


| Basic Information | |
|---|---|
| Family ID | F086348 |
| Family Type | Metagenome |
| Number of Sequences | 111 |
| Average Sequence Length | 44 residues |
| Representative Sequence | AGVPFMAIIARGEHGYRQRAARFRELGALALLPRVTGLFRILS |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 111 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.90 % |
| % of genes near scaffold ends (potentially truncated) | 98.20 % |
| % of genes from short scaffolds (< 2000 bps) | 89.19 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.55 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (84.685 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (33.333 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.135 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.946 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.62% β-sheet: 0.00% Coil/Unstructured: 63.38% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 111 Family Scaffolds |
|---|---|---|
| PF03747 | ADP_ribosyl_GH | 38.74 |
| PF00430 | ATP-synt_B | 10.81 |
| PF08450 | SGL | 5.41 |
| PF03462 | PCRF | 1.80 |
| PF13426 | PAS_9 | 1.80 |
| PF00213 | OSCP | 1.80 |
| PF05227 | CHASE3 | 1.80 |
| PF03320 | FBPase_glpX | 0.90 |
| PF13579 | Glyco_trans_4_4 | 0.90 |
| PF02311 | AraC_binding | 0.90 |
| PF03764 | EFG_IV | 0.90 |
| PF13899 | Thioredoxin_7 | 0.90 |
| PF14534 | DUF4440 | 0.90 |
| PF00679 | EFG_C | 0.90 |
| PF13683 | rve_3 | 0.90 |
| PF12697 | Abhydrolase_6 | 0.90 |
| PF07690 | MFS_1 | 0.90 |
| PF16694 | Cytochrome_P460 | 0.90 |
| PF02874 | ATP-synt_ab_N | 0.90 |
| COG ID | Name | Functional Category | % Frequency in 111 Family Scaffolds |
|---|---|---|---|
| COG1397 | ADP-ribosylglycohydrolase | Posttranslational modification, protein turnover, chaperones [O] | 38.74 |
| COG0711 | FoF1-type ATP synthase, membrane subunit b or b' | Energy production and conversion [C] | 10.81 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 5.41 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 5.41 |
| COG0216 | Protein chain release factor RF1 | Translation, ribosomal structure and biogenesis [J] | 1.80 |
| COG0712 | FoF1-type ATP synthase, delta subunit | Energy production and conversion [C] | 1.80 |
| COG1186 | Protein chain release factor PrfB | Translation, ribosomal structure and biogenesis [J] | 1.80 |
| COG0480 | Translation elongation factor EF-G, a GTPase | Translation, ribosomal structure and biogenesis [J] | 0.90 |
| COG1494 | Fructose-1,6-bisphosphatase/sedoheptulose 1,7-bisphosphatase or related protein | Carbohydrate transport and metabolism [G] | 0.90 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 84.68 % |
| Unclassified | root | N/A | 15.32 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352024|deeps_contig44597.27974 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1611 | Open in IMG/M |
| 3300001167|JGI12673J13574_1009246 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300001369|JGI12701J14581_1009211 | Not Available | 664 | Open in IMG/M |
| 3300001593|JGI12635J15846_10051833 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3124 | Open in IMG/M |
| 3300001593|JGI12635J15846_10358944 | Not Available | 891 | Open in IMG/M |
