


| Basic Information | |
|---|---|
| Family ID | F086855 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 40 residues |
| Representative Sequence | DDTFFIRVTGGDVETKETLRFDVEKKTVEVANRAQGQR |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.82 % |
| % of genes near scaffold ends (potentially truncated) | 97.27 % |
| % of genes from short scaffolds (< 2000 bps) | 89.09 % |
| Associated GOLD sequencing projects | 99 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.23 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (82.727 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (12.727 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.636 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (37.273 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 15.15% Coil/Unstructured: 84.85% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.23 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF03992 | ABM | 20.91 |
| PF07969 | Amidohydro_3 | 19.09 |
| PF00296 | Bac_luciferase | 6.36 |
| PF00106 | adh_short | 3.64 |
| PF02900 | LigB | 3.64 |
| PF13594 | Obsolete Pfam Family | 2.73 |
| PF08843 | AbiEii | 1.82 |
| PF13458 | Peripla_BP_6 | 1.82 |
| PF04909 | Amidohydro_2 | 1.82 |
| PF13378 | MR_MLE_C | 1.82 |
| PF10041 | DUF2277 | 1.82 |
| PF00550 | PP-binding | 0.91 |
| PF04255 | DUF433 | 0.91 |
| PF00496 | SBP_bac_5 | 0.91 |
| PF13561 | adh_short_C2 | 0.91 |
| PF05378 | Hydant_A_N | 0.91 |
| PF14833 | NAD_binding_11 | 0.91 |
| PF03364 | Polyketide_cyc | 0.91 |
| PF00583 | Acetyltransf_1 | 0.91 |
| PF00034 | Cytochrom_C | 0.91 |
| PF05598 | DUF772 | 0.91 |
| PF00903 | Glyoxalase | 0.91 |
| PF03480 | DctP | 0.91 |
| PF00596 | Aldolase_II | 0.91 |
| PF00378 | ECH_1 | 0.91 |
| PF02129 | Peptidase_S15 | 0.91 |
| PF03471 | CorC_HlyC | 0.91 |
| PF13522 | GATase_6 | 0.91 |
| PF01408 | GFO_IDH_MocA | 0.91 |
| PF02730 | AFOR_N | 0.91 |
| PF08352 | oligo_HPY | 0.91 |
| PF02746 | MR_MLE_N | 0.91 |
| PF13419 | HAD_2 | 0.91 |
| PF02515 | CoA_transf_3 | 0.91 |
| PF00702 | Hydrolase | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 6.36 |
| COG0145 | N-methylhydantoinase A/oxoprolinase/acetone carboxylase, beta subunit | Amino acid transport and metabolism [E] | 1.82 |
| COG2253 | Predicted nucleotidyltransferase component of viral defense system | Defense mechanisms [V] | 1.82 |
| COG4948 | L-alanine-DL-glutamate epimerase or related enzyme of enolase superfamily | Cell wall/membrane/envelope biogenesis [M] | 1.82 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.91 |
| COG2414 | Aldehyde:ferredoxin oxidoreductase | Energy production and conversion [C] | 0.91 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.64 % |
| Unclassified | root | N/A | 16.36 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_100485992 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 522 | Open in IMG/M |
| 3300000443|F12B_10233428 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 509 | Open in IMG/M |
| 3300002912|JGI25386J43895_10154149 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300003987|Ga0055471_10087229 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 900 | Open in IMG/M |
| 3300004024|Ga0055436_10005687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2519 | Open in IMG/M |
| 3300004479|Ga0062595_100801922 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300004479|Ga0062595_101081662 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 699 | Open in IMG/M |
