


| Basic Information | |
|---|---|
| Family ID | F085934 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 111 |
| Average Sequence Length | 40 residues |
| Representative Sequence | EEYKMLQFADSVDEAFDHIRAGLEKYHMEVDPFLQAY |
| Number of Associated Samples | 98 |
| Number of Associated Scaffolds | 111 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 95.50 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.297 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (24.324 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.631 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.955 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.92% β-sheet: 0.00% Coil/Unstructured: 63.08% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 111 Family Scaffolds |
|---|---|---|
| PF03544 | TonB_C | 1.80 |
| PF01553 | Acyltransferase | 1.80 |
| PF05163 | DinB | 0.90 |
| PF12867 | DinB_2 | 0.90 |
| PF01370 | Epimerase | 0.90 |
| PF00679 | EFG_C | 0.90 |
| COG ID | Name | Functional Category | % Frequency in 111 Family Scaffolds |
|---|---|---|---|
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 1.80 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.90 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.30 % |
| Unclassified | root | N/A | 2.70 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459002|FZY7DQ102GR43C | Not Available | 507 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100959497 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 738 | Open in IMG/M |
| 3300002906|JGI25614J43888_10205762 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300002917|JGI25616J43925_10293206 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300005467|Ga0070706_100824414 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 858 | Open in IMG/M |
| 3300005536|Ga0070697_102127456 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300005537|Ga0070730_10732058 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300005602|Ga0070762_10253247 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
| 3300005921|Ga0070766_10203950 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1237 | Open in IMG/M |
| 3300006052|Ga0075029_100928418 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300006059|Ga0075017_100965415 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 663 | Open in IMG/M |
| 3300006176|Ga0070765_100849637 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 863 | Open in IMG/M |
| 3300006871|Ga0075434_100909563 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 895 | Open in IMG/M |
| 3300006903|Ga0075426_10624363 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 805 | Open in IMG/M |
| 3300007255|Ga0099791_10091979 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1390 | Open in IMG/M |
| 3300007258|Ga0099793_10476414 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
| 3300007265|Ga0099794_10145885 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1200 | Open in IMG/M |
| 3300009012|Ga0066710_104886045 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300009792|Ga0126374_11737360 | Not Available | 520 | Open in IMG/M |
| 3300010048|Ga0126373_12683125 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300010303|Ga0134082_10446678 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300010329|Ga0134111_10322578 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
| 3300010339|Ga0074046_10204476 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1240 | Open in IMG/M |
| 3300010361|Ga0126378_10975424 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 952 | Open in IMG/M |
| 3300010361|Ga0126378_13263444 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300010362|Ga0126377_10415168 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1360 | Open in IMG/M |
| 3300010376|Ga0126381_104616856 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300010379|Ga0136449_102499270 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 741 | Open in IMG/M |