| 3300001661|JGI12053J15887_10000576 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 15264 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101560232 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300005174|Ga0066680_10898013 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300005176|Ga0066679_10186321 | Not Available | 1317 | Open in IMG/M |
| 3300005177|Ga0066690_10112700 | All Organisms → cellular organisms → Bacteria | 1759 | Open in IMG/M |
| 3300005184|Ga0066671_10054628 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2038 | Open in IMG/M |
| 3300005332|Ga0066388_102473398 | Not Available | 943 | Open in IMG/M |
| 3300005451|Ga0066681_10597339 | Not Available | 680 | Open in IMG/M |
| 3300005555|Ga0066692_10443704 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 826 | Open in IMG/M |
| 3300005557|Ga0066704_10928856 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300005764|Ga0066903_101322413 | All Organisms → cellular organisms → Bacteria | 1348 | Open in IMG/M |
| 3300006041|Ga0075023_100417554 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300006046|Ga0066652_100935264 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 826 | Open in IMG/M |
| 3300006050|Ga0075028_100738400 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300006173|Ga0070716_101741426 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300006755|Ga0079222_10382039 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300006796|Ga0066665_10982685 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 649 | Open in IMG/M |
| 3300006797|Ga0066659_10206554 | Not Available | 1441 | Open in IMG/M |
| 3300006893|Ga0073928_10199351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodomicrobium | 1569 | Open in IMG/M |
| 3300006893|Ga0073928_11243247 | Not Available | 500 | Open in IMG/M |
| 3300007258|Ga0099793_10006044 | All Organisms → cellular organisms → Bacteria | 4428 | Open in IMG/M |
| 3300009088|Ga0099830_10598903 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 904 | Open in IMG/M |
| 3300009088|Ga0099830_11088583 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 663 | Open in IMG/M |
| 3300009089|Ga0099828_10250811 | All Organisms → cellular organisms → Bacteria | 1587 | Open in IMG/M |
| 3300009089|Ga0099828_11423894 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 612 | Open in IMG/M |
| 3300009090|Ga0099827_10419764 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
| 3300009090|Ga0099827_11474593 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300009176|Ga0105242_10843723 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 911 | Open in IMG/M |
| 3300009635|Ga0116117_1063909 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 908 | Open in IMG/M |
| 3300010048|Ga0126373_10621055 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1135 | Open in IMG/M |
| 3300010048|Ga0126373_10822329 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 991 | Open in IMG/M |
| 3300010048|Ga0126373_12557794 | Not Available | 569 | Open in IMG/M |
| 3300010337|Ga0134062_10156046 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
| 3300010358|Ga0126370_12227151 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300010361|Ga0126378_12868932 | Not Available | 550 | Open in IMG/M |