| 3300005175|Ga0066673_10350532 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 862 | Open in IMG/M |
| 3300005440|Ga0070705_101783665 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 522 | Open in IMG/M |
| 3300005471|Ga0070698_100013991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 8486 | Open in IMG/M |
| 3300005556|Ga0066707_10544642 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 749 | Open in IMG/M |
| 3300005558|Ga0066698_10902797 | Not Available | 565 | Open in IMG/M |
| 3300005560|Ga0066670_10707941 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 610 | Open in IMG/M |
| 3300005586|Ga0066691_10577857 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 669 | Open in IMG/M |
| 3300005713|Ga0066905_100824231 | Not Available | 806 | Open in IMG/M |
| 3300005829|Ga0074479_10710805 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 594 | Open in IMG/M |
| 3300005844|Ga0068862_100331166 | All Organisms → cellular organisms → Bacteria | 1408 | Open in IMG/M |
| 3300006034|Ga0066656_10793504 | Not Available | 607 | Open in IMG/M |
| 3300006050|Ga0075028_100745059 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 593 | Open in IMG/M |
| 3300006800|Ga0066660_11023756 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300006806|Ga0079220_10307403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 983 | Open in IMG/M |
| 3300006845|Ga0075421_101033655 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300006846|Ga0075430_100716014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 825 | Open in IMG/M |
| 3300006904|Ga0075424_102420267 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 551 | Open in IMG/M |
| 3300007258|Ga0099793_10655099 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300009038|Ga0099829_10701987 | Not Available | 840 | Open in IMG/M |
| 3300009088|Ga0099830_10246946 | All Organisms → cellular organisms → Bacteria | 1411 | Open in IMG/M |
| 3300009137|Ga0066709_103105048 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300009147|Ga0114129_10600341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1426 | Open in IMG/M |
| 3300009177|Ga0105248_10085486 | All Organisms → cellular organisms → Bacteria | 3549 | Open in IMG/M |
| 3300009799|Ga0105075_1042944 | Not Available | 560 | Open in IMG/M |
| 3300009806|Ga0105081_1012351 | Not Available | 962 | Open in IMG/M |
| 3300010047|Ga0126382_10597999 | Not Available | 907 | Open in IMG/M |
| 3300010303|Ga0134082_10170973 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300010321|Ga0134067_10178066 | Not Available | 771 | Open in IMG/M |
| 3300010336|Ga0134071_10697632 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300010359|Ga0126376_13101835 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300010360|Ga0126372_11642253 | Not Available | 682 | Open in IMG/M |
| 3300010362|Ga0126377_10164823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2095 | Open in IMG/M |
| 3300010391|Ga0136847_10141768 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1456 | Open in IMG/M |
| 3300011270|Ga0137391_11395281 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300012205|Ga0137362_11271493 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 621 | Open in IMG/M |
| 3300012207|Ga0137381_10564512 | Not Available | 992 | Open in IMG/M |
| 3300012353|Ga0137367_10158150 | All Organisms → cellular organisms → Bacteria | 1651 | Open in IMG/M |
