


| Basic Information | |
|---|---|
| Family ID | F086131 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 111 |
| Average Sequence Length | 50 residues |
| Representative Sequence | MYMRIIWGRIASGQWDAFEAAYKKATALRGDVKGLKNQWLARDQADPDAGY |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 111 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 97.30 % |
| % of genes near scaffold ends (potentially truncated) | 91.89 % |
| % of genes from short scaffolds (< 2000 bps) | 97.30 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (63.063 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (11.712 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.829 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (51.351 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.44% β-sheet: 0.00% Coil/Unstructured: 64.56% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 111 Family Scaffolds |
|---|---|---|
| PF08734 | GYD | 28.83 |
| PF07311 | Dodecin | 6.31 |
| PF00496 | SBP_bac_5 | 1.80 |
| PF02371 | Transposase_20 | 1.80 |
| PF03992 | ABM | 1.80 |
| PF14294 | DUF4372 | 0.90 |
| PF05368 | NmrA | 0.90 |
| PF02538 | Hydantoinase_B | 0.90 |
| PF01042 | Ribonuc_L-PSP | 0.90 |
| PF02586 | SRAP | 0.90 |
| PF07908 | Obsolete Pfam Family | 0.90 |
| PF00872 | Transposase_mut | 0.90 |
| PF02668 | TauD | 0.90 |
| PF03548 | LolA | 0.90 |
| PF13546 | DDE_5 | 0.90 |
| PF08883 | DOPA_dioxygen | 0.90 |
| PF01053 | Cys_Met_Meta_PP | 0.90 |
| PF00210 | Ferritin | 0.90 |
| PF13358 | DDE_3 | 0.90 |
| PF09996 | DUF2237 | 0.90 |
| PF01425 | Amidase | 0.90 |
| PF00924 | MS_channel | 0.90 |
| COG ID | Name | Functional Category | % Frequency in 111 Family Scaffolds |
|---|---|---|---|
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 28.83 |
| COG3360 | Flavin-binding protein dodecin | General function prediction only [R] | 6.31 |
| COG0146 | N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunit | Amino acid transport and metabolism [E] | 1.80 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.80 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.90 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.90 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.90 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.90 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.90 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.90 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.90 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.90 |
| COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.90 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.90 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.90 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.90 |
| COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 0.90 |
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.90 |
| COG2834 | Outer membrane lipoprotein-sorting protein | Cell wall/membrane/envelope biogenesis [M] | 0.90 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.90 |
| COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 0.90 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.90 |
| COG3805 | Aromatic ring-cleaving dioxygenase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.90 |
| COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 0.90 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 63.06 % |
| Unclassified | root | N/A | 36.94 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004081|Ga0063454_101866976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia xenovorans | 528 | Open in IMG/M |