| 3300011269|Ga0137392_10893359 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 732 | Open in IMG/M |
| 3300011271|Ga0137393_10039866 | All Organisms → cellular organisms → Bacteria | 3616 | Open in IMG/M |
| 3300012096|Ga0137389_10206409 | All Organisms → cellular organisms → Bacteria | 1638 | Open in IMG/M |
| 3300012198|Ga0137364_11428631 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 511 | Open in IMG/M |
| 3300012199|Ga0137383_10102878 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2075 | Open in IMG/M |
| 3300012200|Ga0137382_11298402 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300012202|Ga0137363_10036953 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3417 | Open in IMG/M |
| 3300012202|Ga0137363_11257947 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| 3300012205|Ga0137362_11254516 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300012206|Ga0137380_10163805 | All Organisms → cellular organisms → Bacteria | 2026 | Open in IMG/M |
| 3300012206|Ga0137380_10254648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1582 | Open in IMG/M |
| 3300012208|Ga0137376_10504471 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1049 | Open in IMG/M |
| 3300012208|Ga0137376_10633054 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 924 | Open in IMG/M |
| 3300012209|Ga0137379_11547771 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 563 | Open in IMG/M |
| 3300012351|Ga0137386_10169018 | All Organisms → cellular organisms → Bacteria | 1567 | Open in IMG/M |
| 3300012351|Ga0137386_10562567 | Not Available | 821 | Open in IMG/M |
| 3300012357|Ga0137384_11129479 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300012359|Ga0137385_11331693 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 581 | Open in IMG/M |
| 3300012363|Ga0137390_10554718 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1119 | Open in IMG/M |
| 3300012582|Ga0137358_10178589 | All Organisms → cellular organisms → Bacteria | 1448 | Open in IMG/M |
| 3300012918|Ga0137396_11290391 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300012922|Ga0137394_10706122 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 849 | Open in IMG/M |
| 3300012922|Ga0137394_10954492 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 714 | Open in IMG/M |
| 3300012923|Ga0137359_10916790 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 755 | Open in IMG/M |
| 3300012925|Ga0137419_11070810 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 670 | Open in IMG/M |
| 3300012931|Ga0153915_12077828 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300012944|Ga0137410_10122030 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1956 | Open in IMG/M |
| 3300012948|Ga0126375_11442567 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300012964|Ga0153916_10311256 | All Organisms → cellular organisms → Bacteria | 1614 | Open in IMG/M |
| 3300012971|Ga0126369_10499488 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1274 | Open in IMG/M |
| 3300012976|Ga0134076_10285474 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 712 | Open in IMG/M |
| 3300012977|Ga0134087_10767934 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300015054|Ga0137420_1048856 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1767 | Open in IMG/M |
