


| Basic Information | |
|---|---|
| Family ID | F086029 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 111 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MAHVCRAETAAMPGWYGIAAAFDDVQFDRDDRIPSRFLKP |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 111 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.30 % |
| % of genes from short scaffolds (< 2000 bps) | 84.68 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.21 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (31.532 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.432 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.351 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.41% β-sheet: 16.18% Coil/Unstructured: 79.41% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.21 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 111 Family Scaffolds |
|---|---|---|
| PF13419 | HAD_2 | 57.66 |
| PF13620 | CarboxypepD_reg | 16.22 |
| PF00708 | Acylphosphatase | 1.80 |
| PF00156 | Pribosyltran | 1.80 |
| PF02805 | Ada_Zn_binding | 0.90 |
| PF00588 | SpoU_methylase | 0.90 |
| PF01663 | Phosphodiest | 0.90 |
| PF01022 | HTH_5 | 0.90 |
| PF16864 | Dimerisation2 | 0.90 |
| PF00999 | Na_H_Exchanger | 0.90 |
| PF00892 | EamA | 0.90 |
| PF16702 | DUF5063 | 0.90 |
| COG ID | Name | Functional Category | % Frequency in 111 Family Scaffolds |
|---|---|---|---|
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.90 |
| COG0219 | tRNA(Leu) C34 or U34 (ribose-2'-O)-methylase TrmL, contains SPOUT domain | Translation, ribosomal structure and biogenesis [J] | 0.90 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.90 |
| COG0565 | tRNA C32,U32 (ribose-2'-O)-methylase TrmJ or a related methyltransferase | Translation, ribosomal structure and biogenesis [J] | 0.90 |
| COG0566 | tRNA G18 (ribose-2'-O)-methylase SpoU | Translation, ribosomal structure and biogenesis [J] | 0.90 |
| COG2169 | Methylphosphotriester-DNA--protein-cysteine methyltransferase (N-terminal fragment of Ada), contains Zn-binding and two AraC-type DNA-binding domains | Replication, recombination and repair [L] | 0.90 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.90 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.90 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.90 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_101050515 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300002562|JGI25382J37095_10032814 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2035 | Open in IMG/M |
| 3300004121|Ga0058882_1723292 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300005177|Ga0066690_10956459 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300005552|Ga0066701_10387407 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300005553|Ga0066695_10612077 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300005560|Ga0066670_10038145 | All Organisms → cellular organisms → Bacteria | 2407 | Open in IMG/M |
| 3300005602|Ga0070762_10460118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 829 | Open in IMG/M |
| 3300005952|Ga0080026_10268870 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300006050|Ga0075028_100475683 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300006174|Ga0075014_100350003 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300006796|Ga0066665_11512158 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300006893|Ga0073928_10007502 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 14087 | Open in IMG/M |
