


| Basic Information | |
|---|---|
| Family ID | F086094 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 111 |
| Average Sequence Length | 42 residues |
| Representative Sequence | PDEPNKPLAVFKIVGGCGALVLIGVWLYAAGKRRAARPA |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 111 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 95.50 % |
| % of genes from short scaffolds (< 2000 bps) | 87.39 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (53.153 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (9.009 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.829 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.847 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.27% β-sheet: 0.00% Coil/Unstructured: 53.73% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 111 Family Scaffolds |
|---|---|---|
| PF08669 | GCV_T_C | 57.66 |
| PF13826 | DUF4188 | 4.50 |
| PF00326 | Peptidase_S9 | 4.50 |
| PF06996 | T6SS_TssG | 0.90 |
| PF00535 | Glycos_transf_2 | 0.90 |
| PF00486 | Trans_reg_C | 0.90 |
| PF13483 | Lactamase_B_3 | 0.90 |
| PF00881 | Nitroreductase | 0.90 |
| PF00005 | ABC_tran | 0.90 |
| PF01609 | DDE_Tnp_1 | 0.90 |
| PF12802 | MarR_2 | 0.90 |
| PF01797 | Y1_Tnp | 0.90 |
| PF13520 | AA_permease_2 | 0.90 |
| COG ID | Name | Functional Category | % Frequency in 111 Family Scaffolds |
|---|---|---|---|
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.90 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.90 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.90 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.90 |
| COG3520 | Predicted component of the type VI protein secretion system | Intracellular trafficking, secretion, and vesicular transport [U] | 0.90 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.90 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.90 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.90 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 53.15 % |
| Unclassified | root | N/A | 46.85 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_104230361 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 780 | Open in IMG/M |
| 3300000955|JGI1027J12803_108631301 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 824 | Open in IMG/M |
| 3300001593|JGI12635J15846_10628557 | Not Available | 623 | Open in IMG/M |
| 3300001593|JGI12635J15846_10643680 | Not Available | 614 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100701409 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300004080|Ga0062385_10573397 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300005434|Ga0070709_11469623 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300005541|Ga0070733_10612917 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 730 | Open in IMG/M |
| 3300005712|Ga0070764_10234569 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
| 3300005712|Ga0070764_10846805 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 570 | Open in IMG/M |
| 3300005764|Ga0066903_101456295 | Not Available | 1290 | Open in IMG/M |
| 3300005993|Ga0080027_10206432 | Not Available | 768 | Open in IMG/M |
| 3300006047|Ga0075024_100616627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 585 | Open in IMG/M |
| 3300006050|Ga0075028_100012462 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3554 | Open in IMG/M |
| 3300006052|Ga0075029_100148145 | All Organisms → cellular organisms → Bacteria | 1441 | Open in IMG/M |
| 3300006059|Ga0075017_100840828 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 711 | Open in IMG/M |