| 3300012355|Ga0137369_10252912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1331 | Open in IMG/M |
| 3300012685|Ga0137397_10277785 | All Organisms → cellular organisms → Bacteria | 1248 | Open in IMG/M |
| 3300012923|Ga0137359_10316040 | All Organisms → cellular organisms → Bacteria | 1390 | Open in IMG/M |
| 3300012944|Ga0137410_11657047 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300012948|Ga0126375_10210878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1284 | Open in IMG/M |
| 3300012971|Ga0126369_10523052 | Not Available | 1247 | Open in IMG/M |
| 3300014154|Ga0134075_10112816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1152 | Open in IMG/M |
| 3300014262|Ga0075301_1182565 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 505 | Open in IMG/M |
| 3300015052|Ga0137411_1025146 | All Organisms → cellular organisms → Bacteria | 1634 | Open in IMG/M |
| 3300015356|Ga0134073_10067565 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300016404|Ga0182037_11715886 | Not Available | 560 | Open in IMG/M |
| 3300017966|Ga0187776_11012749 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300018053|Ga0184626_10014587 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 3125 | Open in IMG/M |
| 3300018059|Ga0184615_10059912 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2123 | Open in IMG/M |
| 3300018063|Ga0184637_10083563 | All Organisms → cellular organisms → Bacteria | 1960 | Open in IMG/M |
| 3300018063|Ga0184637_10174826 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1322 | Open in IMG/M |
| 3300018063|Ga0184637_10540864 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300018422|Ga0190265_10291868 | All Organisms → cellular organisms → Bacteria | 1697 | Open in IMG/M |
| 3300018422|Ga0190265_11799629 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300018431|Ga0066655_10245573 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
| 3300018468|Ga0066662_12260472 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300018482|Ga0066669_11275903 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 664 | Open in IMG/M |
| 3300018482|Ga0066669_12399844 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300019249|Ga0184648_1183364 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 549 | Open in IMG/M |
| 3300019458|Ga0187892_10032441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 4185 | Open in IMG/M |
| 3300019789|Ga0137408_1044791 | All Organisms → cellular organisms → Bacteria | 2507 | Open in IMG/M |
| 3300020067|Ga0180109_1013196 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 965 | Open in IMG/M |
| 3300021081|Ga0210379_10431669 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300022756|Ga0222622_11089206 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 588 | Open in IMG/M |
| 3300025165|Ga0209108_10266436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 868 | Open in IMG/M |
| 3300025324|Ga0209640_10813712 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300025910|Ga0207684_10314099 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1351 | Open in IMG/M |
| 3300025919|Ga0207657_10294616 | All Organisms → cellular organisms → Bacteria | 1286 | Open in IMG/M |
| 3300025923|Ga0207681_11059950 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300025939|Ga0207665_11451743 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 546 | Open in IMG/M |
| 3300026001|Ga0208000_115385 | Not Available | 511 | Open in IMG/M |