| 3300009012|Ga0066710_100149639 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3244 | Open in IMG/M |
| 3300009038|Ga0099829_10413957 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1115 | Open in IMG/M |
| 3300009038|Ga0099829_11139482 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300009090|Ga0099827_10460821 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300009618|Ga0116127_1050815 | All Organisms → cellular organisms → Bacteria | 1192 | Open in IMG/M |
| 3300010337|Ga0134062_10342046 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300010343|Ga0074044_10134931 | All Organisms → cellular organisms → Bacteria | 1655 | Open in IMG/M |
| 3300010358|Ga0126370_12269036 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300010360|Ga0126372_12712923 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300010400|Ga0134122_10009913 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7075 | Open in IMG/M |
| 3300011120|Ga0150983_10563646 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300011269|Ga0137392_11317604 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300012169|Ga0153990_1067076 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300012189|Ga0137388_10667245 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
| 3300012200|Ga0137382_10742898 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300012203|Ga0137399_10496022 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
| 3300012203|Ga0137399_11127963 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300012203|Ga0137399_11698695 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300012205|Ga0137362_10685774 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300012205|Ga0137362_11616800 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300012207|Ga0137381_10052058 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3385 | Open in IMG/M |
| 3300012207|Ga0137381_10618221 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
| 3300012208|Ga0137376_10493712 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
| 3300012209|Ga0137379_10260019 | All Organisms → cellular organisms → Bacteria | 1648 | Open in IMG/M |
| 3300012211|Ga0137377_11279799 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300012351|Ga0137386_10280074 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
| 3300012361|Ga0137360_10022551 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4231 | Open in IMG/M |
| 3300012361|Ga0137360_11371984 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
| 3300012917|Ga0137395_10638955 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300012927|Ga0137416_11686880 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300012927|Ga0137416_11699429 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300012927|Ga0137416_11835968 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300012927|Ga0137416_12195376 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300012929|Ga0137404_10478521 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 1108 | Open in IMG/M |
| 3300012930|Ga0137407_12019493 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300012957|Ga0164303_11212542 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300013307|Ga0157372_12042895 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 659 | Open in IMG/M |
| 3300014150|Ga0134081_10026006 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1672 | Open in IMG/M |
| 3300014157|Ga0134078_10072683 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1237 | Open in IMG/M |
| 3300015054|Ga0137420_1318756 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
