


| Basic Information | |
|---|---|
| Family ID | F086357 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 111 |
| Average Sequence Length | 43 residues |
| Representative Sequence | EKAVLAESRVEVTGDKSAKTDVEVATNVVDIKRLAGLK |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 111 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 91.89 % |
| % of genes from short scaffolds (< 2000 bps) | 86.49 % |
| Associated GOLD sequencing projects | 100 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.26 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (90.090 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (35.135 % of family members) |
| Environment Ontology (ENVO) | Unclassified (53.153 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (50.450 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 16.67% β-sheet: 0.00% Coil/Unstructured: 83.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.26 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 111 Family Scaffolds |
|---|---|---|
| PF07068 | Gp23 | 98.20 |
| PF00149 | Metallophos | 0.90 |
| PF00487 | FA_desaturase | 0.90 |
| COG ID | Name | Functional Category | % Frequency in 111 Family Scaffolds |
|---|---|---|---|
| COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 0.90 |
| COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 0.90 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 90.09 % |
| All Organisms | root | All Organisms | 9.91 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 35.14% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 7.21% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 5.41% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 5.41% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 4.50% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 4.50% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 2.70% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.70% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 2.70% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.70% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.70% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.80% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.80% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.80% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.80% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.80% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.80% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.90% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.90% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.90% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.90% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.90% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.90% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.90% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.90% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.90% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.90% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.90% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.90% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 0.90% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.90% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2149837010 | Fresh water microbial communities from LaBonte Lake, Laramie, Wyoming, sample from pre-bloom | Environmental | Open in IMG/M |
| 3300001963 | Marine microbial communities from Nags Head, North Carolina, USA - GS013 | Environmental | Open in IMG/M |