| 3300004157|Ga0062590_100857074 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 844 | Open in IMG/M |
| 3300005093|Ga0062594_100317745 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1198 | Open in IMG/M |
| 3300005165|Ga0066869_10145290 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 509 | Open in IMG/M |
| 3300005328|Ga0070676_10981193 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 633 | Open in IMG/M |
| 3300005329|Ga0070683_102415606 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 504 | Open in IMG/M |
| 3300005332|Ga0066388_105121370 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 666 | Open in IMG/M |
| 3300005356|Ga0070674_102097348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia xenovorans | 516 | Open in IMG/M |
| 3300005436|Ga0070713_100308512 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1459 | Open in IMG/M |
| 3300005445|Ga0070708_101474129 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 634 | Open in IMG/M |
| 3300005614|Ga0068856_102027914 | Not Available | 585 | Open in IMG/M |
| 3300005713|Ga0066905_101298757 | Not Available | 654 | Open in IMG/M |
| 3300005842|Ga0068858_101671498 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 629 | Open in IMG/M |
| 3300006028|Ga0070717_10080978 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2725 | Open in IMG/M |
| 3300006172|Ga0075018_10082487 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1398 | Open in IMG/M |
| 3300006175|Ga0070712_101889605 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 523 | Open in IMG/M |
| 3300006176|Ga0070765_101010482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 786 | Open in IMG/M |
| 3300006196|Ga0075422_10317880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 671 | Open in IMG/M |
| 3300006358|Ga0068871_101592896 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 618 | Open in IMG/M |
| 3300006847|Ga0075431_101810256 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 567 | Open in IMG/M |
| 3300006852|Ga0075433_10442318 | Not Available | 1146 | Open in IMG/M |
| 3300006871|Ga0075434_101180335 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 778 | Open in IMG/M |
| 3300009094|Ga0111539_10083299 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3761 | Open in IMG/M |
| 3300009094|Ga0111539_13217765 | Not Available | 526 | Open in IMG/M |
| 3300009147|Ga0114129_11241583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 926 | Open in IMG/M |
| 3300009148|Ga0105243_10344513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1366 | Open in IMG/M |
| 3300009177|Ga0105248_11026293 | Not Available | 932 | Open in IMG/M |
| 3300009177|Ga0105248_11358979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 804 | Open in IMG/M |
| 3300009177|Ga0105248_12238385 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300009792|Ga0126374_10794320 | Not Available | 722 | Open in IMG/M |
| 3300009792|Ga0126374_11004574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 655 | Open in IMG/M |
| 3300009840|Ga0126313_10049446 | All Organisms → cellular organisms → Bacteria | 2959 | Open in IMG/M |
| 3300010045|Ga0126311_10504045 | Not Available | 947 | Open in IMG/M |
| 3300010045|Ga0126311_10651554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila → Rhodopila globiformis | 838 | Open in IMG/M |
| 3300010154|Ga0127503_10202890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 912 | Open in IMG/M |
| 3300010358|Ga0126370_10420186 | All Organisms → cellular organisms → Bacteria | 1105 | Open in IMG/M |