| 3300015054|Ga0137420_1366032 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2255 | Open in IMG/M |
| 3300015054|Ga0137420_1461460 | All Organisms → cellular organisms → Bacteria | 6845 | Open in IMG/M |
| 3300015264|Ga0137403_10769377 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300015359|Ga0134085_10474484 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300016270|Ga0182036_10846930 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300017928|Ga0187806_1033135 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1534 | Open in IMG/M |
| 3300017995|Ga0187816_10035749 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2035 | Open in IMG/M |
| 3300018085|Ga0187772_10458247 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
| 3300020021|Ga0193726_1296881 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300020199|Ga0179592_10020825 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2917 | Open in IMG/M |
| 3300020579|Ga0210407_11333990 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300020579|Ga0210407_11483327 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300020580|Ga0210403_11338252 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300020583|Ga0210401_10043141 | All Organisms → cellular organisms → Bacteria | 4269 | Open in IMG/M |
| 3300021168|Ga0210406_10670377 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 802 | Open in IMG/M |
| 3300021170|Ga0210400_10919821 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 714 | Open in IMG/M |
| 3300021170|Ga0210400_11350271 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300021171|Ga0210405_11111464 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300021178|Ga0210408_10485723 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 982 | Open in IMG/M |
| 3300021178|Ga0210408_10598093 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300021181|Ga0210388_10229171 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1629 | Open in IMG/M |
| 3300021181|Ga0210388_10907445 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300021402|Ga0210385_10490667 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300021407|Ga0210383_11470925 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300021407|Ga0210383_11574743 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300021432|Ga0210384_11639730 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300021475|Ga0210392_11282783 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300021478|Ga0210402_10015494 | All Organisms → cellular organisms → Bacteria | 6523 | Open in IMG/M |
| 3300021478|Ga0210402_11683003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 561 | Open in IMG/M |
| 3300021559|Ga0210409_10044941 | All Organisms → cellular organisms → Bacteria | 4174 | Open in IMG/M |
| 3300021559|Ga0210409_10667784 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300021560|Ga0126371_13530501 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300022557|Ga0212123_10940612 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300025414|Ga0208935_1015715 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
| 3300025906|Ga0207699_10523173 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 858 | Open in IMG/M |
| 3300026328|Ga0209802_1120019 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1156 | Open in IMG/M |
| 3300026335|Ga0209804_1088792 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1437 | Open in IMG/M |
| 3300026557|Ga0179587_10027007 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3151 | Open in IMG/M |
