


| Basic Information | |
|---|---|
| Family ID | F085998 |
| Family Type | Metagenome |
| Number of Sequences | 111 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MAGTLLFSKENGQSVNITYSDTGFMPTEVSLSAMRAELEAAK |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 111 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 2.70 % |
| % of genes near scaffold ends (potentially truncated) | 91.89 % |
| % of genes from short scaffolds (< 2000 bps) | 97.30 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (54.955 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (17.117 % of family members) |
| Environment Ontology (ENVO) | Unclassified (41.441 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (46.847 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 30.00% Coil/Unstructured: 70.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 111 Family Scaffolds |
|---|---|---|
| PF13847 | Methyltransf_31 | 23.42 |
| PF08241 | Methyltransf_11 | 5.41 |
| PF10049 | DUF2283 | 5.41 |
| PF02353 | CMAS | 5.41 |
| PF13649 | Methyltransf_25 | 1.80 |
| PF02604 | PhdYeFM_antitox | 0.90 |
| PF01804 | Penicil_amidase | 0.90 |
| PF03848 | TehB | 0.90 |
| PF07927 | HicA_toxin | 0.90 |
| PF13772 | AIG2_2 | 0.90 |
| PF02626 | CT_A_B | 0.90 |
| PF17147 | PFOR_II | 0.90 |
| PF02775 | TPP_enzyme_C | 0.90 |
| PF13449 | Phytase-like | 0.90 |
| PF00144 | Beta-lactamase | 0.90 |
| PF01850 | PIN | 0.90 |
| PF13473 | Cupredoxin_1 | 0.90 |
| PF00156 | Pribosyltran | 0.90 |
| COG ID | Name | Functional Category | % Frequency in 111 Family Scaffolds |
|---|---|---|---|
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 5.41 |
| COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 5.41 |
| COG2230 | Cyclopropane fatty-acyl-phospholipid synthase and related methyltransferases | Lipid transport and metabolism [I] | 5.41 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.90 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.90 |
| COG1724 | Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase family | General function prediction only [R] | 0.90 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.90 |
| COG2366 | Acyl-homoserine lactone (AHL) acylase PvdQ | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.90 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.90 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.90 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 54.95 % |
| All Organisms | root | All Organisms | 45.05 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459010|GIO7OMY02F24CI | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300000890|JGI11643J12802_12241152 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300000955|JGI1027J12803_101305892 | Not Available | 683 | Open in IMG/M |
| 3300000955|JGI1027J12803_101619630 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 703 | Open in IMG/M |
| 3300000955|JGI1027J12803_102300328 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300000955|JGI1027J12803_102415794 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300000956|JGI10216J12902_117099759 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 549 | Open in IMG/M |