| 3300010360|Ga0126372_10660848 | Not Available | 1013 | Open in IMG/M |
| 3300010375|Ga0105239_12714129 | Not Available | 578 | Open in IMG/M |
| 3300010376|Ga0126381_100913205 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1264 | Open in IMG/M |
| 3300010398|Ga0126383_12882397 | Not Available | 562 | Open in IMG/M |
| 3300010400|Ga0134122_11129023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 779 | Open in IMG/M |
| 3300010401|Ga0134121_11648382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 663 | Open in IMG/M |
| 3300011119|Ga0105246_10476040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1055 | Open in IMG/M |
| 3300012212|Ga0150985_109790223 | Not Available | 646 | Open in IMG/M |
| 3300012212|Ga0150985_111590379 | Not Available | 504 | Open in IMG/M |
| 3300012212|Ga0150985_113666422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila → Rhodopila globiformis | 1551 | Open in IMG/M |
| 3300012469|Ga0150984_105448542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila → Rhodopila globiformis | 1190 | Open in IMG/M |
| 3300012469|Ga0150984_107038350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila → Rhodopila globiformis | 960 | Open in IMG/M |
| 3300012469|Ga0150984_118909467 | Not Available | 685 | Open in IMG/M |
| 3300012951|Ga0164300_10739021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 601 | Open in IMG/M |
| 3300012958|Ga0164299_10180305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1201 | Open in IMG/M |
| 3300012960|Ga0164301_10227316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1209 | Open in IMG/M |
| 3300012984|Ga0164309_11081622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 666 | Open in IMG/M |
| 3300012987|Ga0164307_10199638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1361 | Open in IMG/M |
| 3300012987|Ga0164307_10575159 | Not Available | 864 | Open in IMG/M |
| 3300013296|Ga0157374_11402085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium jicamae | 721 | Open in IMG/M |
| 3300013296|Ga0157374_12278471 | Not Available | 569 | Open in IMG/M |
| 3300013306|Ga0163162_10645662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 1182 | Open in IMG/M |
| 3300013306|Ga0163162_12084603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 650 | Open in IMG/M |
| 3300013306|Ga0163162_13168843 | Not Available | 528 | Open in IMG/M |
| 3300013308|Ga0157375_13070651 | Not Available | 557 | Open in IMG/M |
| 3300014325|Ga0163163_10766034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1028 | Open in IMG/M |
| 3300014968|Ga0157379_10969961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium jicamae | 809 | Open in IMG/M |
| 3300014968|Ga0157379_11652494 | Not Available | 626 | Open in IMG/M |
| 3300014968|Ga0157379_11754529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila → Rhodopila globiformis | 609 | Open in IMG/M |
| 3300014969|Ga0157376_11323536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 751 | Open in IMG/M |
| 3300015158|Ga0167622_1045234 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300015373|Ga0132257_102437501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 679 | Open in IMG/M |
| 3300015374|Ga0132255_102927664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 729 | Open in IMG/M |
| 3300015374|Ga0132255_105259242 | Not Available | 548 | Open in IMG/M |
| 3300016371|Ga0182034_11906961 | Not Available | 524 | Open in IMG/M |
| 3300017792|Ga0163161_10801369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 792 | Open in IMG/M |