| 3300010877|Ga0126356_11107291 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300011270|Ga0137391_10984969 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
| 3300011271|Ga0137393_10061539 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2965 | Open in IMG/M |
| 3300011271|Ga0137393_10105267 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2309 | Open in IMG/M |
| 3300011271|Ga0137393_11151521 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 659 | Open in IMG/M |
| 3300012096|Ga0137389_10967016 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 730 | Open in IMG/M |
| 3300012189|Ga0137388_10315909 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1435 | Open in IMG/M |
| 3300012189|Ga0137388_10548371 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1075 | Open in IMG/M |
| 3300012189|Ga0137388_10706671 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 936 | Open in IMG/M |
| 3300012205|Ga0137362_10464314 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1096 | Open in IMG/M |
| 3300012361|Ga0137360_10195814 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1633 | Open in IMG/M |
| 3300012363|Ga0137390_10803390 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 898 | Open in IMG/M |
| 3300012918|Ga0137396_10452528 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 952 | Open in IMG/M |
| 3300012918|Ga0137396_11044907 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300014166|Ga0134079_10435130 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
| 3300015053|Ga0137405_1049353 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1201 | Open in IMG/M |
| 3300015054|Ga0137420_1002248 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1198 | Open in IMG/M |
| 3300015241|Ga0137418_10599919 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 864 | Open in IMG/M |
| 3300015264|Ga0137403_10947962 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
| 3300016294|Ga0182041_10586471 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 978 | Open in IMG/M |
| 3300016341|Ga0182035_11198328 | Not Available | 678 | Open in IMG/M |
| 3300016422|Ga0182039_10877887 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 800 | Open in IMG/M |
| 3300016422|Ga0182039_11111789 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 712 | Open in IMG/M |
| 3300017822|Ga0187802_10041891 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1658 | Open in IMG/M |
| 3300017961|Ga0187778_11013726 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300018012|Ga0187810_10202611 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 807 | Open in IMG/M |
| 3300018019|Ga0187874_10474505 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300019284|Ga0187797_1469476 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
| 3300021046|Ga0215015_10451641 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1233 | Open in IMG/M |
| 3300021168|Ga0210406_10729093 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 761 | Open in IMG/M |
| 3300021168|Ga0210406_11290221 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300021401|Ga0210393_11299364 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 583 | Open in IMG/M |
| 3300021406|Ga0210386_11032609 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 700 | Open in IMG/M |
| 3300021406|Ga0210386_11733370 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300021407|Ga0210383_11376846 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300021432|Ga0210384_11584489 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
| 3300021433|Ga0210391_10332793 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1191 | Open in IMG/M |
| 3300021433|Ga0210391_10972316 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
| 3300021475|Ga0210392_11052612 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
| 3300021478|Ga0210402_10935828 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 793 | Open in IMG/M |
| 3300021478|Ga0210402_11093581 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 724 | Open in IMG/M |