| 3300026095|Ga0207676_12072815 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300026528|Ga0209378_1100830 | All Organisms → cellular organisms → Bacteria | 1275 | Open in IMG/M |
| 3300026536|Ga0209058_1335668 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 522 | Open in IMG/M |
| 3300026538|Ga0209056_10039316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 4358 | Open in IMG/M |
| 3300026552|Ga0209577_10219363 | All Organisms → cellular organisms → Bacteria | 1450 | Open in IMG/M |
| 3300026827|Ga0207591_107563 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 554 | Open in IMG/M |
| 3300027511|Ga0209843_1049717 | Not Available | 742 | Open in IMG/M |
| 3300027862|Ga0209701_10429408 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 731 | Open in IMG/M |
| 3300027907|Ga0207428_10013931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 7005 | Open in IMG/M |
| 3300027909|Ga0209382_10244186 | All Organisms → cellular organisms → Bacteria | 2041 | Open in IMG/M |
| 3300027964|Ga0256864_1156686 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300028809|Ga0247824_10075300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Thermales → Thermaceae → Thermus | 1755 | Open in IMG/M |
| 3300028878|Ga0307278_10356429 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 645 | Open in IMG/M |
| 3300030830|Ga0308205_1031788 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| (restricted) 3300031197|Ga0255310_10089569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 821 | Open in IMG/M |
| 3300031228|Ga0299914_10010253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7162 | Open in IMG/M |
| 3300031538|Ga0310888_10367820 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 837 | Open in IMG/M |
| 3300031716|Ga0310813_11822889 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 572 | Open in IMG/M |
| 3300031740|Ga0307468_100477883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → unclassified Reyranella → Reyranella sp. CPCC 100927 | 980 | Open in IMG/M |
| 3300031764|Ga0318535_10113480 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1193 | Open in IMG/M |
| 3300031833|Ga0310917_10288444 | Not Available | 1109 | Open in IMG/M |
| 3300031894|Ga0318522_10297924 | Not Available | 611 | Open in IMG/M |
| 3300031897|Ga0318520_11016960 | Not Available | 524 | Open in IMG/M |
| 3300032174|Ga0307470_10936318 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 684 | Open in IMG/M |
| 3300032205|Ga0307472_102475237 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 528 | Open in IMG/M |
| 3300033814|Ga0364930_0076585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1142 | Open in IMG/M |
| 3300034056|Ga0373893_062293 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium pilosum | 525 | Open in IMG/M |
| 3300034090|Ga0326723_0270576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 759 | Open in IMG/M |
| 3300034643|Ga0370545_116571 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 595 | Open in IMG/M |