| 3300002099|JGI24808J26613_1029698 | Not Available | 796 | Open in IMG/M |
| 3300002128|JGI24036J26619_10008787 | Not Available | 1810 | Open in IMG/M |
| 3300004480|Ga0062592_101616106 | Not Available | 627 | Open in IMG/M |
| 3300005167|Ga0066672_10901599 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 547 | Open in IMG/M |
| 3300005175|Ga0066673_10696027 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300005179|Ga0066684_10407197 | Not Available | 914 | Open in IMG/M |
| 3300005290|Ga0065712_10266491 | Not Available | 920 | Open in IMG/M |
| 3300005294|Ga0065705_10320399 | Not Available | 1012 | Open in IMG/M |
| 3300005339|Ga0070660_100573865 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300005365|Ga0070688_100313904 | Not Available | 1137 | Open in IMG/M |
| 3300005434|Ga0070709_11297191 | Not Available | 587 | Open in IMG/M |
| 3300005439|Ga0070711_100341457 | All Organisms → cellular organisms → Bacteria | 1202 | Open in IMG/M |
| 3300005457|Ga0070662_100900166 | Not Available | 755 | Open in IMG/M |
| 3300005548|Ga0070665_100848583 | Not Available | 926 | Open in IMG/M |
| 3300005598|Ga0066706_10135715 | All Organisms → cellular organisms → Bacteria | 1834 | Open in IMG/M |
| 3300005713|Ga0066905_100755392 | Not Available | 839 | Open in IMG/M |
| 3300005764|Ga0066903_106490846 | Not Available | 609 | Open in IMG/M |
| 3300005843|Ga0068860_101387743 | Not Available | 724 | Open in IMG/M |
| 3300005937|Ga0081455_10159159 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1733 | Open in IMG/M |
| 3300005937|Ga0081455_10580826 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 734 | Open in IMG/M |
| 3300006175|Ga0070712_100281048 | Not Available | 1341 | Open in IMG/M |
| 3300006800|Ga0066660_10190979 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1554 | Open in IMG/M |
| 3300006844|Ga0075428_101052230 | Not Available | 860 | Open in IMG/M |
| 3300006852|Ga0075433_10565567 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 999 | Open in IMG/M |
| 3300006871|Ga0075434_102285257 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 544 | Open in IMG/M |
| 3300009012|Ga0066710_101891496 | Not Available | 894 | Open in IMG/M |
| 3300009012|Ga0066710_102773106 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300009098|Ga0105245_12171374 | Not Available | 609 | Open in IMG/M |
| 3300009147|Ga0114129_11871095 | Not Available | 728 | Open in IMG/M |
| 3300009802|Ga0105073_1054151 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300010040|Ga0126308_10552640 | Not Available | 782 | Open in IMG/M |
| 3300010046|Ga0126384_10332659 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1260 | Open in IMG/M |
| 3300010047|Ga0126382_10489810 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300010047|Ga0126382_11087996 | Not Available | 708 | Open in IMG/M |
| 3300010323|Ga0134086_10322929 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 604 | Open in IMG/M |
| 3300010326|Ga0134065_10220064 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300010337|Ga0134062_10818365 | Not Available | 500 | Open in IMG/M |
| 3300010362|Ga0126377_11728018 | Not Available | 701 | Open in IMG/M |
| 3300010371|Ga0134125_12225985 | Not Available | 596 | Open in IMG/M |
