


| Basic Information | |
|---|---|
| Family ID | F086118 |
| Family Type | Metagenome |
| Number of Sequences | 111 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MVKLFFLCRRRPDLTHDRYVERLLGGHVPLALRHHPTLRRYVVN |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 111 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 67.27 % |
| % of genes near scaffold ends (potentially truncated) | 98.20 % |
| % of genes from short scaffolds (< 2000 bps) | 96.40 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.099 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.514 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.225 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (39.640 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.33% β-sheet: 0.00% Coil/Unstructured: 66.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 111 Family Scaffolds |
|---|---|---|
| PF01553 | Acyltransferase | 18.92 |
| PF10503 | Esterase_PHB | 9.91 |
| PF00027 | cNMP_binding | 8.11 |
| PF01694 | Rhomboid | 7.21 |
| PF12710 | HAD | 5.41 |
| PF12695 | Abhydrolase_5 | 3.60 |
| PF03176 | MMPL | 3.60 |
| PF04238 | DUF420 | 2.70 |
| PF03060 | NMO | 1.80 |
| PF09818 | ABC_ATPase | 0.90 |
| PF00107 | ADH_zinc_N | 0.90 |
| PF01741 | MscL | 0.90 |
| PF00403 | HMA | 0.90 |
| PF13533 | Biotin_lipoyl_2 | 0.90 |
| PF13347 | MFS_2 | 0.90 |
| PF03900 | Porphobil_deamC | 0.90 |
| PF14371 | DUF4412 | 0.90 |
| PF00575 | S1 | 0.90 |
| PF01797 | Y1_Tnp | 0.90 |
| PF05494 | MlaC | 0.90 |
| PF02653 | BPD_transp_2 | 0.90 |
| COG ID | Name | Functional Category | % Frequency in 111 Family Scaffolds |
|---|---|---|---|
| COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 7.21 |
| COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 3.60 |
| COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 3.60 |
| COG2322 | Cytochrome oxidase assembly protein CtaM/YozB, DUF420 family | Posttranslational modification, protein turnover, chaperones [O] | 2.70 |
| COG0516 | IMP dehydrogenase/GMP reductase | Nucleotide transport and metabolism [F] | 1.80 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 1.80 |
| COG0181 | Porphobilinogen deaminase | Coenzyme transport and metabolism [H] | 0.90 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.90 |
| COG1970 | Large-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.90 |
| COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.90 |
| COG2608 | Copper chaperone CopZ | Inorganic ion transport and metabolism [P] | 0.90 |
| COG2854 | Periplasmic subunit MlaC of the ABC-type intermembrane phospholipid transporter Mla | Cell wall/membrane/envelope biogenesis [M] | 0.90 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.10 % |
| Unclassified | root | N/A | 0.90 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_104828447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingopyxis → Sphingopyxis alaskensis | 1444 | Open in IMG/M |
| 3300001431|F14TB_101284189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 540 | Open in IMG/M |
| 3300004463|Ga0063356_105527437 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 542 | Open in IMG/M |
| 3300004643|Ga0062591_101709223 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300005093|Ga0062594_100192621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 1409 | Open in IMG/M |
| 3300005167|Ga0066672_10643206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 685 | Open in IMG/M |