| 3300034664|Ga0314786_072078 | Not Available | 696 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.36% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.45% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.45% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.45% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.55% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.64% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.64% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 2.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.73% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.73% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.73% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.82% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.91% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.91% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.91% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.91% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.91% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.91% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.91% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.91% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.91% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.91% |
| Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 0.91% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.91% |
| Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000443 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly | Environmental | Open in IMG/M |
| 3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
| 3300003987 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 | Environmental | Open in IMG/M |
| 3300004024 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009799 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_0_30 | Environmental | Open in IMG/M |
| 3300009806 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_50_60 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014262 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D1 | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019249 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020067 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT47_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025165 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1 | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026001 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_104 (SPAdes) | Environmental | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026827 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G09A4-11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027511 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027964 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 HiSeq | Environmental | Open in IMG/M |
| 3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300030830 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_368 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
| 3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033814 | Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17 | Environmental | Open in IMG/M |
| 3300034056 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A3A4.3 | Engineered | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| 3300034643 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034664 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1004859921 | 3300000364 | Soil | DDTFFIRVTGGDVETKXTLRFDVEKKTVEVANRAQGQR* |
| F12B_102334281 | 3300000443 | Soil | FFIRVTGGDVETKETNRFDVAKQTVEVANRAMGQR* |
| JGI25386J43895_101541491 | 3300002912 | Grasslands Soil | SIEYGDDTFFIRVTGGDVETKKTLRFDLEKKAVQVADRAQGQR* |
| Ga0055471_100872291 | 3300003987 | Natural And Restored Wetlands | IEYGDDTFFIRVTGGDVESKETLRFDVAGKTVQVANRAQGQR* |
| Ga0055436_100056873 | 3300004024 | Natural And Restored Wetlands | DIHSIEFGDDTFFIRVTGGDVETKDTLRFDVAQNTVEVASRAQGQR* |