| 3300010373|Ga0134128_11876224 | Not Available | 659 | Open in IMG/M |
| 3300010399|Ga0134127_13580732 | Not Available | 509 | Open in IMG/M |
| 3300012199|Ga0137383_10423185 | Not Available | 976 | Open in IMG/M |
| 3300012199|Ga0137383_11276093 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300012200|Ga0137382_10878496 | Not Available | 646 | Open in IMG/M |
| 3300012207|Ga0137381_11808921 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300012211|Ga0137377_10877924 | Not Available | 829 | Open in IMG/M |
| 3300012211|Ga0137377_11459695 | Not Available | 611 | Open in IMG/M |
| 3300012349|Ga0137387_11146038 | Not Available | 552 | Open in IMG/M |
| 3300012358|Ga0137368_10247041 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
| 3300012359|Ga0137385_11148895 | Not Available | 637 | Open in IMG/M |
| 3300012582|Ga0137358_10307046 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1077 | Open in IMG/M |
| 3300012683|Ga0137398_10405529 | Not Available | 928 | Open in IMG/M |
| 3300012683|Ga0137398_10816487 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 652 | Open in IMG/M |
| 3300012922|Ga0137394_10642409 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 896 | Open in IMG/M |
| 3300012923|Ga0137359_10860249 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 783 | Open in IMG/M |
| 3300012924|Ga0137413_10684247 | Not Available | 777 | Open in IMG/M |
| 3300012929|Ga0137404_12177403 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 518 | Open in IMG/M |
| 3300012948|Ga0126375_11525917 | Not Available | 572 | Open in IMG/M |
| 3300012976|Ga0134076_10214009 | Not Available | 812 | Open in IMG/M |
| 3300012976|Ga0134076_10364391 | Not Available | 638 | Open in IMG/M |
| 3300013102|Ga0157371_11602748 | Not Available | 510 | Open in IMG/M |
| 3300013296|Ga0157374_10705913 | Not Available | 1022 | Open in IMG/M |
| 3300015053|Ga0137405_1151094 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 530 | Open in IMG/M |
| 3300015371|Ga0132258_10449953 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium 13_1_20CM_3_54_17 | 3210 | Open in IMG/M |
| 3300015373|Ga0132257_101289025 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300015374|Ga0132255_103903583 | Not Available | 633 | Open in IMG/M |
| 3300017657|Ga0134074_1385664 | Not Available | 520 | Open in IMG/M |
| 3300018054|Ga0184621_10267281 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300018056|Ga0184623_10430634 | Not Available | 574 | Open in IMG/M |
| 3300018066|Ga0184617_1028610 | Not Available | 1302 | Open in IMG/M |
| 3300018076|Ga0184609_10049216 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1795 | Open in IMG/M |
| 3300019879|Ga0193723_1087244 | Not Available | 890 | Open in IMG/M |
| 3300019881|Ga0193707_1033307 | Not Available | 1681 | Open in IMG/M |
| 3300019881|Ga0193707_1043339 | All Organisms → cellular organisms → Bacteria | 1449 | Open in IMG/M |
| 3300019882|Ga0193713_1114916 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 744 | Open in IMG/M |
| 3300019886|Ga0193727_1190609 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300020005|Ga0193697_1024443 | Not Available | 1506 | Open in IMG/M |