| 3300017792|Ga0163161_11111755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia xenovorans → Paraburkholderia xenovorans LB400 | 680 | Open in IMG/M |
| 3300017792|Ga0163161_11647521 | Not Available | 567 | Open in IMG/M |
| 3300018073|Ga0184624_10444313 | Not Available | 570 | Open in IMG/M |
| 3300018081|Ga0184625_10055495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1989 | Open in IMG/M |
| 3300018466|Ga0190268_10522994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila → Rhodopila globiformis | 813 | Open in IMG/M |
| 3300018466|Ga0190268_11091728 | Not Available | 648 | Open in IMG/M |
| 3300018476|Ga0190274_13252081 | Not Available | 547 | Open in IMG/M |
| 3300019767|Ga0190267_10427305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila → Rhodopila globiformis | 751 | Open in IMG/M |
| 3300020583|Ga0210401_10362643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1311 | Open in IMG/M |
| 3300021171|Ga0210405_10566300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 887 | Open in IMG/M |
| 3300021178|Ga0210408_10273852 | Not Available | 1346 | Open in IMG/M |
| 3300021181|Ga0210388_10360331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila | 1278 | Open in IMG/M |
| 3300021406|Ga0210386_10745724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 843 | Open in IMG/M |
| 3300021475|Ga0210392_10768229 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300021477|Ga0210398_11240783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 588 | Open in IMG/M |
| 3300021478|Ga0210402_11384397 | Not Available | 631 | Open in IMG/M |
| 3300021953|Ga0213880_10020861 | All Organisms → cellular organisms → Bacteria | 1450 | Open in IMG/M |
| 3300022533|Ga0242662_10163248 | Not Available | 681 | Open in IMG/M |
| 3300025981|Ga0207640_12096388 | Not Available | 513 | Open in IMG/M |
| 3300026023|Ga0207677_10265958 | All Organisms → cellular organisms → Bacteria | 1400 | Open in IMG/M |
| 3300026075|Ga0207708_11427764 | Not Available | 608 | Open in IMG/M |
| 3300026075|Ga0207708_11878010 | Not Available | 525 | Open in IMG/M |
| 3300026078|Ga0207702_10498176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 1187 | Open in IMG/M |
| 3300026116|Ga0207674_11341447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 685 | Open in IMG/M |
| 3300027379|Ga0209842_1089160 | Not Available | 529 | Open in IMG/M |
| 3300027898|Ga0209067_10491375 | Not Available | 696 | Open in IMG/M |
| 3300027909|Ga0209382_11423730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 695 | Open in IMG/M |
| 3300028810|Ga0307294_10304564 | Not Available | 579 | Open in IMG/M |
| 3300030829|Ga0308203_1068385 | Not Available | 567 | Open in IMG/M |
| 3300030990|Ga0308178_1046240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 799 | Open in IMG/M |
| 3300031057|Ga0170834_102780999 | Not Available | 945 | Open in IMG/M |
| 3300031720|Ga0307469_10194089 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1578 | Open in IMG/M |
| 3300031740|Ga0307468_101489033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 627 | Open in IMG/M |
| 3300031945|Ga0310913_10425776 | Not Available | 942 | Open in IMG/M |
| 3300032174|Ga0307470_11795134 | Not Available | 519 | Open in IMG/M |
| 3300032205|Ga0307472_100971833 | Not Available | 793 | Open in IMG/M |
| 3300032261|Ga0306920_102680651 | Not Available | 681 | Open in IMG/M |
| 3300032261|Ga0306920_103514905 | Not Available | 579 | Open in IMG/M |