| 3300001968 | Marine microbial communities from Lake Gatun, Panama - GS020 | Environmental | Open in IMG/M |
| 3300004765 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004786 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004836 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009239 | Microbial communities of water from Amazon river, Brazil - RCM11 | Environmental | Open in IMG/M |
| 3300009243 | Microbial communities of water from Amazon river, Brazil - RCM13 | Environmental | Open in IMG/M |
| 3300009261 | Microbial communities of water from Amazon river, Brazil - RCM23 | Environmental | Open in IMG/M |
| 3300009426 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 | Environmental | Open in IMG/M |
| 3300009543 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009606 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
| 3300012689 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES065 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012692 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES073 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012694 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES054 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012696 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES083 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012697 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES082 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012699 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES110 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012705 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES047 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012712 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES121 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012714 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES125 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012715 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES122 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012719 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES123 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012720 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES141 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012726 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES115 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012729 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES157 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012730 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES126 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012747 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES063 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012759 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES158 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012763 | Freshwater microbial communities from Lake Simoncouche, Canada - S_140108_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012764 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES155 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012967 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012970 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013079 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES022 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016696 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES024 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016724 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011507AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016741 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071410CT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018041 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018413 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019196 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041406BS (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020347 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994) | Environmental | Open in IMG/M |
| 3300020539 | Freshwater microbial communities from Lake Mendota, WI - 13SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020570 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300023708 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024255 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MG | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024503 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8h | Environmental | Open in IMG/M |
| 3300024513 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8h | Environmental | Open in IMG/M |
| 3300024555 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024561 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024563 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024571 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025091 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025311 | Groundwater microbial communities from Rifle, Colorado - Rifle CSP2_plank lowO2_0.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025379 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025437 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH28Sep08 (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300028079 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Yuk_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028125 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB | Environmental | Open in IMG/M |
| 3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
| 3300031622 | Marine microbial communities from Western Arctic Ocean, Canada - CB4_20m | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300032117 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003 | Environmental | Open in IMG/M |
| 3300032561 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18011 | Environmental | Open in IMG/M |
| 3300032668 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18025 | Environmental | Open in IMG/M |
| 3300032675 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18015 | Environmental | Open in IMG/M |
| 3300032676 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18023 | Environmental | Open in IMG/M |
| 3300032677 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18019 | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034064 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034095 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034108 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157 | Environmental | Open in IMG/M |
| 3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
| 3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| LBLPr_01473710 | 2149837010 | Freshwater | KPVLAESRVEVTGDKSAKTDVTTETSNNVVELKRLAGLK |
| GOS2229_10134864 | 3300001963 | Marine | KATKKADSLVEATGNKSAKAVEATNNTNNVVELKRLAGL* |
| GOS2236_10497823 | 3300001968 | Marine | VLNNGTVPKAEKQMVVESRKEVTGDKSAKVSAEVNDNNVFEIKRLAGLK* |