| 3300027512|Ga0209179_1128086 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300027674|Ga0209118_1044717 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1323 | Open in IMG/M |
| 3300027829|Ga0209773_10156072 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300027862|Ga0209701_10706750 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300027875|Ga0209283_10887086 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300027889|Ga0209380_10391472 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 815 | Open in IMG/M |
| 3300027915|Ga0209069_10524677 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300028906|Ga0308309_10242639 | All Organisms → cellular organisms → Bacteria | 1504 | Open in IMG/M |
| 3300028906|Ga0308309_11564711 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300029636|Ga0222749_10421948 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 710 | Open in IMG/M |
| 3300029636|Ga0222749_10680818 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300031708|Ga0310686_101064600 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 3228 | Open in IMG/M |
| 3300031718|Ga0307474_10831804 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 730 | Open in IMG/M |
| 3300031720|Ga0307469_11073447 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300031835|Ga0318517_10237697 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300031879|Ga0306919_10565758 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300031962|Ga0307479_11740060 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300032001|Ga0306922_10162396 | All Organisms → cellular organisms → Bacteria | 2392 | Open in IMG/M |
| 3300032180|Ga0307471_101221559 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300034125|Ga0370484_0227677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 514 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 31.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.31% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.60% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.60% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.60% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.60% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.70% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.70% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.80% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.80% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.80% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.90% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.90% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.90% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.90% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.90% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.90% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.90% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.90% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.90% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004121 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF109 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009618 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012169 | Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC074 MetaG | Host-Associated | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300025414 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1010505151 | 3300002245 | Forest Soil | MAHVRRAETAAMPGWYGIAAAFDDVQFDRDDRLPSRFLKP* |
