


| Basic Information | |
|---|---|
| Family ID | F086005 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 111 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MSLVLQSLLPYPHSCLGTSPHQQGWDTKMEKLSYGGIDVSKDRLD |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 111 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 83.78 % |
| % of genes near scaffold ends (potentially truncated) | 92.79 % |
| % of genes from short scaffolds (< 2000 bps) | 90.99 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.21 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (81.081 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (17.117 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.027 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.054 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 27.40% β-sheet: 0.00% Coil/Unstructured: 72.60% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.21 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 111 Family Scaffolds |
|---|---|---|
| PF04392 | ABC_sub_bind | 34.23 |
| PF01548 | DEDD_Tnp_IS110 | 2.70 |
| PF00106 | adh_short | 1.80 |
| PF02371 | Transposase_20 | 1.80 |
| PF00149 | Metallophos | 0.90 |
| PF06627 | DUF1153 | 0.90 |
| PF08281 | Sigma70_r4_2 | 0.90 |
| PF00052 | Laminin_B | 0.90 |
| PF00027 | cNMP_binding | 0.90 |
| PF07751 | Abi_2 | 0.90 |
| PF13430 | DUF4112 | 0.90 |
| PF02826 | 2-Hacid_dh_C | 0.90 |
| PF00378 | ECH_1 | 0.90 |
| PF02517 | Rce1-like | 0.90 |
| PF13763 | DUF4167 | 0.90 |
| PF13683 | rve_3 | 0.90 |
| PF02518 | HATPase_c | 0.90 |
| PF08241 | Methyltransf_11 | 0.90 |
| PF07883 | Cupin_2 | 0.90 |
| PF12697 | Abhydrolase_6 | 0.90 |
| PF03928 | HbpS-like | 0.90 |
| PF03466 | LysR_substrate | 0.90 |
| COG ID | Name | Functional Category | % Frequency in 111 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 34.23 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 4.50 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.90 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.90 |
| COG4823 | Abortive infection bacteriophage resistance protein | Defense mechanisms [V] | 0.90 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 81.08 % |
| Unclassified | root | N/A | 18.92 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2032320005|FACEOR_FY84VJD01BOP5M | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 507 | Open in IMG/M |
| 2166559005|cont_contig24801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1149 | Open in IMG/M |
| 2166559005|cont_contig51371 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 2170459003|FZ032L002JVS4K | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 505 | Open in IMG/M |
| 2170459010|GIO7OMY01C6KTY | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 512 | Open in IMG/M |
| 2209111022|2221204146 | All Organisms → cellular organisms → Bacteria | 1201 | Open in IMG/M |
| 3300000912|JGI12032J12867_1006104 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300004633|Ga0066395_10175230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1105 | Open in IMG/M |
| 3300004635|Ga0062388_100520488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1070 | Open in IMG/M |
| 3300005163|Ga0066823_10011379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1264 | Open in IMG/M |
| 3300005468|Ga0070707_102064387 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 537 | Open in IMG/M |