| Ga0007745_13495341 | 3300004765 | Freshwater Lake | NGSVKTSAPKAVLAESRSEVTGDKTAKTVIEADDSNVIALKRLAGLK* |
| Ga0007753_14145642 | 3300004786 | Freshwater Lake | NNSTPSAAQKPAMLAESRMEVTGDKTAKVNVEHEYNNVVEIKRLAGLK* |
| Ga0007759_114453892 | 3300004836 | Freshwater Lake | SVKKAEKPVLAESRIEVTGDKSAKDDADANNNVIEIRRLAGLK* |
| Ga0049082_102967431 | 3300005584 | Freshwater Lentic | NNGTVKTSAPKAVLAESRSEVTGDKTAKTVVEAHDSNVIALKRLAGLK* |
| Ga0114350_10023097 | 3300008116 | Freshwater, Plankton | MLAESRVEVTGDKSANTPVIEENVHNVFEIKRLAGLK* |
| Ga0102963_10223354 | 3300009001 | Pond Water | QPKAEKQMVTESRKEVTGDKSAKVSVETDDNNVVEIRRLAGLK* |
| Ga0105105_105950462 | 3300009009 | Freshwater Sediment | SEKKQLSESRVEVTGDKTTAKVSVETDFSNVIEIKRLAGLK* |
| Ga0105102_108280452 | 3300009165 | Freshwater Sediment | EKSAMLVESRSAVTGDKTAKVSVETGDNNVIEIKRLAGLK* |
| Ga0103858_100840231 | 3300009239 | River Water | LPAVLNNTQSKVKAEKPMLAESRVELTGDKSAKVDVEVTKDNNVIELKRLAGLK* |
| Ga0103860_100507441 | 3300009243 | River Water | VAPKAAKPAVLAESRVEVTGDKAAKPSAEPDYNNVVEIKRLAGLK* |
| Ga0103870_10532501 | 3300009261 | River Water | AESRVEVTGDKTAKVAAQPAVDTNVVELRRLAGLR* |
| Ga0115547_100214810 | 3300009426 | Pelagic Marine | SKTVSEAKAVLTESRVEVTGDKSAKQTNAKTEDDNNNVVEIKRLAGL* |
| Ga0115099_103523232 | 3300009543 | Marine | ADKPTLAESRVEVSGDKSAKASEENLNNVVEIRRLAGL* |
| Ga0115102_100637272 | 3300009606 | Marine | AVLNNTSKPKADKPTLAESRVEVSGDKSAKASEENLNNVVEIRRLAGL* |
| Ga0129333_101364251 | 3300010354 | Freshwater To Marine Saline Gradient | ESRSEVTGDKTAKPAAAQETATENNVVELKRLAGLK* |
| Ga0129336_106080232 | 3300010370 | Freshwater To Marine Saline Gradient | AESRVEVTGDKSANSLAVEENANNVFEIKRLAGLK* |
| Ga0157203_10149083 | 3300012663 | Freshwater | LNNSSVKKAEKPVLAESRTEVTGDKSAKDDADANNNVIEIRRLAGLK* |
| Ga0157565_11196632 | 3300012689 | Freshwater | NNSSVKPVAEKQVVLTESRSEVTGDKSAKPVEVDTNVIDLRRLAGLK* |
| Ga0157571_11120541 | 3300012692 | Freshwater | SSVKPVAEKQVVLTESRTEVTGDKSAKPVDDDTNVIDIKRLAGLK* |
| Ga0157559_10937621 | 3300012694 | Freshwater | NSSVKPVAEKQVVLTESRSEVTGDKSAKPVEVDTNVIDLRRLAGLK* |
| Ga0157559_11202942 | 3300012694 | Freshwater | VLNNTPAVKAEKAVLAESRVEVTGDKSAKTDVEVATNVVDIKRLAGLK* |
| Ga0157579_10629912 | 3300012696 | Freshwater | NNSVLPKSEKAVLAESRVEVTGDKTAKVSAEPDYNNVVEIKRLAGLK* |
| Ga0157578_10113511 | 3300012697 | Freshwater | KAVLAESRVEVTGDKSAKTDVEVATNVVDIKRLAGLK* |
| Ga0157593_10876812 | 3300012699 | Freshwater | NNSSVKPVAEKQVVLTESRTEVTGDKSAKPVDDDTNVIDIKRLAGLK* |
| Ga0157593_11649262 | 3300012699 | Freshwater | VLNNAPAVKTEKVMIAESRKEVTGDKSAKANVESDNNVVEIRRLAGLK* |
| Ga0157555_11977671 | 3300012705 | Freshwater | NSTVKKPVKAVLSEARVEVTGDKSAIVNVENHDNVIEIKRLAGLK* |
| Ga0157598_12355751 | 3300012712 | Freshwater | TMLAEGRVEVTGDKSANTPAIEENVHNVFEIKRLAGLK* |
| Ga0157601_10579182 | 3300012714 | Freshwater | VESRPRAMLSESRVEVTGDKSANTPVIEENIHNVFEIKRLAGLK* |
| Ga0157599_10604002 | 3300012715 | Freshwater | TAQKPTQQKTMLSESRVEVTGDKSANTPVIEENIHNVFEIKRLAGLK* |
| Ga0157600_10583892 | 3300012719 | Freshwater | VLNNSSVKKAEKPVLAESRVEVTGDKSAKDDADANNNVIEIRRLAGLK* |
| Ga0157613_11809921 | 3300012720 | Freshwater | AVLNNSAKVESRPRAMLSESRVEVTGDKSATTPVIEENIHNVFEIKRLAGLK* |
| Ga0157597_11208981 | 3300012726 | Freshwater | KPVLAESRTEVTGDKSAKDDADTNNNVIEIRRLAGLK* |
| Ga0157625_11221401 | 3300012729 | Freshwater | LNNTPTAKADKAMLSESRVEVTGDKSAKTSEESETNVIEIRRLAGLK* |
| Ga0157602_11894741 | 3300012730 | Freshwater | LNNTPTAKADKAMLSESRVEVTGDKSAKTNVESETNVIEIRRLAGLK* |
| Ga0157602_13313321 | 3300012730 | Freshwater | KAEKAQVLVESRVEVTGDKSAKVAVEFDHNNVIEIKRLAGLK* |
| Ga0157564_10212572 | 3300012747 | Freshwater | SVKPVAEKQVVLTESRTEVTGDKSAKPVDDDTNVIDIKRLAGLK* |