| 3300005172|Ga0066683_10483519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 757 | Open in IMG/M |
| 3300005178|Ga0066688_10127305 | All Organisms → cellular organisms → Bacteria | 1580 | Open in IMG/M |
| 3300005180|Ga0066685_10203660 | All Organisms → cellular organisms → Bacteria | 1358 | Open in IMG/M |
| 3300005328|Ga0070676_10240475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1204 | Open in IMG/M |
| 3300005336|Ga0070680_100910910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 759 | Open in IMG/M |
| 3300005434|Ga0070709_11209989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 607 | Open in IMG/M |
| 3300005441|Ga0070700_100560272 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 889 | Open in IMG/M |
| 3300005441|Ga0070700_101278291 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 616 | Open in IMG/M |
| 3300005445|Ga0070708_101876612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 556 | Open in IMG/M |
| 3300005451|Ga0066681_10886030 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300005468|Ga0070707_100288899 | All Organisms → cellular organisms → Bacteria | 1593 | Open in IMG/M |
| 3300005536|Ga0070697_100162671 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1886 | Open in IMG/M |
| 3300005536|Ga0070697_101016734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 737 | Open in IMG/M |
| 3300005546|Ga0070696_101302610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Nannocystaceae → Nannocystis | 617 | Open in IMG/M |
| 3300005552|Ga0066701_10283184 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
| 3300005552|Ga0066701_10871649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 534 | Open in IMG/M |
| 3300005557|Ga0066704_10232117 | All Organisms → cellular organisms → Bacteria | 1251 | Open in IMG/M |
| 3300005586|Ga0066691_10141881 | All Organisms → cellular organisms → Bacteria | 1377 | Open in IMG/M |
| 3300005843|Ga0068860_100801517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 955 | Open in IMG/M |
| 3300006172|Ga0075018_10816469 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300006173|Ga0070716_100547333 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300006175|Ga0070712_101335583 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300006796|Ga0066665_11682432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300006797|Ga0066659_10591892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 900 | Open in IMG/M |
| 3300006854|Ga0075425_101568836 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 742 | Open in IMG/M |
| 3300009089|Ga0099828_10770152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 863 | Open in IMG/M |
| 3300009090|Ga0099827_10642247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 916 | Open in IMG/M |
| 3300009111|Ga0115026_10724932 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300009137|Ga0066709_101581593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 940 | Open in IMG/M |
| 3300009177|Ga0105248_11437033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 780 | Open in IMG/M |
| 3300010048|Ga0126373_12340933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 594 | Open in IMG/M |
| 3300010301|Ga0134070_10473925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 504 | Open in IMG/M |
| 3300010323|Ga0134086_10092666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1061 | Open in IMG/M |
| 3300010323|Ga0134086_10117049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 953 | Open in IMG/M |