| 3300015242|Ga0137412_10870617 | Not Available | 655 | Open in IMG/M |
| 3300015356|Ga0134073_10378253 | Not Available | 528 | Open in IMG/M |
| 3300015357|Ga0134072_10334525 | Not Available | 576 | Open in IMG/M |
| 3300015358|Ga0134089_10193727 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300017943|Ga0187819_10807119 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300018012|Ga0187810_10161813 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 901 | Open in IMG/M |
| 3300021168|Ga0210406_10664788 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 806 | Open in IMG/M |
| 3300021432|Ga0210384_10673518 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 926 | Open in IMG/M |
| 3300021474|Ga0210390_10342729 | All Organisms → cellular organisms → Bacteria | 1265 | Open in IMG/M |
| 3300021479|Ga0210410_11243379 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 637 | Open in IMG/M |
| 3300021560|Ga0126371_10564342 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1287 | Open in IMG/M |
| 3300025915|Ga0207693_10447918 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
| 3300025934|Ga0207686_10973102 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 688 | Open in IMG/M |
| 3300025939|Ga0207665_10941671 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 686 | Open in IMG/M |
| 3300026308|Ga0209265_1050913 | Not Available | 1276 | Open in IMG/M |
| 3300026309|Ga0209055_1245293 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 553 | Open in IMG/M |
| 3300026319|Ga0209647_1194363 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 722 | Open in IMG/M |
| 3300026333|Ga0209158_1276495 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
| 3300026551|Ga0209648_10025088 | All Organisms → cellular organisms → Bacteria | 5210 | Open in IMG/M |
| 3300027603|Ga0209331_1062707 | Not Available | 931 | Open in IMG/M |
| 3300027629|Ga0209422_1012944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodomicrobium | 2059 | Open in IMG/M |
| 3300027635|Ga0209625_1010949 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1974 | Open in IMG/M |
| 3300027706|Ga0209581_1145985 | Not Available | 773 | Open in IMG/M |
| 3300027787|Ga0209074_10339930 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300027846|Ga0209180_10030204 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2917 | Open in IMG/M |
| 3300027882|Ga0209590_10391016 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 898 | Open in IMG/M |
| 3300028047|Ga0209526_10071204 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2446 | Open in IMG/M |
| 3300028047|Ga0209526_10703021 | Not Available | 636 | Open in IMG/M |
| 3300031231|Ga0170824_108840295 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300031231|Ga0170824_118876540 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300031231|Ga0170824_121338340 | All Organisms → cellular organisms → Bacteria | 1292 | Open in IMG/M |
| 3300031754|Ga0307475_10177422 | All Organisms → cellular organisms → Bacteria | 1699 | Open in IMG/M |
| 3300031754|Ga0307475_10636046 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 853 | Open in IMG/M |