| 3300005471|Ga0070698_101025860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 772 | Open in IMG/M |
| 3300005559|Ga0066700_10074535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2162 | Open in IMG/M |
| 3300005559|Ga0066700_10155169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1554 | Open in IMG/M |
| 3300005610|Ga0070763_10694227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 596 | Open in IMG/M |
| 3300005713|Ga0066905_101880649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 553 | Open in IMG/M |
| 3300005843|Ga0068860_100396121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1365 | Open in IMG/M |
| 3300006028|Ga0070717_10066628 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2995 | Open in IMG/M |
| 3300006028|Ga0070717_10849988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 830 | Open in IMG/M |
| 3300006175|Ga0070712_100173811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1673 | Open in IMG/M |
| 3300006605|Ga0074057_10028006 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300006606|Ga0074062_10049823 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300007258|Ga0099793_10299435 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 781 | Open in IMG/M |
| 3300009143|Ga0099792_11144235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 526 | Open in IMG/M |
| 3300009148|Ga0105243_10626490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1039 | Open in IMG/M |
| 3300009792|Ga0126374_11688408 | Not Available | 526 | Open in IMG/M |
| 3300010037|Ga0126304_10278126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1105 | Open in IMG/M |
| 3300010041|Ga0126312_10463891 | Not Available | 904 | Open in IMG/M |
| 3300010043|Ga0126380_11007586 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300010046|Ga0126384_10988160 | Not Available | 765 | Open in IMG/M |
| 3300010154|Ga0127503_10075055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 724 | Open in IMG/M |
| 3300010333|Ga0134080_10539545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 559 | Open in IMG/M |
| 3300010360|Ga0126372_10794837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → unclassified Rhodobacterales → Rhodobacterales bacterium 52_120_T64 | 936 | Open in IMG/M |
| 3300010362|Ga0126377_13208304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 528 | Open in IMG/M |
| 3300010398|Ga0126383_10174335 | All Organisms → cellular organisms → Bacteria | 2036 | Open in IMG/M |
| 3300010398|Ga0126383_10308033 | Not Available | 1585 | Open in IMG/M |
| 3300010398|Ga0126383_12625432 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300010398|Ga0126383_13532817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 510 | Open in IMG/M |
| 3300010868|Ga0124844_1231492 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300010999|Ga0138505_100008297 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
| 3300012148|Ga0153940_1071231 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300012209|Ga0137379_10145248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2279 | Open in IMG/M |
| 3300012210|Ga0137378_10102338 | All Organisms → cellular organisms → Bacteria | 2631 | Open in IMG/M |
| 3300012350|Ga0137372_11142998 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 531 | Open in IMG/M |