| 3300021080|Ga0210382_10209412 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 848 | Open in IMG/M |
| 3300021086|Ga0179596_10331906 | Not Available | 762 | Open in IMG/M |
| 3300021510|Ga0222621_1034297 | Not Available | 1049 | Open in IMG/M |
| 3300022534|Ga0224452_1115019 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 825 | Open in IMG/M |
| 3300024330|Ga0137417_1388850 | All Organisms → cellular organisms → Bacteria | 4263 | Open in IMG/M |
| 3300025315|Ga0207697_10212370 | Not Available | 853 | Open in IMG/M |
| 3300025908|Ga0207643_10479478 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300025926|Ga0207659_10559018 | Not Available | 973 | Open in IMG/M |
| 3300025930|Ga0207701_10087199 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium 13_1_20CM_3_54_17 | 2814 | Open in IMG/M |
| 3300025932|Ga0207690_11309648 | Not Available | 605 | Open in IMG/M |
| 3300025936|Ga0207670_11356856 | Not Available | 603 | Open in IMG/M |
| 3300025937|Ga0207669_11029208 | Not Available | 693 | Open in IMG/M |
| 3300025986|Ga0207658_11089713 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300026035|Ga0207703_11290232 | Not Available | 702 | Open in IMG/M |
| 3300026142|Ga0207698_12696427 | Not Available | 506 | Open in IMG/M |
| 3300026326|Ga0209801_1067444 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1591 | Open in IMG/M |
| 3300026326|Ga0209801_1265385 | Not Available | 635 | Open in IMG/M |
| 3300026702|Ga0208708_102090 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 554 | Open in IMG/M |
| 3300028707|Ga0307291_1173819 | Not Available | 552 | Open in IMG/M |
| 3300028793|Ga0307299_10039965 | All Organisms → cellular organisms → Bacteria | 1717 | Open in IMG/M |
| 3300028878|Ga0307278_10476295 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 546 | Open in IMG/M |
| 3300028885|Ga0307304_10334193 | Not Available | 675 | Open in IMG/M |
| 3300031231|Ga0170824_109759321 | Not Available | 516 | Open in IMG/M |
| 3300031720|Ga0307469_11204030 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 716 | Open in IMG/M |
| 3300031943|Ga0310885_10392017 | Not Available | 738 | Open in IMG/M |
| 3300032000|Ga0310903_10267373 | Not Available | 829 | Open in IMG/M |
| 3300032261|Ga0306920_103148336 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 619 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.01% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.41% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.50% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.60% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.60% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.70% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.70% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.70% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.70% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.80% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 1.