| 3300006086|Ga0075019_10650630 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300006162|Ga0075030_101277941 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 576 | Open in IMG/M |
| 3300006162|Ga0075030_101324679 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 565 | Open in IMG/M |
| 3300006176|Ga0070765_100262647 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1586 | Open in IMG/M |
| 3300009522|Ga0116218_1116905 | Not Available | 1213 | Open in IMG/M |
| 3300009638|Ga0116113_1166062 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300009641|Ga0116120_1216329 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300009839|Ga0116223_10051592 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 2683 | Open in IMG/M |
| 3300010358|Ga0126370_10078291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica | 2212 | Open in IMG/M |
| 3300010360|Ga0126372_12537592 | Not Available | 564 | Open in IMG/M |
| 3300012357|Ga0137384_11509445 | Not Available | 521 | Open in IMG/M |
| 3300012508|Ga0157315_1062366 | Not Available | 529 | Open in IMG/M |
| 3300012922|Ga0137394_10155551 | All Organisms → cellular organisms → Bacteria | 1946 | Open in IMG/M |
| 3300012927|Ga0137416_11246861 | Not Available | 670 | Open in IMG/M |
| 3300012929|Ga0137404_10439296 | All Organisms → cellular organisms → Bacteria | 1156 | Open in IMG/M |
| 3300012930|Ga0137407_11467138 | Not Available | 649 | Open in IMG/M |
| 3300012986|Ga0164304_10380632 | Not Available | 996 | Open in IMG/M |
| 3300014169|Ga0181531_10560484 | Not Available | 707 | Open in IMG/M |
| 3300014169|Ga0181531_10964837 | Not Available | 535 | Open in IMG/M |
| 3300014501|Ga0182024_12700836 | Not Available | 531 | Open in IMG/M |
| 3300014657|Ga0181522_10644858 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300016371|Ga0182034_10348859 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1201 | Open in IMG/M |
| 3300016750|Ga0181505_10412177 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Silvibacterium → Silvibacterium bohemicum | 1136 | Open in IMG/M |
| 3300017822|Ga0187802_10200624 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 767 | Open in IMG/M |
| 3300017924|Ga0187820_1121663 | Not Available | 766 | Open in IMG/M |
| 3300017932|Ga0187814_10272702 | Not Available | 644 | Open in IMG/M |
| 3300017948|Ga0187847_10695785 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300017955|Ga0187817_11023283 | Not Available | 529 | Open in IMG/M |
| 3300017974|Ga0187777_11270997 | Not Available | 540 | Open in IMG/M |
| 3300018009|Ga0187884_10050370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1948 | Open in IMG/M |
| 3300018019|Ga0187874_10128413 | Not Available | 1085 | Open in IMG/M |
| 3300018021|Ga0187882_1202931 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300018035|Ga0187875_10418673 | Not Available | 715 | Open in IMG/M |
| 3300018038|Ga0187855_10193951 | Not Available | 1200 | Open in IMG/M |
| 3300018042|Ga0187871_10792776 | Not Available | 528 | Open in IMG/M |
| 3300018043|Ga0187887_10603816 | Not Available | 648 | Open in IMG/M |
| 3300018062|Ga0187784_10317459 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1264 | Open in IMG/M |
| 3300019888|Ga0193751_1272649 | Not Available | 504 | Open in IMG/M |
| 3300020021|Ga0193726_1014584 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4111 | Open in IMG/M |
| 3300020580|Ga0210403_10718825 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300021168|Ga0210406_10360019 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
| 3300021168|Ga0210406_10427476 | Not Available | 1057 | Open in IMG/M |