| 3300012508|Ga0157315_1050896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 556 | Open in IMG/M |
| 3300012677|Ga0153928_1102761 | Not Available | 550 | Open in IMG/M |
| 3300012938|Ga0162651_100077022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 554 | Open in IMG/M |
| 3300012938|Ga0162651_100094922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 507 | Open in IMG/M |
| 3300012939|Ga0162650_100011501 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1159 | Open in IMG/M |
| 3300012939|Ga0162650_100050411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 681 | Open in IMG/M |
| 3300012985|Ga0164308_10731112 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300012986|Ga0164304_10916318 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300012989|Ga0164305_11995776 | Not Available | 529 | Open in IMG/M |
| 3300014154|Ga0134075_10490090 | Not Available | 550 | Open in IMG/M |
| 3300015359|Ga0134085_10628550 | Not Available | 501 | Open in IMG/M |
| 3300016270|Ga0182036_10182640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1522 | Open in IMG/M |
| 3300016270|Ga0182036_10863223 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300016294|Ga0182041_10509970 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
| 3300016357|Ga0182032_10195787 | All Organisms → cellular organisms → Bacteria | 1535 | Open in IMG/M |
| 3300018028|Ga0184608_10235203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. 2A | 805 | Open in IMG/M |
| 3300018028|Ga0184608_10466022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCGB12 | 543 | Open in IMG/M |
| 3300018031|Ga0184634_10086178 | Not Available | 1356 | Open in IMG/M |
| 3300018067|Ga0184611_1208155 | Not Available | 695 | Open in IMG/M |
| 3300018469|Ga0190270_10983921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 868 | Open in IMG/M |
| 3300018469|Ga0190270_11572427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 708 | Open in IMG/M |
| 3300018481|Ga0190271_10469355 | All Organisms → cellular organisms → Bacteria | 1365 | Open in IMG/M |
| 3300021078|Ga0210381_10082893 | Not Available | 1017 | Open in IMG/M |
| 3300021170|Ga0210400_10390156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1148 | Open in IMG/M |
| 3300021178|Ga0210408_10194613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1612 | Open in IMG/M |
| 3300021445|Ga0182009_10728436 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300025910|Ga0207684_11604052 | Not Available | 527 | Open in IMG/M |
| 3300026551|Ga0209648_10283839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1199 | Open in IMG/M |
| 3300027288|Ga0208525_1044521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 556 | Open in IMG/M |
| 3300027855|Ga0209693_10406608 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300027903|Ga0209488_10324906 | Not Available | 1146 | Open in IMG/M |
| 3300027903|Ga0209488_10339153 | Not Available | 1118 | Open in IMG/M |
| 3300028708|Ga0307295_10065698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 950 | Open in IMG/M |
| 3300028711|Ga0307293_10114697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 856 | Open in IMG/M |
| 3300028715|Ga0307313_10073221 | Not Available | 1024 | Open in IMG/M |
| 3300028718|Ga0307307_10093166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 913 | Open in IMG/M |