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.80% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.80% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.80% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.80% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.80% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.90% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.90% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.90% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.90% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.90% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.90% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.90% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.90% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.90% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.90% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002099 | Soil microbial communities from Manhattan, Kansas, USA - Sample 400um MDA | Environmental | Open in IMG/M |
| 3300002128 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009802 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_50_60 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
| 3300020005 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2 | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021510 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026702 | Grasslands soil microbial communities from Kansas, USA, that are Nitrogen fertilized - NN593 (SPAdes) | Environmental | Open in IMG/M |
| 3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F62_08486230 | 2170459010 | Grass Soil | MSGAVSFSKGDGQSVSLTYSDTPIAPSEVSLSAMRAELERR |
| JGI11643J12802_122411521 | 3300000890 | Soil | AGTILFSKEDGPSLNITYSDTGFMPTEVSVSAFRAELEAAK* |
| JGI1027J12803_1013058922 | 3300000955 | Soil | IFSKGDGQSVNITYSDTGFMPTEVSLSAMRAELEAAK* |
| JGI1027J12803_1016196302 | 3300000955 | Soil | AGTLLFSKENGQSVNITYSDTGFMPTEVSLSAMRAELEAAK* |
| JGI1027J12803_1023003282 | 3300000955 | Soil | SKEGGGSVTVTYSDTGFMPTEVSVSAFRAELEAAK* |
| JGI1027J12803_1024157941 | 3300000955 | Soil | FSKEGGPSVTITYSDTGFMPTEVSLSAMRAELEAAK* |
| JGI10216J12902_1170997591 | 3300000956 | Soil | KEDVASLERMAGTILLSKEDGKSVNITYSDTGFMPSEVSVSAMRVEFEAAR* |
| JGI24808J26613_10296981 | 3300002099 | Soil | WKEDVASLERMAGTVLLSKDNGQSVTITYSDTGFMPSEVSVSAMRVEFEAAR* |
| JGI24036J26619_100087871 | 3300002128 | Corn, Switchgrass And Miscanthus Rhizosphere | KEDVASLERMAGTLLFSKDGQSLNITYSDTGFMPTEVSLSAMRAELEAAK* |
| Ga0062592_1016161061 | 3300004480 | Soil | EDVASLERMAGTLLFSKDGQSLNITYSDTGFMPTEVSLSAMRAELEAAK* |
| Ga0066672_109015992 | 3300005167 | Soil | MAGTILLSKEDGQSVNITYSDTGFMPSEVSVSAMRVEFEAAR* |
| Ga0066673_106960272 | 3300005175 | Soil | SVTGMSGVVSVSKEGGPSATITYTDTGFLPTELSVSAMRADLEAAESKK* |
| Ga0066684_104071971 | 3300005179 | Soil | GMSGVVSVSKEGGPSATITYTDTGFLPTELSVSAMRAELEAAK* |
| Ga0065712_102664911 | 3300005290 | Miscanthus Rhizosphere | GTLAFSKDDQHVTITYSDTGFMPTEVSLSAMRAELEAAR* |
| Ga0065705_103203991 | 3300005294 | Switchgrass Rhizosphere | ASVTGMSGVVSVSKEGGPSATITYSDTGFLPTELSVSAFRAELEAAK* |
| Ga0070660_1005738651 | 3300005339 | Corn Rhizosphere | VASLERMAGTLIFSKGDGQSVNITYSDTGFMPTEVSLSAMRAELEAAK* |
| Ga0070688_1003139043 | 3300005365 | Switchgrass Rhizosphere | TMEKMAGTLLFSKEGGGSVNITYSDTGFMPTEVSVSAFRAELEAAR* |
| Ga0070709_112971912 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MAGTLSFSKEGGQSVTITYSDTGFMPSEVTVSLVRAEFEAAR* |