| 3300031754|Ga0307475_11247004 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
| 3300031820|Ga0307473_10436335 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 868 | Open in IMG/M |
| 3300031823|Ga0307478_11237370 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300032180|Ga0307471_102732186 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
| 3300032261|Ga0306920_103771927 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 33.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.71% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 9.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.21% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.41% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.60% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.70% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.70% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.80% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.80% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.80% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.80% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.80% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.80% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.90% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.90% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 3300001167 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 | Environmental | Open in IMG/M |
| 3300001369 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deeps_00087360 | 2199352024 | Soil | EAGVPFMAIIAAHEHGYRARAAAFRKLGALALLPRATALNAWLTNIR |
| JGI12673J13574_10092462 | 3300001167 | Forest Soil | GVPFIAIIAEGEHGYRARAAAFRKLGALALLPRATALNKWLVGRR* |
| JGI12701J14581_10092112 | 3300001369 | Forest Soil | FMAIIAQGEHGYRARASAFRKLGALALLPRATALNKWLVARP* |
| JGI12635J15846_100518331 | 3300001593 | Forest Soil | ALAARDANVPFMAIIARGEHGYRQRAARFRELGALALLPRATELFRILK* |
| JGI12635J15846_103589442 | 3300001593 | Forest Soil | LAARDAGVPFMAIIAEGEHGYRARAAVFRKLGALALLPRATALNQWLVGRP* |
| JGI12053J15887_1000057616 | 3300001661 | Forest Soil | MAIIGEGEYGYRARASAFRKLGALALLPRATALNKWLVARP* |
| JGIcombinedJ26739_1015602323 | 3300002245 | Forest Soil | AGVPFMAIIAEDEHGYRARAAAFRKLGALALLPGATALNKWLAARR* |
| Ga0066680_108980131 | 3300005174 | Soil | AGVPFMAIIARGEHGYRQRAARFRELGALALLPRVTGLFRILS* |
| Ga0066679_101863211 | 3300005176 | Soil | LAIIARDEHRFRERAARFRELGALALLPRATELNRILPQ* |
| Ga0066690_101127004 | 3300005177 | Soil | VPFMAIIAPGEHGYRERAKRFRELGALALLPRATDLRHWLS* |
| Ga0066671_100546281 | 3300005184 | Soil | PFMAIIAPGEYGYRQRAARFRELGALALLPRVKELFGYLKKAD* |
| Ga0066388_1024733982 | 3300005332 | Tropical Forest Soil | AIIAVGEHNYRKRAAKFRALGAVALLPRATAVNRWLKSSTR* |
| Ga0066681_105973391 | 3300005451 | Soil | FMAVIARGEHGYRQRAAQFRELGAIALLPRVTELFRKLK* |
| Ga0066692_104437041 | 3300005555 | Soil | NVPFMAIIAPGEHGYLERAARFRELGALALLPRASDLNRRLA* |
| Ga0066704_109288562 | 3300005557 | Soil | DASVSFMAIIAPGEHGYRQRAARFRELGAIALLPRVAELFRKLK* |
| Ga0066903_1013224133 | 3300005764 | Tropical Forest Soil | FAIIAPGEHGYRERAARFKELGALGLLRRATDLKDYLKPQRPAK* |
| Ga0075023_1004175542 | 3300006041 | Watersheds | GVPFMAIIAPGEHRYRQRAARFRELGALALLPRATNLSAWLKYDD* |