| Ga0157564_10753682 | 3300012747 | Freshwater | VLNNSSVKPVAEKQVVLTESRSEVTGDKSAKPVEVDTNVIDLRRLAGLK* |
| Ga0157626_10371821 | 3300012759 | Freshwater | NNTAQKPTQQKTMLSESRVEVTGDKSANTPVIEENIHNVFEIKRLAGLK* |
| Ga0138289_11263642 | 3300012763 | Freshwater Lake | PSAAQKPAMLAESRMEVTGDKTAKVNVEHEYNNVVEIKRLAGLK* |
| Ga0157624_11299982 | 3300012764 | Freshwater | LNNSSVKKAEKPVLAESRTEVTGDKSAKDDADTNNNVIEIRRLAGLK* |
| Ga0129343_13299381 | 3300012967 | Aqueous | TESRKEVTGDKSAKVSVETDDNNVVEIRRLAGLK* |
| Ga0129338_10916471 | 3300012970 | Aqueous | VLSESRVEVTGDKTAKPAAAQETATENNVVELKRLAGLK* |
| Ga0129338_14731781 | 3300012970 | Aqueous | ANGKAVKEAKAVLTESRVEVTGDKSAKVNAKTDDDNSNVVEIKRLAGLR* |
| Ga0164292_107660472 | 3300013005 | Freshwater | MLSESRVEVTGDKSAKTNVESETNVIEIRRLAGLK* |
| Ga0157536_10427221 | 3300013079 | Freshwater | NNSPTVAKGQKPALTESRVEVTGDKSAKVSAEPDYNNVVEIKRLAGLK* |
| Ga0180049_10928641 | 3300016696 | Freshwater | PAVLNNSTVKKPVKAVLSEARVEVTGDKSAIVNVENHDNVIEIKRLAGLK |
| Ga0182048_13644021 | 3300016724 | Salt Marsh | VAPKSEKSKVLVESRSEVTGDKSAKVSVETEYNNVIEIKRLAGLK |
| Ga0182079_17010261 | 3300016741 | Salt Marsh | QPKAEKQMVTENRKEVTGDKSAKVSVETDDNNVVEIRRLAGLK |
| Ga0181400_11554542 | 3300017752 | Seawater | PAVLNNSSKQKAEKPVLAESRSVATGDKSAKASEENLNNVVEIRRLAGL |
| Ga0181590_100489016 | 3300017967 | Salt Marsh | VLAEGKEVTGNKESAKSDVETPEDNNVVELKRLAGLK |
| Ga0181601_101451751 | 3300018041 | Salt Marsh | KADSLVEATGNKSAKAVKATNNTNNVVELKRLAGL |
| Ga0181560_100063291 | 3300018413 | Salt Marsh | TKAEKSVLAEGKEVTGNKESAKSDVETPEDNNVVELKRLAGLK |
| Ga0182087_10166791 | 3300019196 | Salt Marsh | AKPKADKPVLAESRREATGDKSAKTVDTHEVDNNVIEIKRLAGLK |
| Ga0211504_11237552 | 3300020347 | Marine | YLPAVLNNTSKPKADKPTLAESRVEVSGDKSAKASEENLNNVVEIRRLAGL |
| Ga0207941_10446501 | 3300020539 | Freshwater | SSVKKAEKPVLAESRVEVTGDKSAKDDADANNNVIEIRRLAGLK |
| Ga0208465_10403622 | 3300020570 | Freshwater | LNNTAQKPVAQTKTMLSESRVEVTGDKSANTQTIEENIHNVFEIKRLAGLK |
| Ga0222714_100609004 | 3300021961 | Estuarine Water | SKVLVESRLEVTGDKSAKVSVETEYNNVIEIKRLAGLK |
| Ga0222714_103657122 | 3300021961 | Estuarine Water | KSVLAESRTEVSGDKESANTNAEPDNNVVELRRLAGLK |
| Ga0222713_102405791 | 3300021962 | Estuarine Water | LAESKVEVTGDKSAKTDVEVKDNNVIELKRLAGLK |
| Ga0222713_105434771 | 3300021962 | Estuarine Water | NNVSAKPKAEKPVLAESRTEVTGDKSAKTDDESLNNVVEIRRLAGLK |
| Ga0222712_106236801 | 3300021963 | Estuarine Water | ESRSTVTGDKTAKTVATEQQVNTNVVELKRLAGLK |
| Ga0214919_106645221 | 3300023184 | Freshwater | AMLSESRVEVTGDKSAKTNEESETNVIEIRRLAGLK |
| Ga0228709_10517002 | 3300023708 | Freshwater | NNATLPKAEKQMVVESRKEVTGDKSAKVSAEVNDSNVFEIKRLAGLK |
| (restricted) Ga0233438_100985332 | 3300024255 | Seawater | AERPVLAESRSVLTGDKSAKASEEILNNVVEIRRLAGL |
| Ga0244775_107769522 | 3300024346 | Estuarine | LNNSSVKKAEKPVLAESRIEVTGDKSAKDDADANNNVIEIRRLAGLK |
| Ga0255152_10728921 | 3300024503 | Freshwater | KPAAQPKAMLAESRVEVTGDKAATPAIEENVNNVFEIKRLAGLK |
| Ga0255144_10693462 | 3300024513 | Freshwater | MLAESRVEVTGDKAATPAIEENVNNVFEIKRLAGLK |
| Ga0255280_10623561 | 3300024555 | Freshwater | ESRVEVTGDKTAKPAAAQETAPENNVVELKRLAGLK |
| Ga0255288_10482972 | 3300024561 | Freshwater | SVSQKTEKSSMITESRIEVTGDKSAKSNVELDGNNVIELKRLAGLK |
| Ga0255236_11433221 | 3300024563 | Freshwater | AMLAESRLEVTGDKAAKTNVESTDAHNNVIELKRLAGLN |
| Ga0256302_10231701 | 3300024571 | Freshwater | NTAAVAPRKAMLAESRLEVTGDKAAKTNVESTDAHNNVIELKRLAGLN |
| Ga0256302_11559492 | 3300024571 | Freshwater | VESKPKAMLNEGRVEVTGDKSANTAAVEENANNVFEIKRLAGLK |