| 3300010325|Ga0134064_10031390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1561 | Open in IMG/M |
| 3300010326|Ga0134065_10224947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 690 | Open in IMG/M |
| 3300010335|Ga0134063_10063772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1628 | Open in IMG/M |
| 3300010358|Ga0126370_10963432 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300010361|Ga0126378_13406381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 505 | Open in IMG/M |
| 3300010364|Ga0134066_10314529 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300010391|Ga0136847_10673175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1192 | Open in IMG/M |
| 3300010397|Ga0134124_12021434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 614 | Open in IMG/M |
| 3300010403|Ga0134123_10379450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1288 | Open in IMG/M |
| 3300012200|Ga0137382_10149782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1581 | Open in IMG/M |
| 3300012209|Ga0137379_11243030 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300012922|Ga0137394_11535016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 524 | Open in IMG/M |
| 3300012924|Ga0137413_10761589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 740 | Open in IMG/M |
| 3300012929|Ga0137404_11780693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 573 | Open in IMG/M |
| 3300012930|Ga0137407_10659714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 984 | Open in IMG/M |
| 3300014150|Ga0134081_10007494 | All Organisms → cellular organisms → Bacteria | 2847 | Open in IMG/M |
| 3300014157|Ga0134078_10236464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 760 | Open in IMG/M |
| 3300014968|Ga0157379_10673689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 970 | Open in IMG/M |
| 3300015374|Ga0132255_101758419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 941 | Open in IMG/M |
| 3300017654|Ga0134069_1302716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 567 | Open in IMG/M |
| 3300017959|Ga0187779_11196788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 534 | Open in IMG/M |
| 3300018064|Ga0187773_10232101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 999 | Open in IMG/M |
| 3300018431|Ga0066655_10256857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1119 | Open in IMG/M |
| 3300018433|Ga0066667_12248475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 509 | Open in IMG/M |
| 3300018468|Ga0066662_12829540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 515 | Open in IMG/M |
| 3300021432|Ga0210384_10153623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2066 | Open in IMG/M |
| 3300025310|Ga0209172_10167119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1189 | Open in IMG/M |
| 3300025910|Ga0207684_11589035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 530 | Open in IMG/M |
| 3300025923|Ga0207681_10302704 | All Organisms → cellular organisms → Bacteria | 1266 | Open in IMG/M |
| 3300025972|Ga0207668_12153882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300025986|Ga0207658_10456629 | All Organisms → cellular organisms → Bacteria | 1132 | Open in IMG/M |
| 3300026313|Ga0209761_1323445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 527 | Open in IMG/M |
| 3300026331|Ga0209267_1141573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 998 | Open in IMG/M |