| 3300028811|Ga0307292_10523605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 509 | Open in IMG/M |
| 3300028819|Ga0307296_10006208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 6276 | Open in IMG/M |
| 3300028828|Ga0307312_11034700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 543 | Open in IMG/M |
| 3300028880|Ga0307300_10083376 | Not Available | 946 | Open in IMG/M |
| 3300028884|Ga0307308_10160009 | Not Available | 1078 | Open in IMG/M |
| 3300031561|Ga0318528_10394036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter → Nitrobacter hamburgensis → Nitrobacter hamburgensis X14 | 743 | Open in IMG/M |
| 3300031564|Ga0318573_10466325 | Not Available | 679 | Open in IMG/M |
| 3300031564|Ga0318573_10582502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 602 | Open in IMG/M |
| 3300031573|Ga0310915_10293096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1149 | Open in IMG/M |
| 3300031744|Ga0306918_11405723 | Not Available | 535 | Open in IMG/M |
| 3300031770|Ga0318521_10047848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2193 | Open in IMG/M |
| 3300031771|Ga0318546_10310755 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
| 3300031794|Ga0318503_10101101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter → Nitrobacter hamburgensis → Nitrobacter hamburgensis X14 | 915 | Open in IMG/M |
| 3300031832|Ga0318499_10254667 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300031890|Ga0306925_10117747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2840 | Open in IMG/M |
| 3300031890|Ga0306925_12040721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 539 | Open in IMG/M |
| 3300031894|Ga0318522_10198512 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300031946|Ga0310910_10060993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2691 | Open in IMG/M |
| 3300031946|Ga0310910_10327970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1207 | Open in IMG/M |
| 3300031954|Ga0306926_12562607 | Not Available | 557 | Open in IMG/M |
| 3300032001|Ga0306922_10585553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1183 | Open in IMG/M |
| 3300032001|Ga0306922_12078555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 551 | Open in IMG/M |
| 3300032008|Ga0318562_10475507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 725 | Open in IMG/M |
| 3300032052|Ga0318506_10120450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter → Nitrobacter hamburgensis → Nitrobacter hamburgensis X14 | 1134 | Open in IMG/M |
| 3300032060|Ga0318505_10610834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 512 | Open in IMG/M |
| 3300032076|Ga0306924_11350220 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 763 | Open in IMG/M |
| 3300032076|Ga0306924_11695486 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 662 | Open in IMG/M |
| 3300032261|Ga0306920_100231535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 2756 | Open in IMG/M |
| 3300033289|Ga0310914_10500302 | Not Available | 1099 | Open in IMG/M |
| 3300033289|Ga0310914_11651509 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 544 | Open in IMG/M |