| Ga0066652_1009352642 | 3300006046 | Soil | LAARDAGVPFMAIIAPGEHGYRQRAAHFHEVGALALLPRVKELFRHLKKAN* |
| Ga0075028_1007384001 | 3300006050 | Watersheds | MAIIAPGEHRYRQRAARFRELGALALLPRVTELFRILK* |
| Ga0070716_1017414261 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | RDAGVPFMAIIAPGEHGYRERAKRFRELGALALLPRATDLRYWLS* |
| Ga0079222_103820392 | 3300006755 | Agricultural Soil | AARDAGVPFVAIIAAGEHGYRERAAIFRKLGAVRLLAGAGDLNRLLPAKKNRT* |
| Ga0066665_109826852 | 3300006796 | Soil | DAGVPFLAIIAPGEHGYRQRAARFRALGALALLPRANELSRYLKKAN* |
| Ga0066659_102065541 | 3300006797 | Soil | RDAGVPFLAIIARDEHRYRERATRFRKLGALALLPRATELNRILPQ* |
| Ga0073928_101993512 | 3300006893 | Iron-Sulfur Acid Spring | ARDAGVPFMAIIAESEHGYRARASAFRKLGALALLPRATALNKWLAVRP* |
| Ga0073928_112432471 | 3300006893 | Iron-Sulfur Acid Spring | PFMAFIAPGEHGFRARSRRFRELGALALLPRAKDLNHWLMKAGKINALAS* |
| Ga0099793_100060441 | 3300007258 | Vadose Zone Soil | IAPGEHGYRQRAARFRELGALALLPRANELSRYLKKAD* |
| Ga0099830_105989031 | 3300009088 | Vadose Zone Soil | ALAAREASVPFVAIIAPGEHRYRQRAARFRELGARALLPRVTDLFRILK* |
| Ga0099830_110885832 | 3300009088 | Vadose Zone Soil | ALAAREASVPFVAIIAPGEHRYRQRAARFRELGACALLPRVTDLFRILK* |
| Ga0099828_102508111 | 3300009089 | Vadose Zone Soil | ARDASVPFMAIIAPGEHGYRQRAARFRELGALALLPRVTELFRILK* |
| Ga0099828_114238941 | 3300009089 | Vadose Zone Soil | ANVPFMAIVAPGEDGYRRRAARFRELGALALLPRLAELFRILKQI* |
| Ga0099827_104197641 | 3300009090 | Vadose Zone Soil | LAARDAGVPFMAIIAPGEHRYRERAARFRELGAIALLQRATDLNTWLE* |
| Ga0099827_114745931 | 3300009090 | Vadose Zone Soil | RDAGVPFMAVIAPDEHRYRQRAARFRELGAVALLPRATDLNAWLK* |
| Ga0105242_108437232 | 3300009176 | Miscanthus Rhizosphere | RDAGVPFFAILPPGSHDYRKRAARFRELGAIALLPRATALNSWLAESGNSAAT* |
| Ga0116117_10639091 | 3300009635 | Peatland | AARDAGVPFMAIIAPGEHGYRARAKRFRELGALGLLPRATDLNRWLKVKAEC* |
| Ga0126373_106210551 | 3300010048 | Tropical Forest Soil | ALAARDAGVPFFAIIARDEHRYRERVARFRELGALALLPRATELNRWLS* |
| Ga0126373_108223292 | 3300010048 | Tropical Forest Soil | PFFAIIARDEHRYRERATRFRELGALALLPRATELDRLLRPT* |
| Ga0126373_125577942 | 3300010048 | Tropical Forest Soil | VPFMAIIAQEEHRYRERAARFRELGALALLPRATELNRLLA* |
| Ga0134062_101560463 | 3300010337 | Grasslands Soil | IIAPDEHGYRERSKRFRELGALALLPRATDLQKWLA* |
| Ga0126370_122271511 | 3300010358 | Tropical Forest Soil | REAGVPFLAIIAPGEHRYRERAAKFRELGALGLLHRATELNRWLA* |
| Ga0126378_128689322 | 3300010361 | Tropical Forest Soil | VPFMAIIARGEHRYRERAARFRELGAMALLPRATELNRLLA* |
| Ga0137392_108933591 | 3300011269 | Vadose Zone Soil | ARDANVPFMAIIARGEHRYHQRAARFRELGALALLPRVTELFRILK* |
| Ga0137393_100398667 | 3300011271 | Vadose Zone Soil | AGVPFMAIIAGGEYGYRQRAARFRELGAVALLPRATELKRLLK* |
| Ga0137389_102064093 | 3300012096 | Vadose Zone Soil | APGEHGYRQRAARFRELGALALLPRANELSRYLKKAD* |
| Ga0137364_114286312 | 3300012198 | Vadose Zone Soil | LAIIAPGEHGYRQRAARFRELGALALLSRANELSRYLKEAN* |
| Ga0137383_101028781 | 3300012199 | Vadose Zone Soil | MAIIASGEHGYRQRAARFRELGALALLPRVTGLFRILK* |
| Ga0137382_112984022 | 3300012200 | Vadose Zone Soil | LAIIAPGEHGYRQRAARFRELGALALLSRANELSRYLKAAN* |
| Ga0137363_100369534 | 3300012202 | Vadose Zone Soil | AIIAPGEHGYRQRAARFRELGALALLPRANELSRYLKKAD* |
| Ga0137363_112579472 | 3300012202 | Vadose Zone Soil | FLAIIAPGEHRYRQRAARFRKLGALALLPRAKDLNTWLK* |