| Ga0070711_1003414571 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MEKMAGTLSFSKEGGQSVTITYSDTGFMPTEVSVSTFRGELEAAK* |
| Ga0070662_1009001661 | 3300005457 | Corn Rhizosphere | GVVSVSKEGGPSATITYTDTGFLPTELSVSAFRAELEAAK* |
| Ga0070665_1008485832 | 3300005548 | Switchgrass Rhizosphere | LAFSKDDQHVTITYSDTGFMPTEVSLSAMRAELEAAR* |
| Ga0066706_101357153 | 3300005598 | Soil | MAGTLLFSKENGQSVNVTYSDTGFMPTEVSLSAMRAELEAAK* |
| Ga0066905_1007553922 | 3300005713 | Tropical Forest Soil | SLEAMAGTLLLSKGEGQSVTITYSDTGFMPSEVSVSAMRAELEAAK* |
| Ga0066903_1064908462 | 3300005764 | Tropical Forest Soil | EDVAALDGMAGALSFSKEGGQSVTINYTDTGFMPSEVTVSVMRGELEAAK* |
| Ga0068860_1013877432 | 3300005843 | Switchgrass Rhizosphere | ATMEKMAGTLLFSKEGGGSVNVTYSDTGFMPTEVSVSAFRAELEAAR* |
| Ga0081455_101591591 | 3300005937 | Tabebuia Heterophylla Rhizosphere | ASLERMAGTLSFSKEGQSVTITYSDTGFMPTEVSLSAFRAELEAAK* |
| Ga0081455_105808263 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MAGTLKFSKEDGPSVTVTYSDTGFMPTEVSVSAFRAELEAAR* |
| Ga0070712_1002810482 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | DVASVTGMSGVVSVSKEGGPSVTVTYTDTPIMPSEVSLSAMRAELEAAK* |
| Ga0066660_101909792 | 3300006800 | Soil | MSGVVSVSKEGGPSVTITYSDTGFMPTEVSVSAMRAELEAAK* |
| Ga0075428_1010522301 | 3300006844 | Populus Rhizosphere | SFSKEDGQSVTVTYTDTPISPSEVSLSAMRAELEAAK* |
| Ga0075433_105655671 | 3300006852 | Populus Rhizosphere | SAMAGTLLLSKEDQSVNITYSDTGFMPSEVTLSAMRAELEAAK* |
| Ga0075434_1022852572 | 3300006871 | Populus Rhizosphere | WKEDVASMSAMAGTLLLSKEDQSVNITYSDTGFMPSEVTLSAMRAELEAAK* |
| Ga0066710_1018914961 | 3300009012 | Grasslands Soil | GMSGVVSVSKEGGPSATITYTDTGFLPTELSVSAMRAELEAAK |
| Ga0066710_1027731063 | 3300009012 | Grasslands Soil | MAGTLLFSKDGGQSVNITYSDTGFMPTEVSVSAMRGELEAAK |
| Ga0105245_121713741 | 3300009098 | Miscanthus Rhizosphere | KEGGGSINVTYSDTGFMPTEVSVSAFRAELEAAR* |
| Ga0114129_118710951 | 3300009147 | Populus Rhizosphere | IASLERMAGTLLLSKENGQSLTITYSDTGFMPSEVSVSAMRAELEAAR* |
| Ga0105073_10541511 | 3300009802 | Groundwater Sand | EDVASMAAMAGTLSFSKEDQSVTITYSDTGFLPTEVSLSAMRAELEAAK* |
| Ga0126308_105526401 | 3300010040 | Serpentine Soil | ASLERMAGTLLFSKGDGQSVNITYSDTGFMPTEVSLSAMRVEFEAAK* |
| Ga0126384_103326591 | 3300010046 | Tropical Forest Soil | LSFSKEGGQSLTITYSDTGFMPTEVSVSAFRGELEAAK* |
| Ga0126382_104898101 | 3300010047 | Tropical Forest Soil | MAGTLLLSKGEGQSVTITYSDTGFMPSEVSVSAMRAELEAPK* |
| Ga0126382_110879962 | 3300010047 | Tropical Forest Soil | LERMAGTVLLSKGDQSVTITYSDTGFMPSEISVSAMHVEFEAAR* |
| Ga0134086_103229293 | 3300010323 | Grasslands Soil | SKGDGQSVNITYSDTGFMPTEISLSGMRVEFEAAK* |
| Ga0134065_102200642 | 3300010326 | Grasslands Soil | TLLFSKGDGQSVNITYSDTGFLPTEVSLSAMRIEFEAAK* |
| Ga0134062_108183651 | 3300010337 | Grasslands Soil | KGDGQRVNITYSDTGFMPTEVSLSAMRAELEADK* |
| Ga0126377_117280182 | 3300010362 | Tropical Forest Soil | KEDVASVEHMAGTVLLSKDNGQSVTITYSDTGFMPSEVSVSAMRVEFEAAR* |
| Ga0134125_122259851 | 3300010371 | Terrestrial Soil | KHASMSAMAGTLSFSKEGGGSVTVTYSDTGFMPTEISLSAFRAELEAAR* |
| Ga0134128_118762241 | 3300010373 | Terrestrial Soil | MEKMAGTLLFSKEGGGSINITYSATGFMPTEVSVSAFRAELEAAR* |