| 3300033290|Ga0318519_10122552 | All Organisms → cellular organisms → Bacteria | 1425 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 13.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.71% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.11% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.41% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.41% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 4.50% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.60% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.70% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.70% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.80% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 1.80% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.80% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 1.80% |
| Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 1.80% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.90% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.90% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.90% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.90% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.90% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.90% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.90% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2032320005 | Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- | Environmental | Open in IMG/M |
| 2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
| 2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
| 2209111022 | Grass soil microbial communities from Rothamsted Park, UK - Chitin enrichment | Environmental | Open in IMG/M |
| 3300000912 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300010999 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015 | Environmental | Open in IMG/M |
| 3300012148 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ024 MetaG | Host-Associated | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Host-Associated | Open in IMG/M |
| 3300012677 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ012 MetaG | Host-Associated | Open in IMG/M |
| 3300012938 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015 | Environmental | Open in IMG/M |
| 3300012939 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015 | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027288 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FACEORA_469010 | 2032320005 | Soil | VSLELRSLLPYPNSCPGTSPHQQERDTKMAMLSFGGIDV |
| cont_0801.00002050 | 2166559005 | Simulated | MSLVLQSLLPYPYSCQGTSPHQQGWDTKMAMLSFCGIDVSKDRLDVVVLPEGGSFR |
| cont_0371.00003630 | 2166559005 | Simulated | MSLVLQSLLPYPNSCQGTSPHQQGWDTKMEKLSYGGIDVSKDRLDVVVLPEGGSFR |
| E4A_02769890 | 2170459003 | Grass Soil | MSLVLQSFLPYPDSCLGTSPHQQGWDTKMAELSFGGIDVSKDRLDVLLLPEGLCFSVLQRRAWFG |
| F62_01428090 | 2170459010 | Grass Soil | MSLVLQSILPYPDSCLGTSPHQQGWDTKMEKLSYG |
| 2222033964 | 2209111022 | Grass Soil | MSLVLQSLLPYPHSCLGTSPHQQGWDTKMEKLSYGGIDVSKDRLDVVVLPEGGSFR |
| JGI12032J12867_10061041 | 3300000912 | Forest Soil | PSILPYPDSCLGTSPHQQGWDTKMEKLSYGGIDVSRLGS* |
| Ga0066395_101752302 | 3300004633 | Tropical Forest Soil | MSLVLQSPLPYPHSCQGTSPHQQGWDTKMAMLSFCGIDVSKDRLDVVVLPEG |
| Ga0062388_1005204882 | 3300004635 | Bog Forest Soil | MSLVLQSLLPYPNGCQGTSPHQQGRDTKMAELSHGGIDVSKDRLDVMILH* |
| Ga0066823_100113791 | 3300005163 | Soil | MSLVLQSILPYPDSCLGTSPHQQGWDTKMEKLSYGGIDVS |
| Ga0070707_1020643871 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLALQSLLPYPNSCEGASPHQQGRDTKMLSFCGIDVSKDRLDVM |