| 3300034268|Ga0372943_1223722 | Not Available | 503 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.91% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.21% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.41% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.41% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.41% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.60% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.60% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.70% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.70% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 2.70% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.70% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.70% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 2.70% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.80% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.80% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.80% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.80% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.90% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.90% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.90% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.90% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.90% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.90% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.90% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005165 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015158 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G1A, Ice margin) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021953 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R07 | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027379 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
| 3300030829 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_357 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030990 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0063454_1018669761 | 3300004081 | Soil | MFMRIIWGKILPGQWDAFETAFKKALETRGKPKGLQGQWLIRDENDPDAGYSISQW |
| Ga0062590_1008570741 | 3300004157 | Soil | MYMRIIWGRIASGQWDAFEAAYKKATALRGDVKGLKNQWLARD |
| Ga0062594_1003177453 | 3300005093 | Soil | MYMRIIWGRIASGQWDAFEAAYKKATALRGDVQGLKNQWL |
| Ga0066869_101452902 | 3300005165 | Soil | MHMRIVWGRILPGQWDGFEAAYKKASAMRGEVNGLKSQWLVRDQNDRDAG |
| Ga0070676_109811932 | 3300005328 | Miscanthus Rhizosphere | MYMRIIWGRIASGQWDAFEAAYKKATALRGDVKGLKNQWLARDQADL |
| Ga0070683_1024156062 | 3300005329 | Corn Rhizosphere | MHMRIIWGRIAAGQWDGFETAYKKATLLRGDVKGLNNQWLARDQNDQDAGYSITLWESEVDM |
| Ga0066388_1051213701 | 3300005332 | Tropical Forest Soil | MHMRIIWGRIAPGQWDAFEAAYKKAIALRGDVKGLKNQWFARDQNDPDAGYSISLWDTE |
| Ga0070674_1020973481 | 3300005356 | Miscanthus Rhizosphere | MQMRIVWGRILPGRWDAFEAAYQEAIARRGEVTGLKDQWLLRDQNDPDAG |
| Ga0070713_1003085122 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MHMRIIWGKIMPGQWNAFEAAFRRALEIRGEVKGLKGQWLLRDQNDPDAGYAV |
| Ga0070708_1014741291 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MYMRIIWGRIASGQWDAFEAAYKKATALRGDVKGLKNQWLARDQADPDAGY |
| Ga0068856_1020279141 | 3300005614 | Corn Rhizosphere | MHMRIIWGKIMPGQWNAFEVAFRRALEIRGEVKGLKGQWLLRDQND |
| Ga0066905_1012987571 | 3300005713 | Tropical Forest Soil | MYMRIIWGRIVPGQWDGFEAAFKKAVALRGDVKGLKDHWLARDQNEPDAGYSI |
| Ga0068858_1016714982 | 3300005842 | Switchgrass Rhizosphere | MYMRIIWGRIAAGQWDGFEAAYKKATSLRGDVKGLKNQWLARDQADQDAGYSITLWESEADMRAFWD |
| Ga0070717_100809783 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MFMRIIWGKILPGQWDAFEAAFRKALEIRGEPKGLRGQWLIRDENDSDAGYSSSPSPTARFVST* |