| Ga0209616_10129972 | 3300025091 | Freshwater | NNSVAPKAQKPAMLSESRMEVTGDKTAKVNVEHDYNNVVEIKRLAGLK |
| Ga0209535_11491561 | 3300025120 | Marine | AKAVLTESRVEVTGDKSAKQTNAKTEDDSNNVVELKRLAGL |
| Ga0209343_106232611 | 3300025311 | Groundwater | TLNESRTAVTGDKGAKPLQVEAENTDMNNVVELKRLAGLK |
| Ga0208738_10124152 | 3300025379 | Freshwater | LAESRVEVTGDKTAKVSAEPDYNNVVEIKRLAGLK |
| Ga0208742_10742012 | 3300025437 | Freshwater | NTPAVKAEKAVLAESRVEVTGDKSAKTDVEVATNVVDIKRLAGLK |
| Ga0209297_11095062 | 3300027733 | Freshwater Lake | NNSQAPVKAEKSVLAESRVEVTGDKSAKTTITETNNNVVELKRLAGLK |
| Ga0209086_103853851 | 3300027770 | Freshwater Lake | LPAVLNNTPTAKADKAMLSESRVEVTGDKSAKTNVESETNVIEIRRLAGLK |
| Ga0209246_104057012 | 3300027785 | Freshwater Lake | VLNNSSVKKAEKPVLAESRIEVTGDKSAKDDADANNNVIEIRRLAGLK |
| Ga0209107_100722681 | 3300027797 | Freshwater And Sediment | LAESRVEVTGDKTAKINVDNSDSMNTVVEFKRLAGLK |
| Ga0209353_100982481 | 3300027798 | Freshwater Lake | NSTPSAAQKPAMLAESRMEVTGDKTAKVNVEHEYNNVVEIKRLAGLK |
| Ga0209229_102586862 | 3300027805 | Freshwater And Sediment | PAVLNNSSVSVPKAEKQVLAESRVEVTGDKSAKVSVETNDNNVIEIKRLAGLK |
| Ga0255305_10361331 | 3300028079 | Freshwater | TESRVEVTGDKSAKPTVQESTPVENNVVELKRLAGLK |
| Ga0256368_10477172 | 3300028125 | Sea-Ice Brine | AVLTESRVEVTGDKSAKQTNAKTEDDSNNVVELKRLAGL |
| Ga0307378_112135582 | 3300031566 | Soil | LPAVLNNSVAPKAEKSKVLVESRSEVTGDKSAKVSVETEYNNVIEIKRLAGLK |
| Ga0302126_100554932 | 3300031622 | Marine | LNTNGRTVNEAKAMLTENRSEITGDKSAKQTNARTQDDINNVVEIKRLAGLK |
| Ga0315900_103743591 | 3300031787 | Freshwater | AASTAKPKTMLSEGRVEVTGDKSANTPVVEENVHNVFEIKRLAGLK |
| Ga0315900_106543111 | 3300031787 | Freshwater | KAEKAQVLAESRVEVTGDKSAKVAVEFDHNNVIEIKRLAGLK |
| Ga0316218_11303951 | 3300032117 | Freshwater | TTTEKSVMLAESRTEVTGDKTAKAVVVEDTGANANVFELKRLAGLK |
| Ga0316222_12220932 | 3300032561 | Freshwater | NNAPKIKSDKVMIAESRVAVTGDKSAKTDVIETADNVIDIKRLAGLK |
| Ga0316230_10268335 | 3300032668 | Freshwater | AVLAESRVEVTGDKSAKTDVDVATNVVDIKRLAGLK |
| Ga0316225_10198485 | 3300032675 | Freshwater | AVKAEKAVLAESRVEVTGDKSAKTDVEVATNVVDIKRLAGLK |
| Ga0316229_12634231 | 3300032676 | Freshwater | TPAVKAEKAVLAESRVEVTGDKSAKTDVEVATNVVDIKRLAGLK |
| Ga0316227_11390372 | 3300032677 | Freshwater | EKAVLAESRVEVTGDKSAKTDVEVATNVVDIKRLAGLK |
| Ga0334980_0262871_570_677 | 3300033816 | Freshwater | VLAESRVEVTGDKSAKDDADANNNVIEIRRLAGLK |
| Ga0334987_0107518_2021_2131 | 3300034061 | Freshwater | VLVESRVEVTGDKSAKVAVEFDHNNVIEIKRLAGLK |
| Ga0334987_0453802_29_142 | 3300034061 | Freshwater | VLSESRVEVTGDKSANTTAMEDNGNNVFEIKRLAGLK |
| Ga0335001_0135539_1_129 | 3300034064 | Freshwater | VKAEKSVLAESRVEVTGDKSAKTVNLETNNNVVELKRLAGLK |
| Ga0335010_0471910_548_661 | 3300034092 | Freshwater | MLAEGRVEVTGDKSATTPAIEENVHNVFEIKRLAGLK |
| Ga0335012_0331614_649_756 | 3300034093 | Freshwater | MLSESRVEVTGDKSAKTNVESETNVIEIRRLAGLK |
| Ga0335022_0413530_600_725 | 3300034095 | Freshwater | KAEKSVLAESRVEVTGDKSAKTVNLETNNNVVELKRLAGLK |
| Ga0335027_0090192_2_130 | 3300034101 | Freshwater | VKKSEKAILSESRVEITGDKSAKSAAKENDTNVIELKRLAGL |
| Ga0335031_0463902_669_779 | 3300034104 | Freshwater | MLVESRTEVTGDKTAKVSVETGDNNVIEIKRLAGLK |
| Ga0335031_0759095_30_155 | 3300034104 | Freshwater | VKAPKAVLAESRVEVTGDKSAKTSEESETNVIEIRRLAGLK |
| Ga0335050_0057572_6_122 | 3300034108 | Freshwater | MLAESRVEVTGDKSAKINVDNSDSINTVVEFKRLAGLK |
| Ga0335068_0347716_2_142 | 3300034116 | Freshwater | AQKPARQKAVLSESRVEVTGDKSANTTSMEENGNNVFEIKRLAGLK |
| Ga0335033_0258183_1_135 | 3300034117 | Freshwater | PSAAQKPAMLAESRMEVTGDKTAKVNVEHEYNNVVEIKRLAGLK |
| ⦗Top⦘ |