| Ga0070698_1010258602 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLVLQSLLPYPNSCQGTSPHQQGWDTKMAMLSFCGIDVSKDRLDVVVLPE |
| Ga0066700_100745351 | 3300005559 | Soil | MSLVLRSLLPYPHSCQGTSPHQQGWDMKMAMLSFCGIDVSKDRLD |
| Ga0066700_101551691 | 3300005559 | Soil | MSLVLQSLLPYPHSCQGTSPHQQGWDMKMAMLSFCGIDVSKDRLD |
| Ga0070763_106942272 | 3300005610 | Soil | MSLALQSLLPYPNSCEGASPHQQGRDTKMLSFCGIDVSKDRLDVMVLPDEYSSSA* |
| Ga0066905_1018806492 | 3300005713 | Tropical Forest Soil | MSLVLRSLLPYPNSCQGTSPHQQGWDTKMAMLSFCGIDISKDRLDVVVLPEG |
| Ga0068860_1003961211 | 3300005843 | Switchgrass Rhizosphere | MSLVLQSILPYPHSCLGTSPHQQGWDTKMEKLSYGGIDVSKD |
| Ga0070717_100666281 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLVLQSLLPYPNSCQGTSPHQQGWDTKMEKLSYGGI |
| Ga0070717_108499882 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLVLQPLLPFPDSCQGMSPHQQGRGTKMTEHCYGGIDVSKDRLDVMVLPDRKSFSVDNN |
| Ga0070712_1001738113 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLVLQSLLPYPNRCQGTSPHQQGWDTKMEKLSYGGIDVSKTDWTW* |
| Ga0074057_100280062 | 3300006605 | Soil | MSLVLQPLLPYPHSCLGTSPHQQGWDTKMEKLSYGGIDVSKD |
| Ga0074062_100498231 | 3300006606 | Soil | MSLVLQSILPYPDSCLGTSPHQQGWDTKMEKLSYGGIDVSKD |
| Ga0099793_102994352 | 3300007258 | Vadose Zone Soil | MSLELRSLLPYPNSCRGTNPHQQERDTKMAMLSFGGIDVSKDRLDVVVLPEEECSSVPN |
| Ga0099792_111442351 | 3300009143 | Vadose Zone Soil | MSLVLPSIPPYPDSCLGTSPHQQGWDTKMEKLSYGGIDVSKDRLDVV |
| Ga0105243_106264902 | 3300009148 | Miscanthus Rhizosphere | MSLVLQSLLPYPHSCQGTSPHQQGWDTKMAMLSFCGIDVSKDRL |
| Ga0126374_116884082 | 3300009792 | Tropical Forest Soil | MSLALQSLLPYPNSCEGASPHQQGRDTKMLSFCGIDVSKDR |
| Ga0126304_102781261 | 3300010037 | Serpentine Soil | MSLVLQPFLPFPHSCQGSSPHQRGRDERMIEQCFGGIDVSQDRLDVLL |
| Ga0126312_104638913 | 3300010041 | Serpentine Soil | MSLELRSLLPYPNSCLGTSPHQQGRDTKMAEHCYGGIDVSKDRLDVM |
| Ga0126380_110075861 | 3300010043 | Tropical Forest Soil | MSLVLQSLLPYPNSCQGTSPHQQGWDTKMAMLSFCGVDVSKDRLDV |
| Ga0126384_109881602 | 3300010046 | Tropical Forest Soil | MSLVLQSFLPYPDSCLGTSPHQQGWDTKMAELSFGGIDVSK |
| Ga0127503_100750552 | 3300010154 | Soil | MSLVLQSILPYPHSCLGTSPHQQGWDTKMEKLSYGGIDVSKDRLDVVVLP* |
| Ga0134080_105395451 | 3300010333 | Grasslands Soil | MSLELQSLLPYPNSCLGASPHQQGRDTKMEMLSFGGIDVSKDRL |
| Ga0126372_107948372 | 3300010360 | Tropical Forest Soil | MSLELRSLLPYPNSCLGASPHQQTWGTKMAVLSFCGIDVSKDRLDVVI |
| Ga0126377_132083042 | 3300010362 | Tropical Forest Soil | MSLVLQSILPYPDSCLGTSPHQQGWDTKMAELSFGGIDVSKDR |
| Ga0126383_101743351 | 3300010398 | Tropical Forest Soil | VSLELQSLLPYPNSCEGASPHQQGRDTKMLSFCGIDVSKDRLDV |
| Ga0126383_103080331 | 3300010398 | Tropical Forest Soil | MSLVLQSFLAYPDSCLGTSPHQQGWDTKMAELSFGGIDVSKDRLDVLVLP |
| Ga0126383_126254321 | 3300010398 | Tropical Forest Soil | MSLVLRSLLQCPNSCQGTSPHQQGWDTKMAMLSFCGVDVSKDRLDV |
| Ga0126383_135328172 | 3300010398 | Tropical Forest Soil | MSLELQSLLPYPNSCLGTGPHQQGRDTKMLSFCGIDVSKDRLDVMVL |
| Ga0124844_12314922 | 3300010868 | Tropical Forest Soil | MSLVLQSLLPYPNSCQGTSPHQQGWDTKMAMLSFCGIDVSKDRLDVVVLPEGWFFFGE* |
| Ga0138505_1000082971 | 3300010999 | Soil | MSLVLQSLLPYPHSCLGTSPHQQGWDTKMEKLSYGGIDVSKDRLDV |
| Ga0153940_10712311 | 3300012148 | Attine Ant Fungus Gardens | MSLVLQSLLPFPNSCQGTSPHQQGRGTKMTEHYYCGIDVAKDRLDVMVLPDHKSFSVD |