| 3300026333|Ga0209158_1236398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 628 | Open in IMG/M |
| (restricted) 3300027872|Ga0255058_10392962 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300028381|Ga0268264_10475620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1214 | Open in IMG/M |
| 3300028381|Ga0268264_10975535 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
| 3300028577|Ga0265318_10122092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 958 | Open in IMG/M |
| 3300028592|Ga0247822_11498969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 570 | Open in IMG/M |
| 3300030336|Ga0247826_10740285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 766 | Open in IMG/M |
| 3300030336|Ga0247826_11162869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 618 | Open in IMG/M |
| 3300031564|Ga0318573_10566284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 612 | Open in IMG/M |
| 3300031679|Ga0318561_10422520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 733 | Open in IMG/M |
| 3300031679|Ga0318561_10620534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 595 | Open in IMG/M |
| 3300031682|Ga0318560_10385478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 758 | Open in IMG/M |
| 3300031713|Ga0318496_10351053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 815 | Open in IMG/M |
| 3300031720|Ga0307469_10637023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 958 | Open in IMG/M |
| 3300031758|Ga0315907_10663844 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300031768|Ga0318509_10131775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1370 | Open in IMG/M |
| 3300031770|Ga0318521_10716331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 608 | Open in IMG/M |
| 3300031779|Ga0318566_10287448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae | 814 | Open in IMG/M |
| 3300031797|Ga0318550_10608389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae | 525 | Open in IMG/M |
| 3300031805|Ga0318497_10382158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 787 | Open in IMG/M |
| 3300031820|Ga0307473_10162897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1283 | Open in IMG/M |
| 3300031820|Ga0307473_10568627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 777 | Open in IMG/M |
| 3300031892|Ga0310893_10383887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 612 | Open in IMG/M |
| 3300031896|Ga0318551_10348613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae | 838 | Open in IMG/M |
| 3300031954|Ga0306926_11567205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 757 | Open in IMG/M |
| 3300032001|Ga0306922_11241290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 757 | Open in IMG/M |
| 3300032054|Ga0318570_10431143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 601 | Open in IMG/M |
| 3300032055|Ga0318575_10458323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 647 | Open in IMG/M |
| 3300032089|Ga0318525_10719230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 508 | Open in IMG/M |
| 3300032160|Ga0311301_10091601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 6066 | Open in IMG/M |
| 3300032177|Ga0315276_10345150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1588 | Open in IMG/M |
| 3300032180|Ga0307471_102422010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 663 | Open in IMG/M |
| 3300032180|Ga0307471_103673161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 543 | Open in IMG/M |