| Ga0137362_112545162 | 3300012205 | Vadose Zone Soil | AARQANVPFMAIIAPGEHGYRQRARRFRELGALALLPRVKDLFRTLK* |
| Ga0137380_101638051 | 3300012206 | Vadose Zone Soil | ARDAGVPFVAIIGRGEHGYRQRAARFREVGALALLPRVTELFRILK* |
| Ga0137380_102546483 | 3300012206 | Vadose Zone Soil | RDAGVPFMAIIAPAEHRYRERAARFRELGAIALLQRAADLNTWLE* |
| Ga0137376_105044712 | 3300012208 | Vadose Zone Soil | GVPFLAIIAPGEHGYRQRAARFRALGALALLPRANELSRYLKKAN* |
| Ga0137376_106330542 | 3300012208 | Vadose Zone Soil | GVPFLAIIAPGEHGYRQRAARFRELGALALLPRASELSRYLKETN* |
| Ga0137379_115477712 | 3300012209 | Vadose Zone Soil | AAVPFMAIIAPGEHRYRERAARFRALGAIALLQRATDLNTWLE* |
| Ga0137386_101690181 | 3300012351 | Vadose Zone Soil | ARGANVPFMAIIAPGEHGYRQRAARFRELGALALLPRVTELFRILK* |
| Ga0137386_105625671 | 3300012351 | Vadose Zone Soil | IIAHDEHGYRERAARFRELGALALLPRVAELNRWLS* |
| Ga0137384_111294792 | 3300012357 | Vadose Zone Soil | MAIIAPGEHRYRERAARFRELGAIALLQRAADLNTWLE* |
| Ga0137385_113316932 | 3300012359 | Vadose Zone Soil | ALAAREAAVPFMAIIAPGEHRYHERAARFRALGAIALLQRATDLNTWLE* |
| Ga0137390_105547181 | 3300012363 | Vadose Zone Soil | REANVPFMAIIAPGEHGYRQRARRFRDLGARALLPRVKDLFRTLK* |
| Ga0137358_101785891 | 3300012582 | Vadose Zone Soil | LAARDARVPFMAIIAPGEHGYRERAKRFRELGALALLPRATDLRHWLS* |
| Ga0137396_112903912 | 3300012918 | Vadose Zone Soil | RAAGVPFMAIIAPGEDGYRQRAAQFRELGALALLPRATELKRWLK* |
| Ga0137394_107061221 | 3300012922 | Vadose Zone Soil | LAARDAGVPFLAIIAPGEHRYRQRAARFRELGALALLPRATGLNRWLK* |
| Ga0137394_109544922 | 3300012922 | Vadose Zone Soil | AIIAAGEHGYRQRAARFRELGALALLPRVTNLFRILG* |
| Ga0137359_109167901 | 3300012923 | Vadose Zone Soil | RDAGVPFLAIIAPGEHGYRQRAARFRELGALAFLPRANELSRYLKKTN* |
| Ga0137419_110708102 | 3300012925 | Vadose Zone Soil | PFLAIIAPGEHGYRQRAARFRELGALALLPRANELSRYLKKAN* |
| Ga0153915_120778282 | 3300012931 | Freshwater Wetlands | RDAGVPFLAVLPRSAHAYRAQAAQFRKLGALALLHRATELTRWLASPR* |
| Ga0137410_101220301 | 3300012944 | Vadose Zone Soil | RDAGVPFLAIIASGEHGYRQRAARFRELGALALLPRVNELFRYLKKTN* |
| Ga0126375_114425671 | 3300012948 | Tropical Forest Soil | GVPFLAIIAAGEHNYRARAAQFRELGAVALLPRAVAVNAWLRKNATKLKV* |
| Ga0153916_103112563 | 3300012964 | Freshwater Wetlands | AARDAGVPFLAVLPRSAHAYRAQAAQFRKLGALALLQRATELTRWLASLR* |
| Ga0126369_104994883 | 3300012971 | Tropical Forest Soil | AIIARNEHRYRERAARFRELGALALLPRATELERLLPYA* |
| Ga0134076_102854742 | 3300012976 | Grasslands Soil | AAGVPFMAIIAPGEHGYRQRAARFRELGAIALLPRVAELFRKLK* |
| Ga0134087_107679342 | 3300012977 | Grasslands Soil | DAGVPFMAIIAPGEYGYRQRAARFRELGALALLPRVKELFGYLKKAD* |
| Ga0137420_10488562 | 3300015054 | Vadose Zone Soil | GEHGYRQRAARFRELGALALLPRVNELFRYLKKTN* |
| Ga0137412_108706172 | 3300015242 | Vadose Zone Soil | MAIIAAGEHGYRQRAARFRELGALALLPLVTGLFRVLK* |
| Ga0134073_103782531 | 3300015356 | Grasslands Soil | IARGEHGYRQRAAQFRELGAIALLPRVTELFRKLK* |
| Ga0134072_103345252 | 3300015357 | Grasslands Soil | FLAIIARDEHRYRERATRFRKLWALALLPRATELNRILPQ* |
| Ga0134089_101937272 | 3300015358 | Grasslands Soil | VPFMAIIAPGEHRYRERAARFRELGAIALLQRATDLNTWLE* |
| Ga0187819_108071192 | 3300017943 | Freshwater Sediment | EAGVPFLAIIAPGEHSYRERARRFRELGALALLRRATELNRWLKLHAAPAWKKAI |
| Ga0187810_101618132 | 3300018012 | Freshwater Sediment | AIVAPGEIRARERAARFRELGALALLPRVTKLFGLLK |