| Ga0062595_1008019223 | 3300004479 | Soil | FGDDTFFIRVTGGDVETKETNRFDVAKKTVEVANRAMGQR* |
| Ga0062595_1010816621 | 3300004479 | Soil | FGDDTFFIRVTGGDVETKETHRFDVEKKTVEVANRAIGQR* |
| Ga0066673_103505321 | 3300005175 | Soil | SIEYGDDTFFIRVTGGDVESKQTLKFDAAKKTVEVANRALGQR* |
| Ga0070705_1017836652 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | SIEFGDDTFFIRVTGGDVESKETNRFDVAKQTVEVANRALGQR* |
| Ga0070698_10001399110 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | IHSIEFGDDTFFIRVTGGDVETKETHRFDVEKQTVEVANRAIGQR* |
| Ga0066707_105446422 | 3300005556 | Soil | FGDDTFFIRVTGGDVEKKQTLKFDPDKKTVEVANRALGQR* |
| Ga0066698_109027971 | 3300005558 | Soil | HSIEYGDDTFFIRVTGGDVESQKTLRFDLDKKSVQVADRAQGQR* |
| Ga0066670_107079411 | 3300005560 | Soil | DDTFFIRVTGGDVETKQTLKFDPEKKTVEVANRALGQR* |
| Ga0066691_105778572 | 3300005586 | Soil | TFFIRVTGGDVERKQTLKFDAAKKTVEVANRALGQR* |
| Ga0066905_1008242311 | 3300005713 | Tropical Forest Soil | DDTFFIRVTGGDVEQQKTLRFDPDKKAVQVADRAQGQR* |
| Ga0074479_107108052 | 3300005829 | Sediment (Intertidal) | FIRVTGGDVETKETHRFDVEKKTVEVANRAKGER* |
| Ga0068862_1003311664 | 3300005844 | Switchgrass Rhizosphere | IEFGDDTFFIRVTGGDVETKKTLKFDKDKKTVEVADRAMNQR* |
| Ga0066656_107935042 | 3300006034 | Soil | HSIEYGDDTFFIRVTGGDVESNKTLRFDLEKKSVQVADRAQGQR* |
| Ga0075028_1007450592 | 3300006050 | Watersheds | SIEFGDDTFFIRVTGGDVESKETHRFDVEKKTVQVANRALGQR* |
| Ga0066660_110237562 | 3300006800 | Soil | DDTFFIRVTGGDVETKKTLRFDLEKKTVQVADRAQGQR* |
| Ga0079220_103074031 | 3300006806 | Agricultural Soil | FGDDTFFIRVTGGDVETKETNRFDVHKKTVEVANRALGQR* |
| Ga0075421_1010336553 | 3300006845 | Populus Rhizosphere | TFFIRVTGGDVETKETNRFDVAKQTVEVANRAMGQR* |
| Ga0075430_1007160143 | 3300006846 | Populus Rhizosphere | FGDDTFFIRVTGGDVEIKETLRFDPEKKTVTVANRALGQR* |
| Ga0075424_1024202673 | 3300006904 | Populus Rhizosphere | IEFGDDTFFIRVTGGDVETKQTLKFDVEKKTVEVANRALGQR* |
| Ga0099793_106550991 | 3300007258 | Vadose Zone Soil | SIEYGDDTFFIRVTGGDVESKKTLRFDLEKKSVHVADRAQGQR* |
| Ga0099829_107019871 | 3300009038 | Vadose Zone Soil | DTFFIRVTGGDVETKETLRFDVEKKTVEVANRAKGQR* |
| Ga0099830_102469461 | 3300009088 | Vadose Zone Soil | IEFGDDTFFLRVTGGDVESKETRRFDVEKKTVEIANRALGQR* |
| Ga0066709_1031050482 | 3300009137 | Grasslands Soil | FGNDTFFIRVTGGDVETKETLRFDVEKKTVEVANRAKGQR* |
| Ga0114129_106003413 | 3300009147 | Populus Rhizosphere | EYGNDTFFIRVTGGDVETKQTLKFDVEKKTVEVANRALGQR* |
| Ga0105248_100854865 | 3300009177 | Switchgrass Rhizosphere | DDTFFIRVTGGDVETKETLRFDVEKKTVEVANRAQGQR* |
| Ga0105075_10429441 | 3300009799 | Groundwater Sand | HSIEYGDDTFFIRVTGGDVESQKTLRFDLEKKSVQVADRALGQR* |
| Ga0105081_10123512 | 3300009806 | Groundwater Sand | EYGDDTFFLRVTGGDVESQKTLRFDLDKKSVQVADRAQGQR* |
| Ga0126382_105979991 | 3300010047 | Tropical Forest Soil | TFFIRVTGGDVETKKTLRFDPEKKAVQIADRAQGQR* |
| Ga0134082_101709731 | 3300010303 | Grasslands Soil | FFVRVTGGDVETKETLRFDVEKKTVEIANRAQGQR* |
| Ga0134067_101780662 | 3300010321 | Grasslands Soil | FFLRVTGGDVETKKTLRFDLEKKTVQVADRAQGQR* |
| Ga0134071_106976322 | 3300010336 | Grasslands Soil | DDTFFVRVTGGDVETKETLRFDVEKKTVEIANRARGQR* |
| Ga0126376_131018351 | 3300010359 | Tropical Forest Soil | IHSIEYGDDTIFLRVTGGDVESQETLRFDVEQKTVTVANRALGQR* |
| Ga0126372_116422532 | 3300010360 | Tropical Forest Soil | YGDDTFFIRVTGGDVETKKTLRFDPEKKTVQIADRAQGQR* |
| Ga0126377_101648231 | 3300010362 | Tropical Forest Soil | TFFIRVTGGDVEQQKTLRFDPDKKAVQVADRAQGQR* |