| 3300021180|Ga0210396_10979507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 717 | Open in IMG/M |
| 3300021432|Ga0210384_10931586 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300021433|Ga0210391_10035421 | All Organisms → cellular organisms → Bacteria | 3998 | Open in IMG/M |
| 3300021433|Ga0210391_10119735 | All Organisms → cellular organisms → Bacteria | 2072 | Open in IMG/M |
| 3300021474|Ga0210390_11141674 | Not Available | 631 | Open in IMG/M |
| 3300021477|Ga0210398_10773602 | Not Available | 774 | Open in IMG/M |
| 3300023019|Ga0224560_101348 | Not Available | 1718 | Open in IMG/M |
| 3300025473|Ga0208190_1096876 | Not Available | 580 | Open in IMG/M |
| 3300025581|Ga0208355_1018276 | All Organisms → cellular organisms → Bacteria | 2120 | Open in IMG/M |
| 3300025604|Ga0207930_1060500 | Not Available | 924 | Open in IMG/M |
| 3300025939|Ga0207665_10682384 | Not Available | 807 | Open in IMG/M |
| 3300026557|Ga0179587_10479917 | Not Available | 815 | Open in IMG/M |
| 3300027164|Ga0208994_1018026 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300027587|Ga0209220_1158058 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300027604|Ga0208324_1121923 | Not Available | 720 | Open in IMG/M |
| 3300027641|Ga0208827_1043893 | Not Available | 1529 | Open in IMG/M |
| 3300027678|Ga0209011_1028672 | All Organisms → cellular organisms → Bacteria | 1777 | Open in IMG/M |
| 3300027678|Ga0209011_1156280 | Not Available | 639 | Open in IMG/M |
| 3300027824|Ga0209040_10223296 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 962 | Open in IMG/M |
| 3300027854|Ga0209517_10028419 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4793 | Open in IMG/M |
| 3300027879|Ga0209169_10464965 | Not Available | 664 | Open in IMG/M |
| 3300027882|Ga0209590_10566891 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 731 | Open in IMG/M |
| 3300027889|Ga0209380_10378337 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Silvibacterium → Silvibacterium bohemicum | 831 | Open in IMG/M |
| 3300027911|Ga0209698_10029198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. WSM1417 | 5073 | Open in IMG/M |
| 3300028676|Ga0302167_10126462 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300028800|Ga0265338_10175041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1641 | Open in IMG/M |
| 3300028800|Ga0265338_10937883 | Not Available | 588 | Open in IMG/M |
| 3300028909|Ga0302200_10165142 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
| 3300029701|Ga0222748_1072087 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300029903|Ga0247271_108396 | Not Available | 1616 | Open in IMG/M |
| 3300029939|Ga0311328_10396706 | Not Available | 993 | Open in IMG/M |
| 3300029945|Ga0311330_10911632 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300030014|Ga0302175_10157572 | Not Available | 539 | Open in IMG/M |
| 3300030659|Ga0316363_10201084 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 830 | Open in IMG/M |
| 3300030706|Ga0310039_10058539 | Not Available | 1688 | Open in IMG/M |
| 3300031028|Ga0302180_10389735 | Not Available | 699 | Open in IMG/M |
| 3300031261|Ga0302140_10218550 | All Organisms → cellular organisms → Bacteria | 1702 | Open in IMG/M |
| 3300031524|Ga0302320_12255834 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300031708|Ga0310686_106966592 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300031718|Ga0307474_11042326 | Not Available | 647 | Open in IMG/M |
| 3300031820|Ga0307473_10502267 | Not Available | 819 | Open in IMG/M |
| 3300032180|Ga0307471_100191195 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2034 | Open in IMG/M |