| Ga0134127_135807322 | 3300010399 | Terrestrial Soil | LFSKDGQSLNITYSDTGFMPTEVSLSAMRAELEAAK* |
| Ga0137383_104231852 | 3300012199 | Vadose Zone Soil | VASVTGMSGVVSVSKEGGPSVTITYTDTGFLPTELSVSAMRAELERR* |
| Ga0137383_112760931 | 3300012199 | Vadose Zone Soil | VSKEGGPSATITYTDTGFLPTELSVSAMRADLEAAESKK* |
| Ga0137382_108784961 | 3300012200 | Vadose Zone Soil | RMAGTLLFSKGDGQRVNITYSDTGFMPTEVSLSAMRVELEATK* |
| Ga0137381_118089211 | 3300012207 | Vadose Zone Soil | AAVTGMSGAVSVSKEGGQSVSITYTDTGFLPTELSISGMRVELERH* |
| Ga0137377_108779241 | 3300012211 | Vadose Zone Soil | GVVSVSKEGGPSVTITYTDTGFLPTELSVSAMRAELEATK* |
| Ga0137377_114596951 | 3300012211 | Vadose Zone Soil | SKGDGQRVNITYSDTGFMPSEVSVSAMRVEFEAAR* |
| Ga0137387_111460381 | 3300012349 | Vadose Zone Soil | KGDGQRVNITYSDTGFMPSEVSVSAMRVEFEAPR* |
| Ga0137368_102470414 | 3300012358 | Vadose Zone Soil | FSKGDGQSVSLTYTDTGFLPTEVSLSAMRAELERR* |
| Ga0137385_111488951 | 3300012359 | Vadose Zone Soil | MAGTLLFSKGDGQRVNITYSDTGFMPSEVSVSAMRVEFEAAR* |
| Ga0137358_103070463 | 3300012582 | Vadose Zone Soil | SFSKEGGQSVTITYSDTGFMPTEVSVSAFRGELEAAK* |
| Ga0137398_104055292 | 3300012683 | Vadose Zone Soil | VTGMSGVVSVSKEGGPSATVTYTDTGFLPTELSVSAMRADLEAAESKK* |
| Ga0137398_108164873 | 3300012683 | Vadose Zone Soil | ASVTGMSGVVSVSTEGGPSVTITYTDTGFLPTELSISAMRAELEAAK* |
| Ga0137394_106424093 | 3300012922 | Vadose Zone Soil | SGAASFSKEDGQNVTVTYTDTPISPSEVSLSAMRAELEAAK* |
| Ga0137359_108602491 | 3300012923 | Vadose Zone Soil | EDVTAIEKMAGTLSFSKEGGQSVTITYSDTGFMPTEVSVSAFRGELEAAK* |
| Ga0137413_106842471 | 3300012924 | Vadose Zone Soil | TLLFSKGDGQRVNITYSDTGFMPTEVSLSAMRVEFEAAK* |
| Ga0137404_121774031 | 3300012929 | Vadose Zone Soil | AGTLSFSKEGGGRVTVTYSDTGFMPTEVSVSAFRAELEAAR* |
| Ga0126375_115259172 | 3300012948 | Tropical Forest Soil | LSFSKEGGQSVTINYTDTGFMPSEVTVSVMRGELEAAK* |
| Ga0134076_102140091 | 3300012976 | Grasslands Soil | SGVVSVSKEGGPSATITYTDTGFLPTELSVSAMRAELEATK* |
| Ga0134076_103643912 | 3300012976 | Grasslands Soil | SKEGGPSATITYTDTGFLPTELSVSAMRAELEATESKK* |
| Ga0157371_116027481 | 3300013102 | Corn Rhizosphere | HATMEKMAGTLLFSKEGGGSVNITYSDTGFMPTEVSVSAFRAELEAAR* |
| Ga0157374_107059134 | 3300013296 | Miscanthus Rhizosphere | WKEDVASLERMAGTLIFSKGDGQSMNITYSDTGFMPTEVSLSAFRAELEAAR* |
| Ga0137405_11510942 | 3300015053 | Vadose Zone Soil | FSKEDGQSVTLTYSDTPISPSEVSLSAMRAELERR* |
| Ga0132258_104499534 | 3300015371 | Arabidopsis Rhizosphere | VASLERMAGTLLFSKGDGQSVNITYSDTGFMPTEVSVSAMRVEFEAAR* |
| Ga0132257_1012890254 | 3300015373 | Arabidopsis Rhizosphere | KEEHASMEKMAGTLLFSKEGGGSVNVTYSDTGFMPTEVSVSAFRAELEAAK* |
| Ga0132255_1039035831 | 3300015374 | Arabidopsis Rhizosphere | ATMEKMAGTLLFSKEGGGSINITYSDTGFMPTEVSVSAFRAELEAAR* |
| Ga0134074_13856642 | 3300017657 | Grasslands Soil | FSKEDGQSVTVTYTDTPISPSEVSLSAMRAELEAAK |
| Ga0184621_102672813 | 3300018054 | Groundwater Sediment | MVSVSKEGGPSVTITYSDTGFMPTELSVSAFRAELEAQQQK |
| Ga0184623_104306342 | 3300018056 | Groundwater Sediment | LFSKGDGQSVNITYSDTGFMPTEVSLSSMRVELEAAK |
| Ga0184617_10286101 | 3300018066 | Groundwater Sediment | VSVSKEGGPSATITYTDTGFLPTELSVSTMHAELEAAK |
| Ga0184609_100492164 | 3300018076 | Groundwater Sediment | SGVVHVSKEGGPSVSITYSDTGFMPTELSVSAFRAELEAQQER |