| JGI25382J37095_100328141 | 3300002562 | Grasslands Soil | TIATVRRIELAATPGWFGVAASFDDMEFGRDDMIPSRFLDE* |
| Ga0058882_17232921 | 3300004121 | Forest Soil | VSTARVQRIEPAAMPGWYGVAASFDDVQFDRDDGVPSRFLRP* |
| Ga0066690_109564592 | 3300005177 | Soil | KAHVQRYEPASMRGWYGVAASFDDVQFDRDDRIPTRFLKP* |
| Ga0066701_103874072 | 3300005552 | Soil | RVCRVEVAAMPGWYGIAAFFEDVQFDRDDGVPSRFLKP* |
| Ga0066695_106120772 | 3300005553 | Soil | RTETAAMPGWHGIAAIFDDVQFDRDDRIPSRYLKS* |
| Ga0066670_100381451 | 3300005560 | Soil | MGMGSVVMTTLARVCRIEAAAMPGWHGLAACFDDVQFDHDDDMPSRFLKP* |
| Ga0070762_104601181 | 3300005602 | Soil | IVTTARVQRIEPAAMPGWYGVAASFDDVQFDRDDGVPSRFLRP* |
| Ga0080026_102688701 | 3300005952 | Permafrost Soil | AHVRRSDPAAMPGWYGIAATFDDVQFDRDDCVPTRFLSV* |
| Ga0075028_1004756832 | 3300006050 | Watersheds | GNVVMATMAHVCRTEPAAMPGWYGIAAAFDDVQFDRDDHMPSRFLKP* |
| Ga0075014_1003500031 | 3300006174 | Watersheds | LGNVVVATMAHVCRTESAAMPGWYGVAAAFDDVQFDRDDHMPSRFLKP* |
| Ga0066665_115121581 | 3300006796 | Soil | NVVVATMAHVCRAETAAMPGWYGIAAAFDDVQFDRDDRIPSRFLKP* |
| Ga0073928_1000750213 | 3300006893 | Iron-Sulfur Acid Spring | VRRLEPAATPGWYGVAVLFDDMSFDRDDRVPSRFLSL* |
| Ga0066710_1001496396 | 3300009012 | Grasslands Soil | CRAEAAAMPGWYGIAAAFDDVQFDRDDRIPSRFLKP |
| Ga0099829_104139573 | 3300009038 | Vadose Zone Soil | AETAAMPGWYGIAAAFDDVQFDRDDRIPSRFLVVS* |
| Ga0099829_111394821 | 3300009038 | Vadose Zone Soil | NVVAATMSRVCRTEPAAVAGWHGIAAAFDDVQFDRDDRIPSRYLKP* |
| Ga0099827_104608213 | 3300009090 | Vadose Zone Soil | VCRIEVAAMPGWYGIAAFFEDVQFDRDDGVPSRFLKP* |
| Ga0116127_10508151 | 3300009618 | Peatland | VEAAATPGWHGIAASFDDVEFDRDDLVPSRFLNW* |
| Ga0134062_103420462 | 3300010337 | Grasslands Soil | GRGSVLMTTMAHVCRTEAAAMPGWYGFAACFDDVEFDHDDDLPSRFLRP* |
| Ga0074044_101349311 | 3300010343 | Bog Forest Soil | MGHGSVVIVTTARVQRCGPAATPGWYGIAASYDDVQFDRDDGLPSHFQRP* |
| Ga0126370_122690361 | 3300010358 | Tropical Forest Soil | TLAHVCRTEAAAMPGWYGLAACFDDVQFDHDDDLPSRFLKR* |
| Ga0126372_127129232 | 3300010360 | Tropical Forest Soil | RRIEPAAMPGWYGIAVAFTDVQFDRDDGIPARFL* |
| Ga0134122_100099137 | 3300010400 | Terrestrial Soil | ARVQRIETAAMPGWYGVAATFDELAFDRDDRVPSRFLKP* |
| Ga0150983_105636461 | 3300011120 | Forest Soil | GNVVVATMAHVRRAETAAMPGWYGIAAAFDDVQFDRDDHIPSRFLKP* |
| Ga0137392_113176042 | 3300011269 | Vadose Zone Soil | TMAHVCRAEAAAMPGWYGIAAAFDDVQFDRDDRIPSRFLKP* |
| Ga0153990_10670761 | 3300012169 | Attine Ant Fungus Gardens | TEPAATPGWYGIAASFDDVQFDRDDRVPARFLNP* |
| Ga0137388_106672452 | 3300012189 | Vadose Zone Soil | HVRRVEPAAMPNWYGIAASFDDVQFDRDDGIPIRFL* |
| Ga0137382_107428981 | 3300012200 | Vadose Zone Soil | MAHVCRAETAAMPGWYGIAAAFDDVQFDRDDRIPSRFLKP* |
| Ga0137399_104960222 | 3300012203 | Vadose Zone Soil | CRAETAAMPGWYGIAAAFDDVQFDRDDRVPSRFLKP* |
| Ga0137399_111279631 | 3300012203 | Vadose Zone Soil | VVAATMARVCRTEAAAVPGWHGIAAAFDEVQFDRDDCIPSRYLKP* |
| Ga0137399_116986951 | 3300012203 | Vadose Zone Soil | HEPASMPGWYGIAASFDDVQFDRDDRVPSRFLNP* |
| Ga0137362_106857741 | 3300012205 | Vadose Zone Soil | RAEPAATPNWYGIAASFDDMEFDRDDGVPSRFLGS* |
| Ga0137362_116168001 | 3300012205 | Vadose Zone Soil | AEAAAMPGWYGIAAAFDDVQFDRDDRIPSRFLKP* |
| Ga0137381_100520581 | 3300012207 | Vadose Zone Soil | RTEAAAMRGWYGLAASFDDVQFDHDDDVPSRFLKP* |
| Ga0137381_106182212 | 3300012207 | Vadose Zone Soil | RIEVAAMPGWYGIAAFFEDVQFDRDDGVPSRFMKP* |
| Ga0137376_104937122 | 3300012208 | Vadose Zone Soil | GNVVVATMAHVCRAETAAMPGWYGIAAAFDDVQFDRDDRIPSRFLKP* |
| Ga0137379_102600191 | 3300012209 | Vadose Zone Soil | TMARVCRVEVAAMPGWYGIAAFFEDVQFDRDDGVPSRFLKP* |