| Ga0137379_101452481 | 3300012209 | Vadose Zone Soil | MSLVLQPFLPYPNSCLGTSPHQQERDTKMAQRSFCGIDVAKDRLDVM |
| Ga0137378_101023384 | 3300012210 | Vadose Zone Soil | MSLALQSLLPYPNSCEGASPHQQGRDTKMLSFCGIDVSKDRLDVMVLPDEYSSSVPND |
| Ga0137372_111429981 | 3300012350 | Vadose Zone Soil | MSLELWSLLPYPDSCPGTSPHQQERDTKMAMLSFGGIDV |
| Ga0157315_10508961 | 3300012508 | Arabidopsis Rhizosphere | MSLVLQSLLPYPPSCLGTSPHQQGWDTKMEKLSYGGIDV |
| Ga0153928_11027611 | 3300012677 | Attine Ant Fungus Gardens | MSLVLQSLLPFPDSCQGMSPHQQGRGTKMTEHCYGGIDVSKDR |
| Ga0162651_1000770222 | 3300012938 | Soil | MSLVLQSILPYPHSCLGTSPHQQGWDTKMEKLSYGGIDVSKDR |
| Ga0162651_1000949222 | 3300012938 | Soil | MSLVLQSLLPYPHSCLGTSPHQQGWDTKMEKLSYGGIDVSKDR |
| Ga0162650_1000115011 | 3300012939 | Soil | MSLMLQSLLPYPNSCQGTSPHQQGWDTKMEKLSYGG |
| Ga0162650_1000504111 | 3300012939 | Soil | MSLVLPSILPYPDSCLGTSPHQQGWDTKMEKLSYGGIDVSKDRLD |
| Ga0164308_107311121 | 3300012985 | Soil | LVLPSILPYPDSCLGTSPHQQGWDTKMEKLSYGGIDVSKD |
| Ga0164304_109163183 | 3300012986 | Soil | MSLVLQSILPYPYSCLGTSPHQQGWDTKMEKLSYGGIDVSK |
| Ga0164305_119957762 | 3300012989 | Soil | MSMELQSLLPYPNSCLGASPHQQGRDTKMAMLSFGGIDVSKDRLDI |
| Ga0134075_104900901 | 3300014154 | Grasslands Soil | MSLELQSLLPYPNSCLGASPHQQGRDTKMAMLSFGGIDVSK |
| Ga0134085_106285501 | 3300015359 | Grasslands Soil | MSLVLQSLLPYPHSCQGTSPHQQGWDTKMAMLSFCGIDVSKDRLDVV |
| Ga0182036_101826403 | 3300016270 | Soil | MSLVLQPLLPFPDGCQGMSPHQQGRGTKMTEHCYGGIDVSKDRLDVMVLPDRK |
| Ga0182036_108632231 | 3300016270 | Soil | MSLVLQSLLPFPDSCQGMSPHQQGRGTKMTEHCYGGID |
| Ga0182041_105099702 | 3300016294 | Soil | MSLVLQSILPYPDSCLGTSPHQQGWDTKMAELSFGGIDVSKDRLDVLL |
| Ga0182032_101957871 | 3300016357 | Soil | MSLVLQPFLPYPNSCQGTSPHQQGWDTKMAELSFGGIDVSK |
| Ga0184608_102352032 | 3300018028 | Groundwater Sediment | MSLVLQSILPYPHSCQGTSPHQQGWDTKMEKLSYGGIDVSKDR |
| Ga0184608_104660222 | 3300018028 | Groundwater Sediment | MSLVLQSLLPYPHSCLGTSPHQQGWDTKMEKLSYGGIDVSK |
| Ga0184634_100861781 | 3300018031 | Groundwater Sediment | MSLVLQSILPYPDSCLGTSPHQQGWDTKMEKLSYGGIDVSKDRLDVVVL |
| Ga0184611_12081551 | 3300018067 | Groundwater Sediment | VLQSLLPYPNSCRGTSPHQQGWDTKMEKLSYGGIDVSKDRLDVV |
| Ga0190270_109839211 | 3300018469 | Soil | MSLVLQSILPYPHSCLGTSPHQQGWDTKMEKLSYGGIDVSKDRLD |
| Ga0190270_115724271 | 3300018469 | Soil | MSLVLQSLLPYPHSCLGTSPHQQGWDTKMEKLSYGGIDVSKDRLD |
| Ga0190271_104693551 | 3300018481 | Soil | MSQVLRSFLPFPDTCQGTSPHQQGRGTKMVERFSGIDA |
| Ga0210381_100828931 | 3300021078 | Groundwater Sediment | MSLVLQSILLYPDSCLRTSPHQQGWDTKMEKLSYGGIDVSKDRLDVVVLPE |
| Ga0210400_103901562 | 3300021170 | Soil | MSLVLQSILPYPYSCLGTSPHQQGWDPKMEKLSYGGIDVSKDRLDV |
| Ga0210408_101946131 | 3300021178 | Soil | MSLVLQSILPYPDSCLGTSPHQQGWDTKMEKLSYGGID |
| Ga0182009_107284361 | 3300021445 | Soil | VNRPRVSLVLQSLLPFPDSCQGTSPHQQGRDPKMIEHCYGGIDVSQERLD |
| Ga0207684_116040522 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLELRSLLPYPDSCLGTSPHQQGRVTKMLSFCAIDDIVWAD |
| Ga0209648_102838391 | 3300026551 | Grasslands Soil | MSLELQSLLPCPNSCLGASPHQQERDTKMAKLSFGGIDVSKDRL |
| Ga0208525_10445211 | 3300027288 | Soil | MSLVLQSILPYPHSCLGTSPHQQGWDTKMEKLSYGGIDVS |
| Ga0209693_104066082 | 3300027855 | Soil | MSLALQSLLPYPNSCEGASPHQQGRDTKMLSFCGIDVSKDRLDVMVLPDEYSSSA |
| Ga0209488_103249061 | 3300027903 | Vadose Zone Soil | MSLVLPSIPPYPDSCLGTSPHQQGWDTKMEKLSYGGIDVSKDRLD |
| Ga0209488_103391531 | 3300027903 | Vadose Zone Soil | MSLALQSFLPYPNSCLGTSPHQQGRDTKMAMLSFC |