| 3300021559|Ga0210409_11169767 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
| 3300021560|Ga0126371_10700372 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1161 | Open in IMG/M |
| 3300022533|Ga0242662_10356869 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300022726|Ga0242654_10260581 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
| 3300024331|Ga0247668_1083174 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300025922|Ga0207646_10505824 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1088 | Open in IMG/M |
| 3300026515|Ga0257158_1050194 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 769 | Open in IMG/M |
| 3300026552|Ga0209577_10870852 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300026760|Ga0207630_104682 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300026819|Ga0207765_118012 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300027042|Ga0207766_1013468 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 944 | Open in IMG/M |
| 3300027853|Ga0209274_10557996 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300027855|Ga0209693_10433150 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 633 | Open in IMG/M |
| 3300027898|Ga0209067_10008678 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5451 | Open in IMG/M |
| 3300027903|Ga0209488_10401567 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
| 3300029636|Ga0222749_10035803 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2133 | Open in IMG/M |
| 3300030862|Ga0265753_1065845 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300031543|Ga0318516_10850717 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300031572|Ga0318515_10033975 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2506 | Open in IMG/M |
| 3300031590|Ga0307483_1011956 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 776 | Open in IMG/M |
| 3300031681|Ga0318572_10851106 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300031715|Ga0307476_11080239 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300031720|Ga0307469_11098163 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 747 | Open in IMG/M |
| 3300031744|Ga0306918_10402551 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1066 | Open in IMG/M |
| 3300031754|Ga0307475_11251238 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300031764|Ga0318535_10089466 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1339 | Open in IMG/M |
| 3300031764|Ga0318535_10436026 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
| 3300031768|Ga0318509_10221830 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1053 | Open in IMG/M |
| 3300031820|Ga0307473_10903355 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
| 3300031894|Ga0318522_10170676 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 822 | Open in IMG/M |
| 3300031910|Ga0306923_11686736 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300031912|Ga0306921_11986808 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300031912|Ga0306921_11999750 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
| 3300031954|Ga0306926_10749601 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1181 | Open in IMG/M |
| 3300032001|Ga0306922_10717096 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1051 | Open in IMG/M |
| 3300032035|Ga0310911_10531641 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 682 | Open in IMG/M |
| 3300032052|Ga0318506_10502683 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
| 3300032076|Ga0306924_10261244 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1988 | Open in IMG/M |
| 3300032261|Ga0306920_100917332 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1280 | Open in IMG/M |
| 3300032770|Ga0335085_10543011 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1319 | Open in IMG/M |
| 3300032954|Ga0335083_10210339 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1771 | Open in IMG/M |