| Ga0075018_100824871 | 3300006172 | Watersheds | WGKILPGQWDAFEAAFKKALEIRGDVKGLKGQWLLRDENDPDAGYSISQSLLSG* |
| Ga0070712_1018896052 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MHMRIVWGKILPGQWDAFEAAFKKALEIRGEAKGLKSQWLLRDQNDPDA |
| Ga0070765_1010104821 | 3300006176 | Soil | MQMRIIWGKIMPGQWDAFEAAFKKALEVRGEVKGLKGQWLLRDQNDPDAGYA |
| Ga0075422_103178802 | 3300006196 | Populus Rhizosphere | MYMRIIWGRIASGQCDAFEAAYKKATALRGDVKGLKNQWLARDQADLDAGYSITLWESE |
| Ga0068871_1015928961 | 3300006358 | Miscanthus Rhizosphere | MYMRIIWGRIAAGQWDGFEAAYKKATSLRGDVKGLKNQWLARDQGDPDAGYS |
| Ga0075431_1018102562 | 3300006847 | Populus Rhizosphere | MYMRIIWGRIVHGQWDGFEAAYKEATALRGDVKGLKNQWLAR |
| Ga0075433_104423181 | 3300006852 | Populus Rhizosphere | MYMRIIWGRIVPGQWDGFEAAFKKAIALRGDVKGLKDHWLARDQNEPDAGY |
| Ga0075434_1011803353 | 3300006871 | Populus Rhizosphere | MYMRIIWGRIASGQWDAFEAAYKKATALRGDVKGLKNQWLARDQADPDAGYSI |
| Ga0111539_100832991 | 3300009094 | Populus Rhizosphere | MHMRIIWGRIVPGQWDGLEAAFKKASALRGDAKRLKDHWLARDQNEPDAGYSITVWENEA |
| Ga0111539_132177651 | 3300009094 | Populus Rhizosphere | MYMRIIWGRIVPGQWDGFEAAFKKAIALRGDVKGLKDHWLARD |
| Ga0114129_112415832 | 3300009147 | Populus Rhizosphere | MYMRIIWGRIVAGQWDGFEAAYKKAIALRGDVRGLKNQWLARDQADPDAGYSITLWESEADMRTFWD |
| Ga0105243_103445132 | 3300009148 | Miscanthus Rhizosphere | MYMRIIWGRIASGQWDAFEAAYKKAISLRGDVKGLKNQWFARDQ |
| Ga0105248_110262932 | 3300009177 | Switchgrass Rhizosphere | MYMRIIWGRIAAGQWDGFEAAYKKATSLRGDVKGLKSQWLARDQADPDAGYSITLWES |
| Ga0105248_113589792 | 3300009177 | Switchgrass Rhizosphere | MAMHMRIIWGKIMPGQWNAFEAAFRRALEIRGEVKGLKGQWLLRDQNDPDAGY |
| Ga0105248_122383851 | 3300009177 | Switchgrass Rhizosphere | MQMRIIWGKIMPGQWNAFEAAFKRALEIRGDVKGLKGQWL |
| Ga0126374_107943202 | 3300009792 | Tropical Forest Soil | MYMRIIWGRIAAGQWDGFEAVYKRAPALRGDVKGLKNQWLARDQSDPDAGYSITLWE |
| Ga0126374_110045742 | 3300009792 | Tropical Forest Soil | MHMRIIWGRIASGQWDAFEAAYKKAISLRGDVKGLKNQWFVRDQNDPDAGYSI |
| Ga0126313_100494461 | 3300009840 | Serpentine Soil | MEMRIIWGKILPGQWDAFEAAFKKAVEIRGDVKGLKGQWLLRDRNDPDAG |
| Ga0126311_105040452 | 3300010045 | Serpentine Soil | MHVRIAWGRILPGRWDAFEAAYREAIARRGEVTGLKDQWLLRDRDDPDAGYSVSL* |
| Ga0126311_106515543 | 3300010045 | Serpentine Soil | MEMRIIWGKILPGQWDAFEAAFKKAVEIRGDVKGLKGQWLLRDRSDPDAGYSI |
| Ga0127503_102028902 | 3300010154 | Soil | MYMRIIWGRIAHGQWDAFEAAYKKAISLRGDVKGLKNQWLARDQNDPDAGYSISLWD |
| Ga0126370_104201863 | 3300010358 | Tropical Forest Soil | VFDWKDAKKESDMYMRIIWGRIAAGQWDGFEAAYKKATALRGDVKGLKNQWLARDQGDPDAGYSITLWESEAD |
| Ga0126372_106608481 | 3300010360 | Tropical Forest Soil | MYMRIIWGRIAAGQWDGFEAVYKRATALRGDVKGLKNQWLARDQSDPDAGYSITLWETEADMRAFWDSKKREEAMA |
| Ga0105239_127141292 | 3300010375 | Corn Rhizosphere | RRTNEESGMYMRIIWGRIAAGQWDGFEVAYKKATSLRGDVKGLKNQWLARDQGDPDAGYSITLWESEADMRAFWEQEA* |
| Ga0126381_1009132052 | 3300010376 | Tropical Forest Soil | MHMRIIWGKIMPGQWNAFETAFKRALEIRGEVKGLKMQWLLRDQND |
| Ga0126383_128823971 | 3300010398 | Tropical Forest Soil | MHMRIIWGRIASGQWDAFEAAYKKAISLRGDVKGLKNQWFVRDQNDPDAGYS |
| Ga0134122_111290231 | 3300010400 | Terrestrial Soil | MYMRIIWGRIAAGQWDGFEAAYKKATSLRGDVKGLKNQWL |
| Ga0134121_116483822 | 3300010401 | Terrestrial Soil | MYMRIIWGRIAAGQWDGFEAAYKKATSLRGDVKGLKNQWLARDQADPDAGYSITLWES |
| Ga0105246_104760401 | 3300011119 | Miscanthus Rhizosphere | MYMRIIWGRIAAGQWDGFEAAYKKATSVRGDVKGLKNQWLARDQSDPDA |
| Ga0150985_1097902232 | 3300012212 | Avena Fatua Rhizosphere | MFMRIIWGKILPGQWDAFETAFKKALETRGKPNGLQGQWLIRDE |