| 3300032180|Ga0307471_104305727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 503 | Open in IMG/M |
| 3300032180|Ga0307471_104359445 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 500 | Open in IMG/M |
| 3300032893|Ga0335069_12119448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 590 | Open in IMG/M |
| 3300033804|Ga0314863_143382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 514 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 12.61% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.91% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 9.01% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.21% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.31% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.50% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.70% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.70% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.70% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.80% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.80% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.90% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.90% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.90% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.90% |
| Seawater | Environmental → Aquatic → Marine → Gulf → Unclassified → Seawater | 0.90% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 0.90% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.90% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.90% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.90% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.90% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.90% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.90% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.90% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.90% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300025310 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300027872 (restricted) | Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_9 | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Host-Associated | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300033804 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_20 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1048284473 | 3300000955 | Soil | MPKLVFLCRRRPDLTHERYAELLLRGHVPLALRHHPTMRKYVVNVVEGL |
| F14TB_1012841891 | 3300001431 | Soil | MVKLIFLCRRRPDLTHEQYVERLLQGHVPLALRHHPTMRGYVVNV |
| Ga0063356_1055274372 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MVKLIFLCRRRPDITHERYAALLLEGHVPIALRHHPTMRRYTVNI |
| Ga0062591_1017092231 | 3300004643 | Soil | MVKMMFLCRRRPDVDHARYVAMVLNDHVPLALRHHPTMRTYVVNVVDRSP |
| Ga0062594_1001926211 | 3300005093 | Soil | MVKLIFLCRRRPEIGHDEYVERVLRGHVPLALRHHPTMLGYVVNIVEDTG |
| Ga0066672_106432062 | 3300005167 | Soil | MVKLVFLCWRRPDISHERYVELLLRGHVPVALAHHPTLRRYVVNVVEGTREPAPALD |
| Ga0066683_104835192 | 3300005172 | Soil | MVKLVFLCRRRPDLSHARYVELLLRGHVPIALAHHPTLRRYVVNVVEGTR |
| Ga0066688_101273053 | 3300005178 | Soil | MVKLVFLCRQRSDLTHERYVARLLEGHVPLALRHHPTLRRY |
| Ga0066685_102036601 | 3300005180 | Soil | MTKLFFLCHRRADLTHDEYAERLLGVHVPLALAHHPTLRRYVVNVV |
| Ga0070676_102404751 | 3300005328 | Miscanthus Rhizosphere | MPKMIFLCRRRPDITHERYAELVLQGHVPLALRHHPTMRKYVVNVV |
| Ga0070680_1009109101 | 3300005336 | Corn Rhizosphere | MVKLVFLCRRRADLTHERYAELLLGGHVPLALRHHPTMRKYVVNLVEGLRAGA |
| Ga0070709_112099892 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VVKLFFFCGRRDDLSHDAYAERLLHGHVPIALRHHPTLRRYTVNIVESS |