| 3300033158|Ga0335077_11626441 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 24.32% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.31% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.50% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.50% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.70% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.70% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.70% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.70% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.70% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.80% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.80% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.80% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.90% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.90% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.90% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.90% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.90% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.90% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.90% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.90% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.90% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459002 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cm | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002906 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010877 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026760 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-SCHO22-B (SPAdes) | Environmental | Open in IMG/M |
| 3300026819 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 59 (SPAdes) | Environmental | Open in IMG/M |
| 3300027042 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 68 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031590 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E1_08355300 | 2170459002 | Grass Soil | VRWGTISQIDYDELQYADNVDEAFEAVRSGLEKYHMNVDPFLQAY |
| JGIcombinedJ26739_1009594971 | 3300002245 | Forest Soil | FDNLQYADSVDEAFDKIRMGLEKYHMQGDPFLQAY* |
| JGI25614J43888_102057621 | 3300002906 | Grasslands Soil | EVLNLKNMLRWGTISQADFDNLQYADSVDEAFDKIRMGLEKYHMEAEPFLQAY* |
| JGI25616J43925_102932061 | 3300002917 | Grasslands Soil | KNMVRWGTISQADFDNLQYADSVDEAFDKIRVGLEKYHMQGDPFLQAY* |
| Ga0070706_1008244142 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VRWGMISASEYGLLQFADNVDDAFEVIRAGLEKYHMEVDPFLQAY* |
| Ga0070697_1021274562 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | WGMINQNEYDMLQFSDNVDDAFQRIRSGLEKYHMELSSEL* |
| Ga0070730_107320582 | 3300005537 | Surface Soil | EEYKMLQFADSVDEAFDHIRAGLEKYHMEVDPFLQAY* |
| Ga0070762_102532471 | 3300005602 | Soil | AMVNWGTINEDEYKMLQFADSVDEAFDHIRAGLEKYHMEVDPFLQAY* |
| Ga0070766_102039504 | 3300005921 | Soil | NWGTINEEEYKMLQFADSVDEAFDHIRAGLEKYHMEVDPFLQAY* |
| Ga0075029_1009284181 | 3300006052 | Watersheds | GTISQADFDNLQYADTVEEAFDKIRMGLEKYHMQVDPFLQAY* |
| Ga0075017_1009654153 | 3300006059 | Watersheds | INQSEYDLLQFADTVDEAFDVVRAGLEKYHMQVDPFLQAY* |
| Ga0070765_1008496371 | 3300006176 | Soil | KAMVRWGMINQNEYKLLKFADTPDEAFDIIHTELENYHMQVDPFLQAY* |
| Ga0075434_1009095631 | 3300006871 | Populus Rhizosphere | GLLQFADNVDDAFEVIRAGLEKYHMEVDPFLQAY* |
| Ga0075426_106243631 | 3300006903 | Populus Rhizosphere | VRWGTINEQEYEMLQFADNVDEAFDRVRAGLEKYHMNVDPFLQAY* |
| Ga0099791_100919793 | 3300007255 | Vadose Zone Soil | EYKMLQFADTVDEAFDHIRAGLEKYHMDADSFLQAY* |
| Ga0099793_104764142 | 3300007258 | Vadose Zone Soil | KMLQFADTVDEAFDHIRAGLEKYHMDLDPFLQAY* |
| Ga0099794_101458851 | 3300007265 | Vadose Zone Soil | NEYKMLQFADTVDEAFDHIRAGLEKYHMDADSFLQAY* |
| Ga0066710_1048860451 | 3300009012 | Grasslands Soil | EDEYKLLQFADNVDEAFDLVRAGMEKYHMDVDPFLQAY |
| Ga0126374_117373601 | 3300009792 | Tropical Forest Soil | NPDEFKLLKFADTVEDAFNVVRATLEKYHMEVDPFLQTY* |
| Ga0126373_126831252 | 3300010048 | Tropical Forest Soil | PSEYGLLQFADTVDDAFEVIRAGLERYHMEVDPFLQAY* |
| Ga0134082_104466781 | 3300010303 | Grasslands Soil | YNMLQFADTVDEAFDYNRAGLEKYHMEPDPFLRA* |
| Ga0134111_103225781 | 3300010329 | Grasslands Soil | KLLQFADNVDEAFDLVRAGMEKYHMDVDPFLQAY* |