| Ga0193723_10872442 | 3300019879 | Soil | VASMAGMSGTLLFSKEDGHLTITYSDTGFMPTEVSLSAFRAELEATK |
| Ga0193707_10333071 | 3300019881 | Soil | KEDVASVTGMSGMVSVSKEGGPSVTITYTDTGFMPTELSVSAFRAELEAAK |
| Ga0193707_10433391 | 3300019881 | Soil | SVSKEGGPSATITYTDTGFMPTELSVSAMRAELEAAK |
| Ga0193713_11149161 | 3300019882 | Soil | LFSKENGQSVNITYSDTGFMPTEVSVSAMRVEFEAAR |
| Ga0193727_11906092 | 3300019886 | Soil | KENVASVTGMSGMVSVSKEGGPSATITYTDTGFMPTELSVSAFRAELEITK |
| Ga0193697_10244433 | 3300020005 | Soil | SGVVSVSKEGGPSATITYSDTGFLPTELSVSAFRAELEAAK |
| Ga0210382_102094123 | 3300021080 | Groundwater Sediment | FSKEDGQSLTVTYSDTPISPSEVSLSAFRAELEAAK |
| Ga0179596_103319061 | 3300021086 | Vadose Zone Soil | DVASVTGMTGVVSVSKEGGPSATITYTDTGFLPTELSVSAMRADLEAAESKK |
| Ga0222621_10342971 | 3300021510 | Groundwater Sediment | MAGTLSFSKEGGGSVTVTYSDTGFMPTEVSLSAFRAELEAAK |
| Ga0224452_11150192 | 3300022534 | Groundwater Sediment | AAMAGMSGAVSFSKGDGQSVSLTYSDTPIAPSEVSLSAMRAELERR |
| Ga0137417_13888504 | 3300024330 | Vadose Zone Soil | MSASVTGMSGVVSVSKEGGPSATITYTDTGFLPTELSVSAMRADLEAAESKK |
| Ga0207697_102123703 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MEKMAGTLLFSKEGGGSVNITYSDTGFMPTEVSVSAFRAELEAAR |
| Ga0207643_104794782 | 3300025908 | Miscanthus Rhizosphere | MAGTLAFSKDDQHVTITYSDTGFMPTEVSLSAMRAELEAAR |
| Ga0207659_105590182 | 3300025926 | Miscanthus Rhizosphere | ERMAGTLAFSKDDQHVTITYSDTGFMPTEVSLSAMRAELEAAR |
| Ga0207701_100871991 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | DHATMEKMAGTLLFSKEGGGSVNVTYSDTGFMPTEVSVSAFRAELEAAK |
| Ga0207690_113096481 | 3300025932 | Corn Rhizosphere | EDVASLERMAGTLAFSKDDQHVTITYSDTGFMPTEVSLSAMRAELEAAR |
| Ga0207670_113568562 | 3300025936 | Switchgrass Rhizosphere | TLLFSKDDQHVTITYSDTGFMPTEVSLSAMRTELEAAK |
| Ga0207669_110292082 | 3300025937 | Miscanthus Rhizosphere | MAGTLLFSKGDGQSVNITYSDTGFMPTEVSVSAMRAELEAAR |
| Ga0207658_110897131 | 3300025986 | Switchgrass Rhizosphere | IFSKGDGQSVNITYSDTGFMPTEVSLSAMRAELEAAK |
| Ga0207703_112902323 | 3300026035 | Switchgrass Rhizosphere | LFSKEGGGSVNITYSDTGFMPTEVSVSAFRAELEAAR |
| Ga0207698_126964272 | 3300026142 | Corn Rhizosphere | DVASLERMAGTLAFSKDDQHVTITYSDTGFMPTEVSLSAMRAELEAAR |
| Ga0209801_10674441 | 3300026326 | Soil | GAASFSKEDGQSVTITYTDTGIMPSEISLSAMRAELERR |
| Ga0209801_12653852 | 3300026326 | Soil | GTLLFSKGDGQRVNITYSDTGFMPSEVSVSAMRVEFEAAR |
| Ga0208708_1020901 | 3300026702 | Soil | LSKEDQSVTITYSDTGFMPSEVSVSAMRAELEAAK |
| Ga0307291_11738191 | 3300028707 | Soil | AGTLLFSKEGGGSVNVTYSDTGFMPTEVSVSAFRAELEAAK |
| Ga0307299_100399651 | 3300028793 | Soil | FSKEDGQSVTVTYSDTPISPSEVSLSAFRAELEAAK |
| Ga0307278_104762951 | 3300028878 | Soil | GAASFSKEDGQSVTVTYTDTPISPSEVSLSAFRAELERR |
| Ga0307304_103341931 | 3300028885 | Soil | SKEGGGSVNVTYSDTGFMPTEVSVSAFRAELEAAR |
| Ga0170824_1097593212 | 3300031231 | Forest Soil | FSKDDQHVTITYSDTGFMPTEVSVSAMRAELEAAR |
| Ga0307469_112040301 | 3300031720 | Hardwood Forest Soil | LSFKKEGGGSVTITYSDTGFMPTEVSVSAFRAELEAAR |
| Ga0310885_103920171 | 3300031943 | Soil | MAGTLLFSKENGQSVNITYSDTGFMPTEVSLSAMRAELEAAK |
| Ga0310903_102673732 | 3300032000 | Soil | LFSKENGQSVNITYSDTGFMPTEVSLSAMRAELEAAR |
| Ga0306920_1031483361 | 3300032261 | Soil | FSKEGGQNVTINYTDTGFMPSEVSVSAMRVEFEAAR |
| ⦗Top⦘ |