| Ga0070700_1005602722 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MLKLFFFCRRRPDITRARYAELLLDGHVPIALEHHPTMRRYVVNIVEQSPSDWQEL |
| Ga0070700_1012782912 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MVKLVFLCRRRPDITHETYVKRLLEGHVPLALRHHPTLRRYVVNVVEGTRGDV |
| Ga0070708_1018766121 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MTKLFFLCRRRADLTHEQYVERLIAGHVPLALAHHPTLRRYVVNVVE |
| Ga0066681_108860302 | 3300005451 | Soil | MVKLVFLCRRRSDLTHGRYVARLLEGHVPLALRHHPTLRRY |
| Ga0070707_1002888991 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MVKLVFLCRRRPDLTHEQYVARLLEGHVPLALRHHPTLRRYVVNVVEGT |
| Ga0070697_1001626712 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MVKLFFLCRRRPDLTHDRYVERLLGGHVPLALRHHPTLRRYVVN |
| Ga0070697_1010167341 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MTKLFFLCRRRADLTHEQYVERLVAGHVPLALAHHPTLRRYVVNVVEGTR |
| Ga0070696_1013026101 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MVKLVFLCRRRPDITHARYVELLLGGHVPLALAHHQTMRRYVVNIV |
| Ga0066701_102831843 | 3300005552 | Soil | MVKLVFLCRRRSDLTHERYVGRLLEGHVPLALRHHPTLRRYVVNIVE |
| Ga0066701_108716492 | 3300005552 | Soil | MVKLVFLCRRRPDLSHARYVELLLRGHVPIALAHHPTLRRYVVNVV |
| Ga0066704_102321171 | 3300005557 | Soil | MVKLVFLCRQRSDLTHERYVARLLEGHVPLALRHHPTLRRYVVNIVE |
| Ga0066691_101418811 | 3300005586 | Soil | MVKLVFLCWRRPDISHERYVELLLRGHVPVALAHHPTLRRYVVNVVEGT |
| Ga0068860_1008015172 | 3300005843 | Switchgrass Rhizosphere | MEKLIFLCRRRPNITHERYVELLLKGHVPIALQHHPTMRRYTVNIVEQGP |
| Ga0075018_108164691 | 3300006172 | Watersheds | MVKLMFLCRRRPELTPAQYADRLLRGHVPLALRHHATMRGYVVNL |
| Ga0070716_1005473331 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MVKLVFLCRRRPDVTHEQYVDMLLHGHVPLALAHHPTLRRYVVNVVEATR |
| Ga0070712_1013355832 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MHKLIFLCRRRSDETHERYVDWLLGEHVPLALRHHPMLRRYVVNVV |
| Ga0066665_116824322 | 3300006796 | Soil | MTKLFFLCHRRAALTHDEYAERLLGGHVPLALAHHPTLRRYVVNVVEGTR |
| Ga0066659_105918922 | 3300006797 | Soil | MLKMIFLCRRRPDATHERYVDWLLGEHVPLALRHHPTLRRYVVNVVEGT |
| Ga0075425_1015688361 | 3300006854 | Populus Rhizosphere | MMKLVFLCRRRPDLTHPEYAAHLLERHVPLALRHHPTLRRYVVN |
| Ga0099828_107701522 | 3300009089 | Vadose Zone Soil | MVKLVFLCRRRPDITHERYAELLLRGHVPLALRHHPALRRYVV |
| Ga0099827_106422471 | 3300009090 | Vadose Zone Soil | MVKLVFLCWRKPDLSHARYVELLLRGHVPIALSHHPTLRRYVVNVVEGTRGAGLEP |
| Ga0115026_107249321 | 3300009111 | Wetland | LHVRGVVKLIFFCRRRPDLSHGRYAELLLLGHVPLALRHHPAMRGYI |
| Ga0066709_1015815932 | 3300009137 | Grasslands Soil | MTKLFFLCRRRAELTHEQYVERLIAGLVPLALAHHPTLRRYVVNVVEGTRGPAP |
| Ga0105248_114370332 | 3300009177 | Switchgrass Rhizosphere | MTKLIFLCRRRPDITHERYAELVLQGHVPLALRHHP |
| Ga0126373_123409331 | 3300010048 | Tropical Forest Soil | MVKLIFLCRRRPDLTHDQYVERVLQGHVPLALRHHPAMRGYVVNVVENTGA |
| Ga0134070_104739252 | 3300010301 | Grasslands Soil | MTKLFFLCRRRGDLTHDEYVERLLGGHVPLALAHHPTLR |
| Ga0134086_100926663 | 3300010323 | Grasslands Soil | MVKVVFLCRRRSDLTHERYVARLLEGHVPLALRHHPTLRRYVVN |
| Ga0134086_101170491 | 3300010323 | Grasslands Soil | MVKLVFLCRRRSDLTHGRYVARLLEGHVPLALRHHPT |
| Ga0134064_100313901 | 3300010325 | Grasslands Soil | MVKVVFLCRRRSDLTHERYVARLLEGHVPLALRHHPT |
| Ga0134065_102249471 | 3300010326 | Grasslands Soil | MVKLVFLCRRRSDLTHGRYVARLLEGHVPLALRHHPTLRRYVVNIVEGTRG |
| Ga0134063_100637724 | 3300010335 | Grasslands Soil | MVKVVFLCRRRSDLTHERYVARLLEGHVPLALRHHPTLRRYVVNIVE |