| Ga0137377_112797992 | 3300012211 | Vadose Zone Soil | VCRIEAAAMPSWFGIAATFDDVQFDRDDGIPSRFLKP* |
| Ga0137386_102800741 | 3300012351 | Vadose Zone Soil | TMARVCRIEVAAMPGWYGIAAFFEDVQFDRDDGVPSRFMKP* |
| Ga0137360_100225511 | 3300012361 | Vadose Zone Soil | VMMTMAHVQRAEPAATPNWYGIAASFDDMEFDRDDGVPSRFLGS* |
| Ga0137360_113719842 | 3300012361 | Vadose Zone Soil | ATTARVRRLEPAAMPGWYGVAALFDDMSFDRDDRVPSRFLGL* |
| Ga0137395_106389551 | 3300012917 | Vadose Zone Soil | NVVMATMANVVRAEAAAMPGWHGIAAAFDDVQFDRDDRIPSRFLKP* |
| Ga0137416_116868802 | 3300012927 | Vadose Zone Soil | CRAEAAAMPGWYGIAAAFDDVQFDRDDHIPSRFLKP* |
| Ga0137416_116994291 | 3300012927 | Vadose Zone Soil | GNVVLVSMARVRRTEPSAVPGWFGVAAAFEDVQFDRDDGLPSRFQKL* |
| Ga0137416_118359682 | 3300012927 | Vadose Zone Soil | ATMAHVCRAETAAMPGWYGIAAAFDDVQFDRDDRIPSRFLKP* |
| Ga0137416_121953762 | 3300012927 | Vadose Zone Soil | HVCRAETAAMPGWYGIATSFDDVQFDRDDRLPSRFLKP* |
| Ga0137404_104785211 | 3300012929 | Vadose Zone Soil | NVVVATMAHVCRREPAATPGWFGIAAAFDDVQFDRDDRIPSRYLKP* |
| Ga0137407_120194931 | 3300012930 | Vadose Zone Soil | RTESAAMPGWFGVAAAFDDVEFDRDDGLPCRFQKP* |
| Ga0164303_112125422 | 3300012957 | Soil | VGRTELAAVPGWFGAAAAFDDVQFDRDDGLPSRFQKP* |
| Ga0157372_120428952 | 3300013307 | Corn Rhizosphere | RIETAAMPGWYGVAATFDELAFDRDDRVPSRFLKP* |
| Ga0134081_100260061 | 3300014150 | Grasslands Soil | NVVVATMARVCRTETVAMPGWHGIAAAFDDVQFDRDDCIPSRYLKP* |
| Ga0134078_100726831 | 3300014157 | Grasslands Soil | GNVVAVTMARVRRTETAAMPGWHGIAAIFDDVQFDRDDRIPSRYLKS* |
| Ga0137420_13187561 | 3300015054 | Vadose Zone Soil | GLGNVVVATMAHVRRAETAAVPGWFGIAAAFDDVQFDRDDRIPSRFLKP* |
| Ga0137420_13660321 | 3300015054 | Vadose Zone Soil | MATMAHVCRAETAAMPGWHGIAAAFKEVLQFDRDDRIPSRFLKP* |
| Ga0137420_14614602 | 3300015054 | Vadose Zone Soil | MAHVCRIETAAMPGWHGIAAAFDDVQFDRDDRVPSRYLKP* |
| Ga0137403_107693772 | 3300015264 | Vadose Zone Soil | ATMAHVCRAETAAMPGWHGIAAAFKEVQFDRDDRIPSRFLKP* |
| Ga0134085_104744841 | 3300015359 | Grasslands Soil | TVRRIEPAATPGWFGVAASFDDMEFGRDDVIPSRFLDA* |
| Ga0182036_108469302 | 3300016270 | Soil | MGRGSVVMTTMAHVCRAEAAATPGWYELAACFDDVQFDHDDDLPSRFLKP |
| Ga0187806_10331353 | 3300017928 | Freshwater Sediment | MVTLAQVCRTEKADMPGWFGVAASFNDVQFDRDDSIPSRYLKP |
| Ga0187816_100357493 | 3300017995 | Freshwater Sediment | LAQVCRVEKADMPGWFGVAASFNDVQFDRDDSIPSRYLKP |
| Ga0187772_104582472 | 3300018085 | Tropical Peatland | VCRIEAANMPGWYGIAAKFEDFGFDRDDRIPEPITVD |
| Ga0193726_12968811 | 3300020021 | Soil | RVERAAMPGWYGVAASFDDVEFDRDDSVPTRFECF |
| Ga0179592_100208251 | 3300020199 | Vadose Zone Soil | TTMARVCRTETAAMPGWHGIAAAFDDVQFDRDDRIPSRYLKP |
| Ga0210407_113339901 | 3300020579 | Soil | STARVQRIEPAAMPGWYGVAASFDDVQFDRDDGVPSRFLRP |
| Ga0210407_114833272 | 3300020579 | Soil | RAEAAAMPGWYGIAAAFDDVQFDRDDRIPSRFLKP |
| Ga0210403_113382521 | 3300020580 | Soil | HVQRYEPASMPGWYGIAAAFDDVQFDRDDRVPTRFLKP |
| Ga0210401_100431411 | 3300020583 | Soil | KAHVQRYEPASMPGWYGIAAAFDDVQFDRDDRVPTRFLKP |
| Ga0210406_106703771 | 3300021168 | Soil | ARVQRIEPAAMPGWYGVAASFDDVQFDRDDGVPSRFLRP |
| Ga0210400_109198212 | 3300021170 | Soil | SRAHVQRCETAAMPGWYGIATSFDDVQFDRDDRVPARFLKP |
| Ga0210400_113502712 | 3300021170 | Soil | NVVLATRAHVQRCDPAATPGWHGIAALFDDVQFDRDDRVPTRFLKP |
| Ga0210405_111114642 | 3300021171 | Soil | TRAHVQRSDPAATPGWHGIAASFDDVQFDRDDRVPSRFLKP |
| Ga0210408_104857231 | 3300021178 | Soil | ARVQRLEPAAVPRWYGVAALFDDMCFDRDDRVPSRFLNL |
| Ga0210408_105980932 | 3300021178 | Soil | LATRAHVQRCDPAATPGWHGIAALFDDVQFDRDDRVPTRFLKP |
| Ga0210388_102291711 | 3300021181 | Soil | TARVQRIEPAAMPGWYGVAAAFDDVKFDRDDGVPSRFLRP |