| 3300032180|Ga0307471_104308833 | Not Available | 502 | Open in IMG/M |
| 3300032261|Ga0306920_103651855 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300032783|Ga0335079_11788110 | Not Available | 598 | Open in IMG/M |
| 3300032805|Ga0335078_11740583 | Not Available | 681 | Open in IMG/M |
| 3300033433|Ga0326726_10855086 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 881 | Open in IMG/M |
| 3300034195|Ga0370501_0038562 | Not Available | 1483 | Open in IMG/M |
| 3300034282|Ga0370492_0325214 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 624 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.01% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 8.11% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 7.21% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.31% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.31% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.31% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.50% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.50% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 4.50% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.60% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.60% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.70% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.70% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.80% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.80% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.80% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.80% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.80% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.80% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.80% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.90% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.90% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.90% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.90% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.90% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.90% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.90% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.90% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
| 3300009641 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Host-Associated | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300018021 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300023019 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU1 | Environmental | Open in IMG/M |
| 3300025473 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025581 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025604 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027164 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028676 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N1_1 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028909 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_1 | Environmental | Open in IMG/M |
| 3300029701 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029903 | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Fen703 | Environmental | Open in IMG/M |
| 3300029939 | I_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029945 | I_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300030014 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N3_3 | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031261 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1 | Environmental | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300034195 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17 | Environmental | Open in IMG/M |