| Ga0126370_109634322 | 3300010358 | Tropical Forest Soil | MVKLVFLCRRRPDLTHEHYVERLLRGHVPIALAHH |
| Ga0126378_134063811 | 3300010361 | Tropical Forest Soil | MVKLIFLCRRRPDITHERYADLLLNGHVPIALRHHPTLRRYTVNI |
| Ga0134066_103145292 | 3300010364 | Grasslands Soil | MVKLVFLCRRRSDLTHERYVERLLGGHVPLAIRRHPTL |
| Ga0136847_106731754 | 3300010391 | Freshwater Sediment | VKLVFLCRRRPDLTAARYTERLLHGHVPLALRHHPTLAKYVVNLV |
| Ga0134124_120214342 | 3300010397 | Terrestrial Soil | MVKLVFLCRRRPDVTHEQYVDMLLHGHVPLALAHHSTLRR |
| Ga0134123_103794501 | 3300010403 | Terrestrial Soil | VIMVKLIFLCRRRPDLTHERYGELLLGGHVPLALRHHPTMRKYVVNLVEGLRAG |
| Ga0137382_101497821 | 3300012200 | Vadose Zone Soil | MVKLVFLCRRRPDITHERYAELLLRGHVPLALRHHPTLRRYVVNIVDDT |
| Ga0137379_112430302 | 3300012209 | Vadose Zone Soil | MVKLVFLCRRRPHITHERYAELLLGGHVPLALRHHPTLRRYVVNIVE |
| Ga0137394_115350161 | 3300012922 | Vadose Zone Soil | MVKLVFLCWRRPDISHERYVDLLLRGHVPIALAHHPTLRRYVVNVVEGTREPAPALD |
| Ga0137413_107615891 | 3300012924 | Vadose Zone Soil | MVKLLFLCRRRDGLSHPEYVERLRGRHVPLALRHHPTLRRY |
| Ga0137404_117806931 | 3300012929 | Vadose Zone Soil | MEPVVKLFFLCRRKDGLSHEAYAERLLRGHVPIALRHHPTLRRYTVNVVES |
| Ga0137407_106597141 | 3300012930 | Vadose Zone Soil | MVKLVFLCWRRPDISHERDVELLLRGHVPVALAHHP |
| Ga0134081_100074941 | 3300014150 | Grasslands Soil | MVKLVFLCRRRPDLTHERYVELLLGGHVPLALRHHPALRRYVVNI |
| Ga0134078_102364641 | 3300014157 | Grasslands Soil | MTKLFFLCRRRGDLTHDEYVERLLGGHVPLALAHHPT |
| Ga0157379_106736892 | 3300014968 | Switchgrass Rhizosphere | MEKLIFLCRRRPNITHERYVELLLKGHVPIALQHHPTMRRYTVNIVEQGPP |
| Ga0132255_1017584192 | 3300015374 | Arabidopsis Rhizosphere | MVKLIFLCRRRPDLTHEQYVERLLEGHVPLALHHHPTMRGYVVNVVEQTGAGL |
| Ga0134069_13027161 | 3300017654 | Grasslands Soil | MVKLVFLCWRRPDISHERYVELLLRGHVPVALAHHPTLRRYVLNVVEGTREPAPALDS |
| Ga0187779_111967881 | 3300017959 | Tropical Peatland | MVKLIFLCRRRSDISHERYAELLLQGHVPLALEHHPTLR |
| Ga0187773_102321013 | 3300018064 | Tropical Peatland | MVKLIFFCRRRRDISHARYTELLLTGHVPVALKHHPLMQRY |
| Ga0066655_102568571 | 3300018431 | Grasslands Soil | MTKLFFLCHRRADLTHDEYAERLLGGHVPLALAPHPALRRYVVNVVEG |
| Ga0066667_122484752 | 3300018433 | Grasslands Soil | MVKLVFLCRRRPDITHERYAELLLRGHVPLALRHHPTLRRSVVNIVQDT |
| Ga0066662_128295403 | 3300018468 | Grasslands Soil | MVKLVFLCRQRSDLTHERYVARLLEGHVPLALRHHPTLRRYVVNIVEGTRGPAPPLDS |
| Ga0210384_101536234 | 3300021432 | Soil | MVKLVFLCRRRSDLTHEQYVERLLGGHVALALRHHPTLRRYVVNIVEGTRGPTPALD |
| Ga0209172_101671192 | 3300025310 | Hot Spring Sediment | MPKLVFLCRRRPDITHERYADLLLRGHVPLALRHHPT |
| Ga0207684_115890351 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MVKLIFLCRRRPDITHERYAELLLHGHVPLALRHHPTMRRYTVNIVDQGRPDEEALD |
| Ga0207681_103027042 | 3300025923 | Switchgrass Rhizosphere | MVKLIFLCRRRPEIGHDEYVERVLRGHVPLALRHHPTMLGYVVNIVEDTGA |
| Ga0207668_121538822 | 3300025972 | Switchgrass Rhizosphere | MRRMVKLIFLCRRRPDITHERYAELLLDGHVPIALQH |
| Ga0207658_104566292 | 3300025986 | Switchgrass Rhizosphere | MRRMVKLIFLCRRRPDITHERYAELLLDGHVPIALQHHPTLRRYTVNIVERGPDS |
| Ga0209761_13234451 | 3300026313 | Grasslands Soil | MVKLVFLCRRRSDLTHERYVARLLEGHVPLALRHHPTLRRYVVNI |
| Ga0209267_11415732 | 3300026331 | Soil | MTKLFFLCRRRAELTHEQYVERLIAGHVPLALAHHP |
| Ga0209158_12363982 | 3300026333 | Soil | MVKLVFLCWRRPDISHERYVELLLRGHVPVALAHHPTLRRYVVNVVEGTR |
| (restricted) Ga0255058_103929622 | 3300027872 | Seawater | MLFLCRRRSGLTHDEYAHRVLQGHVPLALRHHPTLRHY |
| Ga0268264_104756201 | 3300028381 | Switchgrass Rhizosphere | MEKLIFLCRRRPNITHERYVELLLKGHVPIALQHHPTMRRYTVNIVEQGPPSED |