| Ga0210388_109074451 | 3300021181 | Soil | RVQRIEAAAMPGWYGVAAAFDDVHFDRDDGLPSRFQRP |
| Ga0210385_104906671 | 3300021402 | Soil | QRLEPAAMPGWYGVAALFDDMSFDRDDRVPARFLKL |
| Ga0210383_114709251 | 3300021407 | Soil | RVRRLEPAAMPGWYGVAALFDDMSFDRDDRVPARFLKL |
| Ga0210383_115747431 | 3300021407 | Soil | VVATTACVRRLEPAAMPGWYGVAALFDDMSFDRDDRVPARFLKL |
| Ga0210384_116397302 | 3300021432 | Soil | MVTKAHVSRMEAAAMPGWYGVAAAFDDVEFDRDDGLPTRFLKR |
| Ga0210392_112827831 | 3300021475 | Soil | VKRLEPAATPGWYGVAALFEDVAFDRDDRVPTRFME |
| Ga0210402_1001549410 | 3300021478 | Soil | VRRIEPAAMPGWYGVAASFDDVQFDRDDRVPSRFLQP |
| Ga0210402_116830031 | 3300021478 | Soil | VVIVSSARVQRIEPAAMPGWYGVAAAFDDVHFDRDDGLPSRFLRP |
| Ga0210409_100449413 | 3300021559 | Soil | VERAEPAAMPNWYGIAASFVDMQFDRDDVLPSRFLSS |
| Ga0210409_106677842 | 3300021559 | Soil | HVRRIHPAAVPGWYGIAANFDDVSFDRDDFIPSRFLGT |
| Ga0126371_135305011 | 3300021560 | Tropical Forest Soil | SVLMTTMAHVCRTEAAAMPGWYGLAACFDDVQFDHDDGMPSRFLKP |
| Ga0212123_109406121 | 3300022557 | Iron-Sulfur Acid Spring | QRLEPAAMPGWYGVAASFDDLKFDRDDGVPSRFPEL |
| Ga0208935_10157152 | 3300025414 | Peatland | RVQRLEPAAMPRWYGVAALFDDMSFDRDDRVPSRFLSL |
| Ga0207699_105231732 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | AARVKRLEPAATPGWYGIAALFEDVAFDRDDHIPTRFMK |
| Ga0209802_11200191 | 3300026328 | Soil | NVVMATMAHVCRTEAAAMPSWYGVAASFDDVAFDRDDRVPARFLKP |
| Ga0209804_10887923 | 3300026335 | Soil | CRAETAATPGWYGIAAAFDDVQFDRDDRIPSRYLKP |
| Ga0179587_100270071 | 3300026557 | Vadose Zone Soil | LGLGNVVATTMARVCRTETAAMPGWHGIAAAFDDVQFDRDDRIPSRYLKP |
| Ga0209179_11280862 | 3300027512 | Vadose Zone Soil | ARVCRTELAAMPGWFGVAAAFDDVQFDRDDSIPSRYLKP |
| Ga0209118_10447173 | 3300027674 | Forest Soil | VATMAHVRRAETAAMPGWYGIAAAFDDVQFDRDDRIPSRFLKP |
| Ga0209773_101560723 | 3300027829 | Bog Forest Soil | HGSVVIVSTARVQRIEPAAMPGWYGVAAAFDDVKFDRDDGLPSRFLRP |
| Ga0209701_107067501 | 3300027862 | Vadose Zone Soil | QRYEPAAMQGWYGIAATFDDVQFDRDDRVPSRYLKP |
| Ga0209283_108870861 | 3300027875 | Vadose Zone Soil | RCDPAATPGWHGIAASFDDVQFDRDDRVPSRFLKP |
| Ga0209380_103914722 | 3300027889 | Soil | VVVATTARVRRLEPAATPGWFGVAVLFDDMSFDRDDRVPSRFLSL |
| Ga0209069_105246772 | 3300027915 | Watersheds | QRVDPAAMPGWYGIAASYDDVQFDRDDSIPSRFLK |
| Ga0308309_102426393 | 3300028906 | Soil | TAARVKRLEPAATPGWYGVAALFEDVAFDRDDRVPSRFME |
| Ga0308309_115647112 | 3300028906 | Soil | KRLEPAATPGWYGVAALFEDVVFDRDDRVPVRYTK |
| Ga0222749_104219482 | 3300029636 | Soil | ATMARVQRLEPAAMPGWFGVAASFDEVQFDRDDHVPARFLNP |
| Ga0222749_106808182 | 3300029636 | Soil | VMATMAHVCRTEPAAMPGWHGIAAAFDDVQFDRDDHIPSRYLKP |
| Ga0310686_1010646001 | 3300031708 | Soil | KAHVRRMEAAAMPGWYGVAAAFDDVQFDRDDGLPTRFLKR |
| Ga0307474_108318041 | 3300031718 | Hardwood Forest Soil | IVTKARAERVEPAAMPGWHGVAASFDDVQFDRDDGLPSRFQRP |
| Ga0307469_110734471 | 3300031720 | Hardwood Forest Soil | VRRVEPAAMPGWFGVAAAFDDVEFDRDDGLPFRFQNY |
| Ga0318517_102376972 | 3300031835 | Soil | GRGSVVMTTMAHVCRSEAAATPGWYGLAALFDDVQFDHDDDLPSRFRKP |
| Ga0306919_105657581 | 3300031879 | Soil | AHVCRAEAAATPGWYELAACFDDVQFDHDDDLPSRFLKP |
| Ga0307479_117400601 | 3300031962 | Hardwood Forest Soil | VVVATMAHVCRADAAAMPGWYGIAAVFDDVQFDRDDRMPSRFLNA |
| Ga0306922_101623961 | 3300032001 | Soil | SVVMTTMAHVCRAEAAATPGWYELAACFDDVQFDHDDDLPSRFLKP |
| Ga0307471_1012215592 | 3300032180 | Hardwood Forest Soil | VVMVTRARVRRIEPAAMPGWFGIAAAFDDVEFDRDDGLPSRFQKP |
| Ga0370484_0227677_14_145 | 3300034125 | Untreated Peat Soil | MVSLARVRRVQPAATPGWFGIAASFDDVQFDRDDCVPSRFHDV |
| ⦗Top⦘ |