| 3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1042303612 | 3300000955 | Soil | SLLPQPDEPNQALAVLKIIGLTGALLGIGVIIYAFGKRRARAT* |
| JGI1027J12803_1086313012 | 3300000955 | Soil | DEPNKPLAVFKIVGGCGALLLVGVWIYVAGKRRAARNV* |
| JGI12635J15846_106285571 | 3300001593 | Forest Soil | PNKLLAVVKIVGGCGALVVIGVGLYWAGKRRARRTHVSR* |
| JGI12635J15846_106436801 | 3300001593 | Forest Soil | PLAVFKIVGGCGALVLIGVGLYWAGKRRAHQSHGLSH* |
| JGIcombinedJ26739_1007014092 | 3300002245 | Forest Soil | ANKPLAVFKIVGATGALVLVGVWIFLAGKRRAERPS* |
| Ga0062385_105733971 | 3300004080 | Bog Forest Soil | EPNKPLALLKIVGGTGALLLVGGWIYAAGKHRAARAVPGK* |
| Ga0070709_114696232 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | PQPDEPNKLLAVIKVVGLSGLLVLIGTWIYWAGKKRALR* |
| Ga0070733_106129171 | 3300005541 | Surface Soil | PDEPNKPLALLKIVGGCGALLLIGVWIYAAGKRRAARMSLT* |
| Ga0070764_102345691 | 3300005712 | Soil | IPQPDEPNKPLALFKIVGGTGVLVLVGAWLYIAGKRRARAQSQPT* |
| Ga0070764_108468052 | 3300005712 | Soil | DEPNKPLALLKIVGGCGALVLIGVWLYVAGKRRAAQPNM* |
| Ga0066903_1014562952 | 3300005764 | Tropical Forest Soil | PNKPLAVFKVVGGCGALLLIGVFLYLAGKRRAVLV* |
| Ga0080027_102064321 | 3300005993 | Prmafrost Soil | KPLALFKVVGGCGALVLIGAWLYVAGKRRARRQVS* |
| Ga0075024_1006166271 | 3300006047 | Watersheds | PDEPNKLLAVIKIVGLSGLLVLIGAWIYWAVRRRARQGSTFL* |
| Ga0075028_1000124621 | 3300006050 | Watersheds | PPPDEPNKPLAVFKIVGGCGALLVIGMWLYWAGKRRAAQTT* |
| Ga0075029_1001481454 | 3300006052 | Watersheds | LSVLPPPDEPNKPLAVFKIVGGCGALLAIGMWLYWTGRRRANHQEA* |
| Ga0075017_1008408281 | 3300006059 | Watersheds | PQPDEPNKPLALLKIVGGCGALLLIGAWIYVAGKRRARSSRQQGLT* |
| Ga0075019_106506302 | 3300006086 | Watersheds | ILLSLIPQPDEPNKPLALLKIVGGCGALLLVGAWIYWSGKRRAWSGQ* |
| Ga0075030_1012779412 | 3300006162 | Watersheds | EPNKPLALLKIVGGCGALLLIGAWIYVAGKRRARSSRQQGLT* |
| Ga0075030_1013246792 | 3300006162 | Watersheds | DEPNKPLALLKIVGGCGALLLIGAGLYIAGKHRAARAEIA* |
| Ga0070716_1004157962 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | PQPDESNKALALLKILGGCGALLLVGVWLYVAGKSRAGRVPHQPKIV* |
| Ga0070765_1002626473 | 3300006176 | Soil | PDEPNKPLALLKIVGGTGALLLIGAWMYWAGKRRTAQNAQWR* |
| Ga0116218_11169051 | 3300009522 | Peatlands Soil | KPLALFKIVGGTGAIVLIGAWIYWAGKRRAARGTKTVT* |
| Ga0116113_11660621 | 3300009638 | Peatland | IALSVLPPPDEPNKPLAVFKIVGGCGGLVLIGAWLFWSGKRRAQRHPSQQA* |
| Ga0116120_12163292 | 3300009641 | Peatland | DEPNKPLALFKIVGGTAALLLLGIGIYVAGRQRGSENI* |
| Ga0116223_100515923 | 3300009839 | Peatlands Soil | LSVLPPPDEPNKPLAVFKIVGGCGALVLIGVGLHWVGKRRAGSIS* |
| Ga0126370_100782913 | 3300010358 | Tropical Forest Soil | LPPPDEPNKPLAVFKIVGGCGALLLIGMWIYWAGRRRAKRIEAHAGI* |
| Ga0126372_125375921 | 3300010360 | Tropical Forest Soil | DEPNKPLAVIKVVGLSGLMVLIGAWIYLAGKRKAQQD* |
| Ga0137384_115094451 | 3300012357 | Vadose Zone Soil | PLAMLKVIGGCGALVLVGAWIYWAGKRRATNAASRV* |
| Ga0157315_10623662 | 3300012508 | Arabidopsis Rhizosphere | DEPNKILAVVKIVGLSGILVGMGAWIYWSGKRRAARRRK* |
| Ga0137394_101555511 | 3300012922 | Vadose Zone Soil | LPPPDEPNKPLAVFKIVGGCGALVLIGMWLYWAGKRRALRDQQILSR* |
| Ga0137416_112468611 | 3300012927 | Vadose Zone Soil | PPDEPNKLLAVFKIVGGCGALVLIGVGLYWAGKRRARRSAEFSR* |
| Ga0137404_104392961 | 3300012929 | Vadose Zone Soil | PNKALAVFKIVGGCGALVLIGMWLYWSGKRRARRAA* |
| Ga0137407_114671382 | 3300012930 | Vadose Zone Soil | QPDEPNKPLALLKIVGGTAVMVLIGVCLYVAGKGRAQNSGLRT* |
| Ga0164304_103806322 | 3300012986 | Soil | EPNKLLAVIKIVGLSGLLVLIGAWIYWAGKRRAAREQSP* |
| Ga0181531_105604841 | 3300014169 | Bog | PNKPLALFKVVGATMALVLLGVWIYATGKRRAASKAGAST* |
| Ga0181531_109648372 | 3300014169 | Bog | VIPQPDEPNKPLAILKVVGGSIVLVLIGAWIYWAGKRRANLTRK* |