| Ga0150985_1115903791 | 3300012212 | Avena Fatua Rhizosphere | MQMRIIWGKILPGQWDAFEAAFKKALEIRGEVKGLK |
| Ga0150985_1136664223 | 3300012212 | Avena Fatua Rhizosphere | MQMRIIWGKILPGQWDAFEAAFKKALEIRGDVKG* |
| Ga0150984_1054485421 | 3300012469 | Avena Fatua Rhizosphere | MRIIWGKILPGQWDAFETAFKKALETRGKPNGLQGQWLIRDE |
| Ga0150984_1070383501 | 3300012469 | Avena Fatua Rhizosphere | LGRNPMQMRIIWGKILPGQWDAFEAAFKKALEIRGDVKG* |
| Ga0150984_1189094671 | 3300012469 | Avena Fatua Rhizosphere | MQMRIIWGKILPGQWDAFEAAFKRALEIRGEVKGLK |
| Ga0164300_107390211 | 3300012951 | Soil | MHMQVVWGRILPGRWSAFEAAYKEAIARRGEVRGLRDQWL |
| Ga0164299_101803052 | 3300012958 | Soil | MYMRIIWGRIAAGQWDGFEAAYKKATSLRGDVKGLKNQWLARDQGDPDAGYSITLW |
| Ga0164301_102273164 | 3300012960 | Soil | MYMRIIWGRIAAGQWDGFEVAYKKATSLRGDVKGLKNQWLARDQGDPDAGYSITLWESEADMRAFWEQEA* |
| Ga0164309_110816221 | 3300012984 | Soil | MYMRIIWGRIASGQWDAFEAAYKKAISLRGDVKGLKNQW |
| Ga0164307_101996381 | 3300012987 | Soil | MYMRIIWGRIAAGQWDGFEVAYKKATSLRGDVKGLKNQWL |
| Ga0164307_105751592 | 3300012987 | Soil | MHMRIVWGRILPGQWDGFEAAYKKASAMRGEVKGLKS* |
| Ga0157374_114020851 | 3300013296 | Miscanthus Rhizosphere | MFMRIIWGKILPGQWDAFETAFKKALETRGKPKGLQGQWLIRDEHD |
| Ga0157374_122784711 | 3300013296 | Miscanthus Rhizosphere | MQMRIIWGKILPGQWDGFEAAFKQALEIRGEVKGLKKQWLLR |
| Ga0163162_106456622 | 3300013306 | Switchgrass Rhizosphere | MHMRIIWGKILPGQWDAFEAAFKRALEIRGEVKGLKGQWLLRDQNDPDAGY |
| Ga0163162_120846033 | 3300013306 | Switchgrass Rhizosphere | MHMRIVWGKILAGQWDVFEAAFKRALEIRGEAKGLKSQWLLRDQNDPDAG |
| Ga0163162_131688431 | 3300013306 | Switchgrass Rhizosphere | MHMRIVWGRILPGQWDGFEAAYKKASAMRGEVKGLKSQWLVRDQN |
| Ga0157375_130706511 | 3300013308 | Miscanthus Rhizosphere | MFMRIIWGKILPGQWDAFETAFKKALETRGKPKGLQGQWLIRDEN |
| Ga0163163_107660341 | 3300014325 | Switchgrass Rhizosphere | MQMRIIWGKILPGQWDGFEAAFKQALEIRGEVKGLKKQWLLRDQNDPDAGY |
| Ga0157379_109699611 | 3300014968 | Switchgrass Rhizosphere | MFMRIIWGKILPGQWDAFETAFKKALETRGKPKGL |
| Ga0157379_116524941 | 3300014968 | Switchgrass Rhizosphere | MFMRIIWGKILPGQWDAFETAFKKALETRGKPKGLQGQWLIRDENDPD |
| Ga0157379_117545291 | 3300014968 | Switchgrass Rhizosphere | MHMRIVWGRILPGQWDAFEAAFTEALETRGEVKGLISQWLLRDQNDPN |
| Ga0157376_113235362 | 3300014969 | Miscanthus Rhizosphere | MYMRIIWGRIAAGQWDGFEAAYKKATSLRGDVKGLKNQWLARDQADPDAGYSITLWESEADMR |
| Ga0167622_10452341 | 3300015158 | Glacier Forefield Soil | MQMRIIWGKILPGQWDAFEAAFKKALEIRGDVKGLKGQWLLRD |
| Ga0132257_1024375012 | 3300015373 | Arabidopsis Rhizosphere | MYMRIIWGRIAAGQWDGFEAAYKKATSLGGDVKGLKNQWLARDQADPDAGYSITLWESEADMRAFWDSK |
| Ga0132255_1029276642 | 3300015374 | Arabidopsis Rhizosphere | MYMRIIWGRIAAGQWDGFEAAYKKATSLRGDVKGLKNQWLARDQSDPDAGYSIT |
| Ga0132255_1052592422 | 3300015374 | Arabidopsis Rhizosphere | MYMRIIWGRIVAGQWDGFEAAYKKATSLRGDVKGLKNQWLARDQGDPDAGYSITLWESEA |
| Ga0182034_119069613 | 3300016371 | Soil | MYMRIIWGRIASGQWDAFEAAYKKAVSLRGEVKGLRNQWLARDQND |
| Ga0163161_108013692 | 3300017792 | Switchgrass Rhizosphere | MYMRIIWGRIAAGQWDGFEAAYKKATSLRGGVKGLKNQWLARDQADPDAGYSITLWESEA |
| Ga0163161_111117552 | 3300017792 | Switchgrass Rhizosphere | MQMRIIWGKILPGQWDAFEAAFKKALEIRGDVKGLKGQWLLQDQNDPDAGYAISQ |
| Ga0163161_116475211 | 3300017792 | Switchgrass Rhizosphere | MFMRIIWGKILPGQWDAFETAFKKALETRGKPKGLQGQWLIRD |
| Ga0184624_104443131 | 3300018073 | Groundwater Sediment | MYMRIIWGRIASGQWDAFEAAYKKATALRGDVKGLKNQWLARDQADPDAGYSITLW |
| Ga0184625_100554953 | 3300018081 | Groundwater Sediment | MYMRIIWGRIAAGQWDAFEAAYKEAISLRGDVKGLKNQWFARDQNDPDA |
| Ga0190268_105229942 | 3300018466 | Soil | MEMRIIWGKILPGQWDTFEAAFKRAVEIRGDVKGLKGQWLLRDRNDPDAGVFNLAMGKRGGYAGILG |