| Ga0136847_101417683 | 3300010391 | Freshwater Sediment | MKYPTGGRHETKETHRFDVGQQTVEVANRAQGQR* |
| Ga0137391_113952813 | 3300011270 | Vadose Zone Soil | DAGSDDTFFIRVTGGDVETRKTLKFDAERKTVEVADRALGQR* |
| Ga0137362_112714932 | 3300012205 | Vadose Zone Soil | DIHSIEFGDDTFFIRVTGGDVETKETHRFDVEKKTVAVANRAIGQR* |
| Ga0137381_105645121 | 3300012207 | Vadose Zone Soil | IEYGDDTFFIRVTGGDVESQKTLRFDLDKKSVQVADRAQGQR* |
| Ga0137367_101581501 | 3300012353 | Vadose Zone Soil | IEFGNDTFFIRVTGGDVETKETLRFDVERKTVEVANRAKGQR* |
| Ga0137369_102529123 | 3300012355 | Vadose Zone Soil | FGDDTFFLRVTGGDVETKDTLRFDVEKKTVEVANRAKGQR* |
| Ga0137397_102777852 | 3300012685 | Vadose Zone Soil | FGDDTFFIRVTGGDVEKQQTLKFDPDKKTVEVANRALGQR* |
| Ga0137359_103160402 | 3300012923 | Vadose Zone Soil | HSIEYGDDTFFIRVTGGDVETMKTLKFDKDKQTVEVADRAMNQR* |
| Ga0137410_116570472 | 3300012944 | Vadose Zone Soil | SIEYGDDTFFIRVTGGDVESKKTLRFDLEQKTVKVADRAQGQR* |
| Ga0126375_102108781 | 3300012948 | Tropical Forest Soil | IFLRVTGGDVESKETHRFDVEKQTVEIANRAMGQR* |
| Ga0126369_105230521 | 3300012971 | Tropical Forest Soil | HSIEYGDDTFFIRVTGGDVEQQKTLRFDPDKKAVQVADRAQGQR* |
| Ga0134075_101128163 | 3300014154 | Grasslands Soil | EYGDDTFFIRVTGGDVESNKTLRFDLEKKSVQVADRAQGQR* |
| Ga0075301_11825652 | 3300014262 | Natural And Restored Wetlands | SIEFGDDTFFIRVTGGDVETKETLRFDVDKKTVTVADRAQGQR* |
| Ga0137411_10251464 | 3300015052 | Vadose Zone Soil | TFFLRVTGGDVETKETHRFDVEKKTVEIANRAKGER* |
| Ga0134073_100675652 | 3300015356 | Grasslands Soil | FFVRVTGGDVETKETLRFDVEKKTVEIANRARGQR* |
| Ga0182037_117158861 | 3300016404 | Soil | DDTFFIRVTGGDVETKKTLRFDPEKKSVQIADRAQGQR |
| Ga0187776_110127492 | 3300017966 | Tropical Peatland | EFGDDTFFLRVTGGDVETKETLRFDVANKTVEVANRAQGQR |
| Ga0184626_100145875 | 3300018053 | Groundwater Sediment | DDTFFLRVTGGDVETKKTLKFDLEKKTVEVADRAMNQR |
| Ga0184615_100599124 | 3300018059 | Groundwater Sediment | FGDDTFFLRVTGGDVESKKTLKFDKDKKTVEVADRAMNQR |
| Ga0184637_100835631 | 3300018063 | Groundwater Sediment | EFGDDTFFLRVTGGDVETKETHRFDVDKQTVEIANRAKGQR |
| Ga0184637_101748264 | 3300018063 | Groundwater Sediment | FFIRVTGGDVETQKTLRFDVEKKTVEVANRALNQR |
| Ga0184637_105408642 | 3300018063 | Groundwater Sediment | DIHSIEFGPDTFFIRVTGGDVESKETFRFDVDKKTVQVANRALGQR |
| Ga0190265_102918681 | 3300018422 | Soil | IHSIEFGDDTFFIRVTGGDVETKETHRFDVEKKTVEIANRAQGQR |
| Ga0190265_117996292 | 3300018422 | Soil | SIEFGDDTFFIRVTGGDVETKKTLKFDKDKKTVEVADRAMNQR |
| Ga0066655_102455731 | 3300018431 | Grasslands Soil | DIHSIEYGNDTFFIRVTGGDVETKQTLKFDPEKKTVEVANRALGQR |
| Ga0066662_122604722 | 3300018468 | Grasslands Soil | SIAYGDYTFFILVTGVDVEKQKTLRFHLEKQTVEVEDRAQHLQ |
| Ga0066669_112759032 | 3300018482 | Grasslands Soil | TFFIRVTGGDVEKKQTLKFDPDKKTVEVANRALGQR |
| Ga0066669_123998442 | 3300018482 | Grasslands Soil | FFIRVTGGDVESKETLRFDVEKKTVEVANRAKGQR |
| Ga0184648_11833642 | 3300019249 | Groundwater Sediment | DDTFFLRVTGGDVETKETHRFDVEKQTVEVANRAKGQR |
| Ga0187892_100324411 | 3300019458 | Bio-Ooze | EYGDDTFFIRVTGGDVESKETHRFDVDKKTVEIANRALGQR |
| Ga0137408_10447911 | 3300019789 | Vadose Zone Soil | IHSIEFGDDTFFLRVTGGDVETKETHRFDVEKKTVEIANRAKGER |
| Ga0180109_10131963 | 3300020067 | Groundwater Sediment | GDDTFFIRVTGGDVETKETLRFDVEKKTVEVANRSQGQR |
| Ga0210379_104316693 | 3300021081 | Groundwater Sediment | DDTFFLRVTGGDVETKKTLKFDKEKKTVEVADRAMNQR |
| Ga0222622_110892061 | 3300022756 | Groundwater Sediment | DIHSIEFGDDTFFLRVTGGDVETKETHRFDVEKKTVEIANRAQGQR |
| Ga0209108_102664363 | 3300025165 | Soil | SIEFGDDTFFIRVTGGDVETNETHRFDVEKKTVEIANRAQGQR |