| Ga0268264_109755352 | 3300028381 | Switchgrass Rhizosphere | MRRMVKLIFLCRRRPDITHERYAELLLDGHVPIALQ |
| Ga0265318_101220921 | 3300028577 | Rhizosphere | MRKLIFLCHRRPDITHERYTEQLLKSHIPIALEHHP |
| Ga0247822_114989692 | 3300028592 | Soil | MVKLLFLCRRRSDITHERYARLLLEGHVPLALRHHPTMQRYAVNIV |
| Ga0247826_107402851 | 3300030336 | Soil | MTKLIFLCRRRPDITHERYAELVLGGHVPLALRHHPTMRKYVVNVVEGFRAGA |
| Ga0247826_111628692 | 3300030336 | Soil | MVKLIFLCRRRPDIGHDEYVERVLRGHVPLALRHHPTMLG |
| Ga0318573_105662841 | 3300031564 | Soil | MVKLIFLCRRRPDLTHDQYVERVLQGHVPLALRHHPAMRGYVVNVVEDAG |
| Ga0318561_104225201 | 3300031679 | Soil | MVKLIFLCRRRPDLTHDQYVERVLQGHVPLALRHHP |
| Ga0318561_106205342 | 3300031679 | Soil | MVKLIFLCRRRPDLTHEQYVERVLQGHVPLALRHHPSMR |
| Ga0318560_103854782 | 3300031682 | Soil | VVKLIFLCRRRPDLTHEQYVERVLRGHAPLALRHHPTMRGY |
| Ga0318496_103510532 | 3300031713 | Soil | MVKLIFLCRRRPDLTHDQYVERVLQGHVPLALRHHPAMRGYVVNVV |
| Ga0307469_106370231 | 3300031720 | Hardwood Forest Soil | VVKLFFFCGRRDDLSHDAYAEQLLRGHVPIALRHHPTLRRYTVN |
| Ga0315907_106638442 | 3300031758 | Freshwater | VRKLVFLCRRRPDLARAEYARRLLRGHVPLALRHHPTLRRYVVNVVESAAVPGSSPLD |
| Ga0318509_101317751 | 3300031768 | Soil | MVKLIFLCRRRPDLTHDQYVERVLQGHVPLALRHHPTM |
| Ga0318521_107163311 | 3300031770 | Soil | MVKLIFLCRRRLDLTHDQYVERVLQGHVPLALRHHPAMRGYVVNVVEDAGAGL |
| Ga0318566_102874481 | 3300031779 | Soil | MVKLLFLCRRRPDIDHDRYVALLLGGHVPIALRHHPTMRKYVVNVVERAQDGLP |
| Ga0318550_106083892 | 3300031797 | Soil | MVKLLFLCRRRPDIDHDRYVALLLGGHVPIALRHHPTMRKYVVNVVERGQPV |
| Ga0318497_103821582 | 3300031805 | Soil | MVKLIFLCRRRPDLTHDQYVERVLQGHVPLALRHHPTMRGYVVNVV |
| Ga0307473_101628972 | 3300031820 | Hardwood Forest Soil | MVRLVFLCRRRPDIGHDRYVECLLHGHVPIALAHHPTLRRYVVNVVEE |
| Ga0307473_105686271 | 3300031820 | Hardwood Forest Soil | VVKLFFFCGRRDDLSHDAYAEQLLRGHVPIALRHHPTLRRYTVNIVESSSPGSPPV |
| Ga0310893_103838871 | 3300031892 | Soil | MPKLIFLCRRRPDITHERYAELVLGGHVPLALRHH |
| Ga0318551_103486131 | 3300031896 | Soil | MVKLLFLCRRRPDIDHDRYVALLLGGHVPIALRHHPT |
| Ga0306926_115672052 | 3300031954 | Soil | MVKLIFLCRRRPDLTHDQYVERVLQGHVPLALRHHPAMRGYVVNVVEDTGAGLEP |
| Ga0306922_112412902 | 3300032001 | Soil | MVKLIFLCRRRPELTSEQYAERLLRGHVPLALRHHHPAM |
| Ga0318570_104311432 | 3300032054 | Soil | VVKLIFLCRRRPDLTHEQYVERVLRGHVPLALRHHPTMRGYVVNVVEEASAGLE |
| Ga0318575_104583232 | 3300032055 | Soil | VVKLIFLCRRRPDLTHEQYVERVLRGHVPLALRHHPTMRGYVVNVVEEAGA |
| Ga0318525_107192301 | 3300032089 | Soil | MVKLIFLCRRRPDLTHDQYVERVLQGHVPLALRHHPAMRGYVVNVVED |
| Ga0310895_107307471 | 3300032122 | Soil | MVKMMFLCRRRPDVDHARYVAMVLSDHVPLALRHHPTMRTYVVNVVDRSPTGWPE |
| Ga0311301_100916011 | 3300032160 | Peatlands Soil | MATIPMVKLIFLCRRRPDITHAHYAERLLSGHVPIAL |
| Ga0315276_103451502 | 3300032177 | Sediment | VVKLVFLCRRRADLTHDRYAELVLDGHVPLALRHHPAMRK |
| Ga0307471_1024220102 | 3300032180 | Hardwood Forest Soil | MVKLCFLCRRRPDITHEIYVRRLLDGHVPIALRHHPTLRRYTVNIVETPHAG |
| Ga0307471_1036731612 | 3300032180 | Hardwood Forest Soil | MRRMVKLIFLCRRRPDITHERYTELLLDGHVPIALQHHPT |
| Ga0307471_1043057272 | 3300032180 | Hardwood Forest Soil | MRKLIFLCRRRADIDHQQYAKLLVEGHIPIALKHHPA |
| Ga0307471_1043594451 | 3300032180 | Hardwood Forest Soil | MEKLIFLCRRRPDITHERYADLLLGGHVPLALRHHPAMQGYVV |
| Ga0335069_121194482 | 3300032893 | Soil | MVKLVFLCRRRPDIDHARYAELLLHGHVPLALRHHPTLRRYVVNVVEQG |
| Ga0314863_143382_334_513 | 3300033804 | Peatland | LTASQRFRQSQGMVKLIFLCRRRPDLTHEQYVERLRRGHVPIALRHHPAMRRYTVNIVDQ |
| ⦗Top⦘ |