| Ga0190268_110917282 | 3300018466 | Soil | MHMQIVWGKILPGQWDAFEAAYRKAVAGHGELKGLKSRWLLRDQNDPDAGYSVSLW |
| Ga0190274_132520811 | 3300018476 | Soil | MHMRIVWGKILPGQWDAFEAAFKKALEIRGQVKGLKSQWLLRDQNDSD |
| Ga0190267_104273051 | 3300019767 | Soil | MEMRIIWGKVLPGQWDAFEAAFKKAVEIRGDVKGLKGQ |
| Ga0210401_103626431 | 3300020583 | Soil | MHMRIVWGKILPGQWDAFEKAFVRALEIRGDAKGLVGQW |
| Ga0210405_105663001 | 3300021171 | Soil | MHMRIVWGKILPGQWDAFEAAFKKALEIRGEAKGLKSQWLL |
| Ga0210408_102738522 | 3300021178 | Soil | MHMRIVWGRILPGQWDGFEAAYKKASAMRGEVKGLKSQWLVRDQNDRDAGYSI |
| Ga0210388_103603311 | 3300021181 | Soil | MQMRIIWGKILPGQWDAFEAAFKKALEIRGEVKGLKGQWLL |
| Ga0210386_107457242 | 3300021406 | Soil | MQMRIIWGKIMPGQWDAFEAAFKKALEIRGEVKGLKGQWLLRDQNDP |
| Ga0210392_107682291 | 3300021475 | Soil | MHMRIVWGKILPGQWDAFEAAFRKALEIRGEAKGLKSQWLLRDQNDPDAGYS |
| Ga0210398_112407831 | 3300021477 | Soil | MQMRIIWGKIMPGQWDAFEAAFQKALEIRGQVKGLKAQWLLRD |
| Ga0210402_113843972 | 3300021478 | Soil | MQMRIIWGKILPGQWEGFQAAFKQALEIRGDVKGLKTQW |
| Ga0213880_100208612 | 3300021953 | Exposed Rock | MQMRVVWGKILPGQWDAFEAAYKKAMTARGRVKGLRGQWLV |
| Ga0242662_101632482 | 3300022533 | Soil | MHMRIIWGRIAAGQWDAFEAAYKKAISLRGDVKGLRNQWFLRDQND |
| Ga0207640_120963881 | 3300025981 | Corn Rhizosphere | MHMQVVWGRILPGRWSAFEAAYKEAIARRGEVRGLRDQWLLRDQNDPDAGYSISL |
| Ga0207677_102659581 | 3300026023 | Miscanthus Rhizosphere | MQMRVIWGKILPGQWDAFEAAFKRALEIRGEVKGLKGQWLLRDEN |
| Ga0207708_114277641 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MYMRIIWGRIASGQWDAFEAAYKKATALRGDVQGLKNQWLARDQADPDAGYSITLWES |
| Ga0207708_118780101 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MFMRIIWGKILPGQWDAFETAFKKALETRGKPKGLQG |
| Ga0207702_104981761 | 3300026078 | Corn Rhizosphere | MHMRIIWGKIMPGQWNAFEAAFRRALEIRGEVKGLKGQWLLRDQNDPDAGYA |
| Ga0207674_113414471 | 3300026116 | Corn Rhizosphere | MYMRIIWGRIAAGQWDGFEVAYKKATSLRGDVKGLKNQWLARDQGDPDAGYSITLWESEA |
| Ga0209842_10891602 | 3300027379 | Groundwater Sand | MYMRIIWGRIVHGQWDGFEAAYKKATALRGDVKGLKNQWLARDQADPD |
| Ga0209067_104913752 | 3300027898 | Watersheds | MHMRIIWGKILPGQWDAFEAAFKKALEIRGEAKGLKSQW |
| Ga0209382_114237302 | 3300027909 | Populus Rhizosphere | MHMRIIWGRIVPGQWDGFEAAFKKAISLRGDVKGLKNHWLARDQNEP |
| Ga0307294_103045641 | 3300028810 | Soil | MHMRIVWGRILPGQWDGFEAAYKKASAMRGEVKGLKTQWLVRDQNDRDAGYSISLWDSDEDMRAFWD |
| Ga0308203_10683851 | 3300030829 | Soil | MHMRIVWGRILPGQWDGFEAAYKKASAMRGEVKGLKTQWLVRDQNDRDAGYSISLWDSDEDMRAFWDSP |
| Ga0308178_10462401 | 3300030990 | Soil | MHMRIVWGKILPGQWEAFEAAYKKALELRGDVKGLKSQWLLQDQNDPDAGYSISQW |
| Ga0170834_1027809992 | 3300031057 | Forest Soil | MHMRIVWGKILPGQWDAFEAAFKKALEIRADAKGLKSQWLLRDQNDPDAG |
| Ga0307469_101940891 | 3300031720 | Hardwood Forest Soil | MYMRIIWGRIVPGQWDGFEAAFKKAIALRGDVKGL |
| Ga0307468_1014890331 | 3300031740 | Hardwood Forest Soil | MYMRIIWGRIVAGQWDGFEAAYKKAIALRGDVRGLKNQWLARDQADPDAGY |
| Ga0310913_104257763 | 3300031945 | Soil | MHMRIIWGRIASGQWEAFEAAFKKAISLRGDVKGLRNQWFVRDQ |
| Ga0307470_117951341 | 3300032174 | Hardwood Forest Soil | MYMRIIWGRIVAGQWDGFEAAYKKATSLRGDVKGLKNQWLARDQGDPDAGYSITLWES |
| Ga0307472_1009718331 | 3300032205 | Hardwood Forest Soil | MYMRIIWGRIVPGQWDGFEAAFKKAIALRGDVKGLKDHWLARDQNEP |
| Ga0306920_1026806511 | 3300032261 | Soil | MHMRIIWGRIASGQWEAFEAAFKKAISLRGDVKGLRNQWFVRDQNDPDAGYSITLW |
| Ga0306920_1035149052 | 3300032261 | Soil | MHMRIIWGRIASGQWEAFEAAYKKAISLRGDVKGLRNQWFVRDQNDPDAGYSI |
| Ga0372943_1223722_94_273 | 3300034268 | Soil | MQMRIIWGKILPGQWDAFEAAFKRALEIRGEVKGLKGQWLLRDENDPDAGVFDLAVGKC |
| ⦗Top⦘ |