| Ga0209640_108137121 | 3300025324 | Soil | HSIEFGDDTFFIRVTGGDVETQKTLKFDPDKKTVEIADRALNQR |
| Ga0207684_103140993 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | IEFGDDTFFIRVTGGDVETKQTHRFDVEKKTVEVANRALGQR |
| Ga0207657_102946161 | 3300025919 | Corn Rhizosphere | MPFVFGDDTFFIRVTGGDVETKETLRFDVEKKTVEVANRAQGQR |
| Ga0207681_110599503 | 3300025923 | Switchgrass Rhizosphere | FFIRVTGGDVETKETLRFDVEKKTVEVANRAQGQR |
| Ga0207665_114517432 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | EFGDDTFFIRVTGGDVETKETHRFDVEKKTVEVANRAIGQR |
| Ga0208000_1153851 | 3300026001 | Rice Paddy Soil | EFGDDTFFLRVTGGDVETKETNRFDVEKKTVEVANRALGQR |
| Ga0207676_120728151 | 3300026095 | Switchgrass Rhizosphere | HSIEFGDDTFFIRVTGGDVETKETLRFDVEKKTVEVANRAQGQR |
| Ga0209378_11008301 | 3300026528 | Soil | DDTFFIRVTGGDVETKKTLRFDLEKKTVQVADRAQGQR |
| Ga0209058_13356681 | 3300026536 | Soil | HSIEYGDDTFFIRVTGGDVESKKTLRFDLEKKTVQVADRAQGQR |
| Ga0209056_100393161 | 3300026538 | Soil | FFIRVTGGDVESKKTLRFDLEKKSVQVADRAQGQR |
| Ga0209577_102193631 | 3300026552 | Soil | SIEYGDDTFFIRVTGGDVETKKTLRFDLEKKTVQVADRAQGQR |
| Ga0207591_1075633 | 3300026827 | Soil | YGDDTFFIRVTGGDVETKQTLKFDKDRKTVEVANRAMGQR |
| Ga0209843_10497172 | 3300027511 | Groundwater Sand | SIEYGDDTFFIRVTGGDVESQKTLRFDLEKKSVNVADRAFGQR |
| Ga0209701_104294083 | 3300027862 | Vadose Zone Soil | IEFGDDTFFLRVTGGDVESKETRRFDVEKKTVEIANRALGQR |
| Ga0207428_100139319 | 3300027907 | Populus Rhizosphere | IFIRVTGGDVESKQTFRFDPEKDTVEVANRALGQR |
| Ga0209382_102441861 | 3300027909 | Populus Rhizosphere | EFGDDTFFLRVTGGDVETKETHRFDVDKKTVEIANRALGQR |
| Ga0256864_11566862 | 3300027964 | Soil | IHSIEFGDDTFFIRVTGGDVETQKTLKFDPDRKTVEVADRALNQR |
| Ga0247824_100753001 | 3300028809 | Soil | TFFIRVTGGDVETKQTLKFDAEKKTVEVANRAMGQR |
| Ga0307278_103564292 | 3300028878 | Soil | IEFGDDTFFLRVTGGDVETKKTLKFDLEKKTVEVADRAMNQR |
| Ga0308205_10317881 | 3300030830 | Soil | HSIAYGDDTFFIRVTGGDVEKHKTLRFNLDKQTVEVEDRGQRPR |
| (restricted) Ga0255310_100895693 | 3300031197 | Sandy Soil | DTFFIRVTGGDVETKETRRFDLEKKTVEIANRANGQR |
| Ga0299914_100102537 | 3300031228 | Soil | MSQDTLDGDVETKKTLRFDAEQKTAKVTDRALNQR |
| Ga0310888_103678201 | 3300031538 | Soil | EFGDDTFFIRVTGGDVETKETNRFDVEKKTVEVANRAVGQR |
| Ga0310813_118228891 | 3300031716 | Soil | EFGDDTFFIRVTGGDVETKETHRFDVEKKTVEVVNRALGQR |
| Ga0307468_1004778831 | 3300031740 | Hardwood Forest Soil | HSIEYGDDTFFIRVTGGDVETKKTNKFDPDKKTVEVADRSRGQR |
| Ga0318535_101134802 | 3300031764 | Soil | FFIRVTGGDVETKKTLRFDPEKKTVQIADRAQGQR |
| Ga0310917_102884441 | 3300031833 | Soil | GDDTFFIRVTGGDVETKKTLRFDPEKKTVQIADRAQGQR |
| Ga0318522_102979241 | 3300031894 | Soil | EYGDDTIFIRVTGGDVETKKTLRFDPEKKSVQIADRAQGQR |
| Ga0318520_110169601 | 3300031897 | Soil | EYGDDTFFIRVTGGDVETKKTLRFDPEKKSVQIADRAQGQR |
| Ga0307470_109363183 | 3300032174 | Hardwood Forest Soil | DDTFFIRVTGGDVESKETNRFDVEKKTVEVANRALGQR |
| Ga0307472_1024752371 | 3300032205 | Hardwood Forest Soil | FGDDTFFIRVTGGDVETKETLKFDVEKKTVEIANRALGQR |
| Ga0364930_0076585_2_130 | 3300033814 | Sediment | IEFGDDTFFIRVTGGDVETKETLRFNVKQKTVEVANRAQGQR |
| Ga0373893_062293_2_115 | 3300034056 | Sediment Slurry | DTFFIQVTGGDVETKETLRFDVDKRTVEIADRARGQQ |
| Ga0326723_0270576_651_758 | 3300034090 | Peat Soil | FFIRVTGGDVETKETHRFDVEKKTVEVANRALGQR |
| Ga0370545_116571_442_588 | 3300034643 | Soil | VGDIYSIEFGDDTFFIRVTGGDVETKETHRFDVEKKTMEIANRAKGQR |
| Ga0314786_072078_2_133 | 3300034664 | Soil | SIEYGDDTFFIRVTGGDVETKKTLRFDLEKKSVQIADRAQGQR |
| ⦗Top⦘ |