| Ga0210406_106647882 | 3300021168 | Soil | MAIIAPGEHRYRQRAARFRELGALAFLPRATDLNRWLR |
| Ga0210384_106735181 | 3300021432 | Soil | IIAPGEHGYRQRAARFRELGALALLPRANELSRFLKKAS |
| Ga0210390_103427291 | 3300021474 | Soil | MAIIAEGEHGYRARAAAFRKLGALALLPRATALNKWLVVRR |
| Ga0210410_112433791 | 3300021479 | Soil | MAIIARGEHGYRQRAARFRELGALALLPRVTELFRILK |
| Ga0126371_105643423 | 3300021560 | Tropical Forest Soil | ARDAGVPFMAIIATGEHGYRERAKRFRELGALALLPRATDLNKFL |
| Ga0207693_104479183 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | LAARDAGVPFMTIIAEGEHGYRARASAFRKLGALALLPRATALNKWLVAR |
| Ga0207686_109731021 | 3300025934 | Miscanthus Rhizosphere | RDAGVPFFAILPPGSHDYRKRAARFRELGAIALLPRATALNSWLAESGNSAAT |
| Ga0207665_109416712 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | LAARDAGVPFMAIIAPGEHGYRERAKRFRELGALALLPRATDLRYWLS |
| Ga0209265_10509131 | 3300026308 | Soil | DAGVPFLAIIARDEHRFRERAARFRELGALALLPRATELNRILPQ |
| Ga0209055_12452932 | 3300026309 | Soil | DALAARDASVSFMAIIAPGEHGYRQRAARFRELGAIALLPRVAELFRKLK |
| Ga0209647_11943632 | 3300026319 | Grasslands Soil | EANVPFMAIIAAGEHGYRQRAARFRELGALALLPRVTNLFRILG |
| Ga0209158_12764951 | 3300026333 | Soil | MAIIAPGEHGFGQRAARFRELGALALLPRATDLNRRLA |
| Ga0209648_100250887 | 3300026551 | Grasslands Soil | RDAGVPFMAIIAPGEHGYQQRAARFRELGALALLPRANELSGYLKKAN |
| Ga0209331_10627072 | 3300027603 | Forest Soil | DAGVPFMAIIAEGEHGYRARASVFRKLGALALLPRATALNKWLAVRS |
| Ga0209422_10129442 | 3300027629 | Forest Soil | AARDAGVPFMAIIAEGEHGYRARAAVFRKLGALALLPRATALNQWLVGRP |
| Ga0209625_10109495 | 3300027635 | Forest Soil | FMAIIAQGEHGYRARGAAFRKLGALALLPRATTLNKWLAARR |
| Ga0209581_11459851 | 3300027706 | Surface Soil | GEHNYRARAKRFRELGALALLPKATELNQWLAPKK |
| Ga0209074_103399302 | 3300027787 | Agricultural Soil | VPFVAIIAAGEHGYRERAAIFRKLGAVRLLAGAGDLNRLLPAKKNRT |
| Ga0209180_100302041 | 3300027846 | Vadose Zone Soil | SVPFVAIIAPGEHRYRQRAARFRELGACALLPRVTDLFRILK |
| Ga0209590_103910162 | 3300027882 | Vadose Zone Soil | VPFVAIIAAGEHRYRQRAARFRELGACALLPGVTELFRILK |
| Ga0209526_100712041 | 3300028047 | Forest Soil | MAIIAPNEHGYRARAATFRKLGARALLPRATRLNAWLATPT |
| Ga0209526_107030212 | 3300028047 | Forest Soil | FVAIIAQGEHGYRARASAFRKLGALALLPRATALNKWLVARP |
| Ga0170824_1088402951 | 3300031231 | Forest Soil | RDAGVPFMAIIAEGEHGYRARAPAFRKLGALALLPRATALNKWLVGQR |
| Ga0170824_1188765402 | 3300031231 | Forest Soil | ALAARDAGVPFMAIIAAHEHGYRARAAAFRNLGALALLPRATALNSFLTNRR |
| Ga0170824_1213383401 | 3300031231 | Forest Soil | MAIIAEGEHGYRARAAAFRKFGALALLPRATVLNKWLVARR |
| Ga0307475_101774221 | 3300031754 | Hardwood Forest Soil | ARDAGVPFMAIIARGEHGYRQRAGRFRELGALALLPRVTGLFRILK |
| Ga0307475_106360461 | 3300031754 | Hardwood Forest Soil | ALAAREAQVPFIAILPLGAHASRERAKKFRELGALGLLPRATDLNHWLRPI |
| Ga0307475_112470042 | 3300031754 | Hardwood Forest Soil | FLAIIAPGEHGYRQRAARFRELGALALLPRASELSRYLKKTN |
| Ga0307473_104363351 | 3300031820 | Hardwood Forest Soil | FLAIIAPGEHRYRLRAARFRELGALALLSRATELNRWLK |
| Ga0307478_112373701 | 3300031823 | Hardwood Forest Soil | VPFMAIIAPGEHGYRQRAARFRELGARALLGRVTELFRILK |
| Ga0307471_1027321861 | 3300032180 | Hardwood Forest Soil | APGEYGYRQRAARFRELGALALLPRVKELFGYLKKAD |
| Ga0306920_1037719271 | 3300032261 | Soil | AARNAGVRFVGLLLPGQSRYRERAARFRELGALALLPRARDLDTLLQVP |
| ⦗Top⦘ |