| Ga0182024_127008362 | 3300014501 | Permafrost | KALAVFKIVGGCGALVVIGVGLYWAGKRRAAWLL* |
| Ga0181522_106448583 | 3300014657 | Bog | DEPNKPLAVFKIVGGCGALVLIGVGLYCLGKRRAQRNPSIWH* |
| Ga0182034_103488593 | 3300016371 | Soil | PQPDEPNKPLALFKVVGGCGALLLVGVWIYLAGKRRALRTDGPSR |
| Ga0181505_104121773 | 3300016750 | Peatland | LIPQPDEPNKPLALLKIVGGTGALVLVGMWIYLAGKRRAAKSSMEK |
| Ga0187802_102006241 | 3300017822 | Freshwater Sediment | PQPDEPNKPLALFKVVGGCGALLLIGAWIYIAGKRRAARPA |
| Ga0187820_11216631 | 3300017924 | Freshwater Sediment | PQPDEPNKLLALLKIVGGCGALLLIGVWIYRAGKRRAT |
| Ga0187814_102727021 | 3300017932 | Freshwater Sediment | LSLIPQPDEPNKPLALFKVVGGCGALVLIGAWIYIAGKRRAAREAAKET |
| Ga0187847_106957852 | 3300017948 | Peatland | PDEPNKPLAVFKIVGGCGALLLIGAGLHWTGKRRAQRTADASR |
| Ga0187817_110232831 | 3300017955 | Freshwater Sediment | LSLIPPPDEPNKPLAVLKVVGGCGALLFIGAWIYVAGKHRAAQASARET |
| Ga0187777_112709972 | 3300017974 | Tropical Peatland | DEPNKPLALFKIVGGTGALLLVGVWLYRAGKRRAIA |
| Ga0187884_100503703 | 3300018009 | Peatland | LPPPDEPNKPLAVLKIVGGCGALLLIGVWLYWTGKRRAQRTM |
| Ga0187874_101284132 | 3300018019 | Peatland | DEPNKPLALFKIIGGTGALVLIGAWIYWAGKRRAARVATRET |
| Ga0187882_12029311 | 3300018021 | Peatland | NKPLAVFKIVGGCGALLLIGVWLYWAGKRRAQRNPDVSR |
| Ga0187875_104186732 | 3300018035 | Peatland | IPQPDEPNKPLALLKIVGGCAALVLIGVGIYVAGKHRAGPR |
| Ga0187855_101939512 | 3300018038 | Peatland | PDEPNKPLAVFKIVGGCGALVLIGVWLYAAGKRRAARPA |
| Ga0187871_107927761 | 3300018042 | Peatland | QPDEPNKLLALLKIVGGTGALVLIGAWIYVAGKHRAARAKLE |
| Ga0187887_106038162 | 3300018043 | Peatland | IPQPDEPNKPLALFKIIGGTGALVLIGAWIYWAGKRRAARVATRET |
| Ga0187784_103174591 | 3300018062 | Tropical Peatland | SVIPAPDEANKPLAVVKVVGGSIVLIAAGAGTYWFGKRQR |
| Ga0193751_12726492 | 3300019888 | Soil | IPQPDEPNKLLAVIKIVGLSGLLVLIGAWIYWAGKRRALK |
| Ga0193726_10145844 | 3300020021 | Soil | PQPDEPNKLLAVIKIVGLSGLMVLIGAWIYWAGKRRATRQRVLEP |
| Ga0210403_107188253 | 3300020580 | Soil | LIPQPDEPNKPLALFKIVGGTGALVLIGAWIYWAGKRRAHAGKKTQAALS |
| Ga0210406_103600191 | 3300021168 | Soil | NKALAVFKIVGGCGALVLIGVGLYWAGKRRAQKSPHFSR |
| Ga0210406_104274762 | 3300021168 | Soil | PNKTLAVFKIVGGCGALVLIGVGLYWAGKRRAQRSPGLFH |
| Ga0210396_109795071 | 3300021180 | Soil | QPDEPNKPLALLKIVGGTGALLLIGAWMYWAGKRRTAQNAQWR |
| Ga0210384_109315862 | 3300021432 | Soil | EPNKPLAVFKIVGGCGALVLIGVGLYWAGKRRAQKSPDFSR |
| Ga0210391_100354215 | 3300021433 | Soil | SLIPQPDEPNKPLALLKIVGGTGALLLIGAWMYWAGKRRTAQNAQWR |
| Ga0210391_101197351 | 3300021433 | Soil | SLIPQPDEPNKLLALLKIVGGTGVLVLVGIGIYAAGRRRAARA |
| Ga0210390_111416741 | 3300021474 | Soil | AVSVLPPPDEPNKPLAVFKIVGGCGALVLIGVGLYWTGKRRAAKAI |
| Ga0210398_107736021 | 3300021477 | Soil | LIPQPDEPNKLLALLKIVGGTGVLVLVGIGIYAAGRRRAARA |
| Ga0224560_1013482 | 3300023019 | Soil | SLIPQPDEPNKPLALLKIVGGTGALVLMGAGIYIAGKRRAAKPVIET |
| Ga0208190_10968761 | 3300025473 | Peatland | IPQPDEPNKLLALSKIVGGTGALVVVGVWLYRAGKRRAADSVLTH |
| Ga0208355_10182763 | 3300025581 | Arctic Peat Soil | PNKPLAALKIVGGCGALLLIGVGLYWAGKRRAQTGN |
| Ga0207930_10605002 | 3300025604 | Arctic Peat Soil | NKPLAMLKVIGGCGALVLIGAWIYWAGKRRAARDASPA |
| Ga0207665_102618231 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | LIPQPDESNKALALLKILGGCGALLLVGVWLYVAGKSRAGRVPHQPKIV |
| Ga0207665_106823842 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | LIPQPDEPNKPLALFKVVGGCGALVLIGAWLYMAGKRRAAEG |
| Ga0179587_104799172 | 3300026557 | Vadose Zone Soil | QAEELNKPLALLKVVGGTAVLVSLGVWIYIAGKRRAARAPQSEM |
| Ga0208994_10180263 | 3300027164 | Forest Soil | PAPDEPNKPLAVFKIVGGTGALLVFGAWLYLRGKRRARII |