| Ga0307295_100656982 | 3300028708 | Soil | MSLVLQSLLPYPHSCLGTSPHQQGWDTKKMEKLSYGGIDVSKGRLDVVVL |
| Ga0307293_101146972 | 3300028711 | Soil | MSLVLQSLLPYPHSCLGTSPHQQGWDTKKMEKLSYGGIDVSKDRL |
| Ga0307313_100732211 | 3300028715 | Soil | MSLVLQSILLYPDSCLRTSPHQQGWDTKMEKLSYGGIDVSKDRLDV |
| Ga0307307_100931661 | 3300028718 | Soil | MSLVLQSLLPYPHSCLGTSPHQQGWDTKKMEKLSYGGIDVSKDRLDVV |
| Ga0307292_105236052 | 3300028811 | Soil | MSLVLQSLLPYPHSCLGASPHQQGWDTKMEKLSYGGIDVSKDRLDV |
| Ga0307296_100062081 | 3300028819 | Soil | MSLVLRSLRPYPHSCQGTSPYQQGWDTKMAILSFCGIDVSKDRLD |
| Ga0307312_110347001 | 3300028828 | Soil | MSLVLQSLLPYPHSCLGTSPHQQGWDTKMENLSYGGIDVSK |
| Ga0307300_100833761 | 3300028880 | Soil | MSLVLQSILLYPDSCLRTSPHQQGWDTKMEKLSYGGIDVSKDRLDVVVLPEVVNECQA |
| Ga0307308_101600091 | 3300028884 | Soil | MSLVLQSILPYPDSCLRTSPHQQGWDTKMEKLSYGGIDVSKDRLDVVV |
| Ga0318528_103940362 | 3300031561 | Soil | MSLVLQSLLPYPNSCQGTSPHQQGWNTKMAMLSFCGVDVSKDRLDVVVLPEGWFFSVSND |
| Ga0318573_104663251 | 3300031564 | Soil | MSLVLRSLLPYPNSCQGTSPHQQGWDTKMAMLSFC |
| Ga0318573_105825021 | 3300031564 | Soil | MSLVLQSLLPFPDSCQGMSPHQQGRGTKMTEHCYGGIDVSKDRLDVMV |
| Ga0310915_102930962 | 3300031573 | Soil | MSLVLQSLLPFPDSCQGTSPHQQGRGTKMTEHCYGGIDVSKDRLDVMVLP |
| Ga0306918_114057231 | 3300031744 | Soil | MSLELRSLLPYPNSCLGTSPHQQERDTKMAMLSFGGIDVSKERLDVMILPEEQCSSVSND |
| Ga0318521_100478481 | 3300031770 | Soil | MSLVLQSLLPDPHSCQGTSPHQQGWDTKMAMLSFCGIDVSKDRLDVV |
| Ga0318546_103107552 | 3300031771 | Soil | MSLALQSLLPYPNSCLGASPHQQGSDTKMAMLSFGGIDVSKDRLDVVVLPEG |
| Ga0318503_101011012 | 3300031794 | Soil | MSLVLQSLLPYPNSCQGTSPHQQGWNTKMAMLSFCGVDVSKDRLD |
| Ga0318499_102546671 | 3300031832 | Soil | MSLVLQSLLPYPYSCQGTSPHQQGWDTKMAMLSFCGVDVSKD |
| Ga0306925_101177477 | 3300031890 | Soil | MSLALQSLLPYPNSCEGASPHQQGRDTKMLSFCGIDVSKDRLDVMV |
| Ga0306925_120407211 | 3300031890 | Soil | MSLVLQPLLPFPDSCQGMSPHQQGRGTKMTEHCYGGIDVS |
| Ga0318522_101985122 | 3300031894 | Soil | MSLVLRSLLPYPNSCLGTSPHQQGWDTKMAMLSFCGIDVSKDRLD |
| Ga0310910_100609934 | 3300031946 | Soil | MSLVLQSLLPYPHSCQGTSPHQQGWDTKMAMLSFCGIDVSKD |
| Ga0310910_103279701 | 3300031946 | Soil | MSLALQSLLPYPHSCQGTSPHQQGWDTKMAMLSFCGVDVSKDRLD |
| Ga0306926_125626071 | 3300031954 | Soil | MSLVLQSLLPYPNSCQGTSPHQQGWDTKMAMLSFCGIDVSKDRLDVVV |
| Ga0306922_105855531 | 3300032001 | Soil | MSLVLQSLLYPNSCQGTSPHQQGWDTKMAMLSFCGIDVSKDR |
| Ga0306922_120785551 | 3300032001 | Soil | MSLELRSLLPYPNSCLGTSPHQQGRDTKMAMLSFCGVDVSKD |
| Ga0318562_104755071 | 3300032008 | Soil | MSLVLPSLLPFPNSCQGMNPHQQGRGTKMIQQGYGGIDVS |
| Ga0318506_101204501 | 3300032052 | Soil | MSLVLQSLLPYPNSCQGTSPHQQGWNTKMAMLSFCGVDVSKDRLDVVVLPEGWFFSVS |
| Ga0318505_106108341 | 3300032060 | Soil | MSLALQSLLPYPNSCLGASPYQQGRDTKMLSFCGIDVSKDRLD |
| Ga0306924_113502201 | 3300032076 | Soil | MSLVLQSLLPCPNSCQGTSPHQQGWDTKMAMLSFCGIDVSKDR |
| Ga0306924_116954862 | 3300032076 | Soil | MSLVLQPLLPFPDSCQGMSPHKQGRGTKMTEHCYGGIDVSKDRLDVMVLPDRKSFSV |
| Ga0306920_1002315356 | 3300032261 | Soil | VSLELRSLLLYPDSCLGASPHQQGRDTKMLSFCGIDVSKDRLDVIVL |
| Ga0310914_105003022 | 3300033289 | Soil | MSLVLQSLLPYPHSCQGTSPHQQGWDTKMAMLSFCGVDVS |
| Ga0310914_116515091 | 3300033289 | Soil | MSLVLQPLLPFPDSCQGMSPHKQGRGTKMTEHCYGGIDVSK |
| Ga0318519_101225521 | 3300033290 | Soil | MSLVLQPLLPFPDSCQGMSPHQQGRGTKMTEHCYGGIDVSKDRLDVMV |
| ⦗Top⦘ |