| Ga0209220_11580582 | 3300027587 | Forest Soil | DEPNKLLAVFKIVGGCGALVLIGIGLYWAGKRRARRSPDFSR |
| Ga0208324_11219232 | 3300027604 | Peatlands Soil | LALFKIVGGTGAIVLIGAWIYWAGKRRAARGTKTVT |
| Ga0208827_10438931 | 3300027641 | Peatlands Soil | PNKPLALFKVVGGCGALVLIGVWIYRAGRKRAIAT |
| Ga0209011_10286721 | 3300027678 | Forest Soil | ALSVLPPPDEPNKLLAVFKIVGGCGALVLIGIGLYWAGKRRARRSPDFSR |
| Ga0209011_11562801 | 3300027678 | Forest Soil | EPNKPLALLKIVGGTGALMVVGGLIYVAGKRRAARLHEET |
| Ga0209040_102232963 | 3300027824 | Bog Forest Soil | QPDEPNKPLALLKIVGGTAVLVLVGIGIYVAGKRRAAQNKIA |
| Ga0209517_100284195 | 3300027854 | Peatlands Soil | PPPDEPNKPLAVFKIVGGCGALVLIGVGLHWVGKRRAGSIS |
| Ga0209169_104649651 | 3300027879 | Soil | KPLALFKIVGGTGVLVLVGAWLYIAGKRRARAQSQPT |
| Ga0209590_105668912 | 3300027882 | Vadose Zone Soil | EPNKPLALFKVVGGCGALVAIGAGIYVAGKRRAKLG |
| Ga0209380_103783373 | 3300027889 | Soil | QPDEANKPLALFKIVGGTGLLVLVGVWIYAAGKRRASR |
| Ga0209698_100291981 | 3300027911 | Watersheds | LFTIALSVLPPPDEPNKTLAVFKIVGGCGALVLIGAGLYWAGKRRAARMT |
| Ga0302167_101264621 | 3300028676 | Fen | DEPNKPLAVFKIVGGCGALVLIGMWLYWSGKRRAARTT |
| Ga0265338_101750412 | 3300028800 | Rhizosphere | PDEPNKALALFKVVGGTGALVVIGAWIYWAGKRRAAREHQLT |
| Ga0265338_109378832 | 3300028800 | Rhizosphere | NKPLAMFKVIGGCGALVLIGAWIYWAGKRRSATDASAA |
| Ga0302200_101651421 | 3300028909 | Bog | VLPPPDEPNKPLAVFKIVGGCGGLVLIGAWLFWSGKRRAQRHPSQQA |
| Ga0222748_10720871 | 3300029701 | Soil | LALFKIVGGTGALVLIGAWIYWAGKRRAHTGKKTQAALS |
| Ga0247271_1083961 | 3300029903 | Soil | SMLPPPDEPNKPLAVFKIVGGCGALVLMGVGLYWAGKRRQL |
| Ga0311328_103967061 | 3300029939 | Bog | PLALLKIVGGTGVLVLVGVAIYFAGKRRAAQSVLTN |
| Ga0311330_109116321 | 3300029945 | Bog | PDEPNKPLALLKIVGGTGVLVLVGAGIYNTGKRRGARSIA |
| Ga0302175_101575721 | 3300030014 | Fen | PDEPNKPLAVFKIVGGCGALLLIGVWLYWAGKKRAMAK |
| Ga0316363_102010842 | 3300030659 | Peatlands Soil | LSVLPPPDEPNKPLAVFKIVGGCGALVLIGVGLHWVGKRRAGSIS |
| Ga0310039_100585391 | 3300030706 | Peatlands Soil | DEPNKPLALFKIVGGTGAIVLIGAWIYWAGKRRAARGTKTVT |
| Ga0302180_103897351 | 3300031028 | Palsa | QADEPNKTLALFKILGATTALVLIGVWIYAAGKRRAAKEVGAL |
| Ga0302140_102185501 | 3300031261 | Bog | QPDEPNKPLALLKIVGGTGVLVLVGAGIYNTGKRRGARSIA |
| Ga0302320_122558341 | 3300031524 | Bog | SVLPPPDEPNKALAVLKIVGGCGALVLLGVGLYWSGKRRAQRGVGLSTDAASTGPR |
| Ga0310686_1069665921 | 3300031708 | Soil | NKLLALLKIVGGTTALVLIGLGIYVAAKRKAAAIG |
| Ga0307474_110423262 | 3300031718 | Hardwood Forest Soil | LIPQPDEPNKPLALFKIVGGTGALVLIGAWIYAAGKHRAASPMQNKLS |
| Ga0307477_100242124 | 3300031753 | Hardwood Forest Soil | KALALLKILGGCGALLLVGVWLYVAGKRRAARVAHQPKIV |
| Ga0307473_105022672 | 3300031820 | Hardwood Forest Soil | VLPQPDEPNKSLAVVKIVGGCGVLVLIGVGLYWTGKRRAMRSHGLSH |
| Ga0307478_102973681 | 3300031823 | Hardwood Forest Soil | SLIPQPDEPNKALALLKILGGCGALLLVGVWLYVAGKRRAARGAHQPKIV |
| Ga0307471_1001911953 | 3300032180 | Hardwood Forest Soil | LPPPDEPNKLLAVFKIVGGCGALVLIGVGLYWAGKRRAVTR |
| Ga0307471_1043088332 | 3300032180 | Hardwood Forest Soil | PQPDEPNKLLAVIKIVGLSGLLVLIGAWIYWAGKRRAQSS |
| Ga0306920_1036518551 | 3300032261 | Soil | ISVIPQHDEPNKLLAVIKVVGGSAVLLAVGAWLYWAGKQRASI |
| Ga0335079_117881101 | 3300032783 | Soil | TSLTILLSLLPQPDEPNKLLAVVKIVGSTGAILAVGAWIYWTGKRRTT |
| Ga0335078_117405831 | 3300032805 | Soil | DEPNKPLAVLKIVGGCAALILVGVWIYVAGKRRAARALIKSDTPR |
| Ga0326726_108550861 | 3300033433 | Peat Soil | DEPNKLLAVIKIVGLSGLLVLIGAWIYWAGKKRALSKTT |
| Ga0370501_0038562_4_135 | 3300034195 | Untreated Peat Soil | LSLIPQPDEPNKLLAVIKIVGLSGLLVLIGAWIYWAGKKRALR |
| Ga0370492_0325214_2_121 | 3300034282 | Untreated Peat Soil | PNKPLALFKIVGGTGVLVLVGVGIYVVGKHRAAASIQNT |
| ⦗Top⦘ |