| Ga0074046_102044763 | 3300010339 | Bog Forest Soil | LNFRAMVRWGMISQNEYGLIQYADTVEEAFEKIRTGMEKYHMEVDPFLQAY* |
| Ga0126378_109754241 | 3300010361 | Tropical Forest Soil | KLLQFADDVDEAFDRIRAGLEKYHMGVDPFLQAY* |
| Ga0126378_132634441 | 3300010361 | Tropical Forest Soil | YEMLQFADTVDEAFDRIRAGLEKYHMDAEPFLQAY* |
| Ga0126377_104151681 | 3300010362 | Tropical Forest Soil | EYKLLQFADNVDEAFDLVRAAMEKYHMDVDPFLQAY* |
| Ga0126381_1046168562 | 3300010376 | Tropical Forest Soil | YEMLQFADTVEEAFDRIRAGLEKYHMDAEPFLQAY* |
| Ga0136449_1024992703 | 3300010379 | Peatlands Soil | EEYKMLKFADTVDEAFDHIRAGLEKYHMDTDSFLQAY* |
| Ga0126356_111072911 | 3300010877 | Boreal Forest Soil | NEEEYKMLQFADSVDEAFDHIRAGLEKYHMEVDPFLQAY* |
| Ga0137391_109849692 | 3300011270 | Vadose Zone Soil | KLLQFADNVDDAFEVIRSGLEKYHMEVDPVLQAY* |
| Ga0137393_100615395 | 3300011271 | Vadose Zone Soil | EDEYKMLQFADTVDEAFDHIRAGLEKYHMDLDPFLQAY* |
| Ga0137393_101052671 | 3300011271 | Vadose Zone Soil | EEYKMLQFADTVDEAFDHIRAGLEKYHMDGDPFLQAY* |
| Ga0137393_111515211 | 3300011271 | Vadose Zone Soil | INEAEYKLLQFADNVDDAFEVIRSGLEKYHMEVDPVLQAY* |
| Ga0137389_109670162 | 3300012096 | Vadose Zone Soil | YKMLQFADNVEEAFDRIRAGLEKYHMGVEPFLQAY* |
| Ga0137388_103159093 | 3300012189 | Vadose Zone Soil | VLKLKNMVRWGTISQADFDNLQYADSVDEAFDKIRMGLEKYHMEGDPFLQAY* |
| Ga0137388_105483711 | 3300012189 | Vadose Zone Soil | DEYKMLQFADTVDEAFDHIRAGLEKYHMGVDAFLQAY* |
| Ga0137388_107066711 | 3300012189 | Vadose Zone Soil | VNEEEYKMLQFADNVEEAFDRIRAGLEKYHMGVEPFLQAY* |
| Ga0137362_104643143 | 3300012205 | Vadose Zone Soil | KMLQFADTVDEAFDRIRAGLEKYHMDGDPFLQAY* |
| Ga0137360_101958141 | 3300012361 | Vadose Zone Soil | DFDNLQYADSVDEAFDKIRVGLEKYHMKGDPFLQAY* |
| Ga0137390_108033901 | 3300012363 | Vadose Zone Soil | RAMVRWRTNNEEEYNMLQLADTVDDAFERIRGGLEKYHMQVDPFLQAY* |
| Ga0137396_104525281 | 3300012918 | Vadose Zone Soil | IDDEEHNLLQFADNVDEAFDLIRSGLEKYLMEVDPFLQTY* |
| Ga0137396_110449072 | 3300012918 | Vadose Zone Soil | EYKMLLFADTVDEAFDHIRAGLEKYHMDGDPFLQAY* |
| Ga0134079_104351302 | 3300014166 | Grasslands Soil | EYKLLQFADNVDEAFDLVRAGMEKYHMDVDPFLQAY* |
| Ga0137405_10493531 | 3300015053 | Vadose Zone Soil | ICRYRRKMLQFADTVDEAFDHIRAGLEKYHMGVDAFLQAY* |
| Ga0137420_10022483 | 3300015054 | Vadose Zone Soil | KMLQFADTVDDAFDHIRAGLEKYHMDADPFLQAY* |
| Ga0137418_105999191 | 3300015241 | Vadose Zone Soil | ENEYKMLQFADTVEEAFDHIRAGLEKYHMDADPFLQAY* |
| Ga0137403_109479622 | 3300015264 | Vadose Zone Soil | KMLQFADTVDEAFDHIRAGLEKYHMDADPFLQAY* |
| Ga0182041_105864711 | 3300016294 | Soil | QEEYDLLQYADTVDEAFEVIRSGLEKYHMEVDPFLQAY |
| Ga0182035_111983281 | 3300016341 | Soil | LHLKAMERWGMINPDEFKLLKFADTVEEAFNVVRATLERYHMEVDPFLQTY |
| Ga0182039_108778871 | 3300016422 | Soil | YDLLQYADTVDEAFEVIRSGLEKYHMEVDPFLQAY |
| Ga0182039_111117891 | 3300016422 | Soil | KAMVRWGTISQIDYDQLQYADNVDEAFEAVRSGLEKYHMNVDPFLQAY |
| Ga0187802_100418911 | 3300017822 | Freshwater Sediment | QTEFDQLQFADNVDEAFEVIRAGLEKYHMEVDPFLQAY |
| Ga0187778_110137261 | 3300017961 | Tropical Peatland | ITEEEYKMLQFADSVDEAFDLIRAGLEKYHMDVDPFLQAY |
| Ga0187810_102026111 | 3300018012 | Freshwater Sediment | TITEEEYRLLKFADNVDEAFDHIRSGLEKYHMKVDSFLQAY |
| Ga0187874_104745052 | 3300018019 | Peatland | QSEYNMLQFADTVDEAFERIQSGLEKYHLEIESDL |
| Ga0187797_14694761 | 3300019284 | Peatland | NEAEYKMLQFADNVDEAFDRVRAGLEKYHMRVDSFLQAY |
| Ga0215015_104516413 | 3300021046 | Soil | RWGMINQDEYKMLQFADPVDEAFARIREGLEKYHMELNSDL |
| Ga0210406_107290932 | 3300021168 | Soil | DEEEHKLLKFADTVDEAFDHIRSGLEKYHMEVDPFLQAY |
| Ga0210406_112902211 | 3300021168 | Soil | EEEYKMLQFADSVDEAFDHIRAGLEKYHMEVDPFLQAY |
| Ga0210393_112993641 | 3300021401 | Soil | WGTINEEEYKMLQFADSVDEAFDHIRAGLEKYHMEVDPFLQAY |
| Ga0210386_110326091 | 3300021406 | Soil | WGTISQADFDNLQYADSVDEAFDKIRMGLEKYHMEGDPFLQAY |
| Ga0210386_117333701 | 3300021406 | Soil | KNMVRWGTISQADFDNLQYADSVDEAFDKIRMGLEKYHMQGDPFLQAY |
| Ga0210383_113768461 | 3300021407 | Soil | EEYKMLQFADSVDEAFDHIRAGLEKYHMEVDPFLQAY |
| Ga0210384_115844892 | 3300021432 | Soil | NEEEYKMLQFADSVDEAFDHIRAGLEKYHMEVDPFLQAY |
| Ga0210391_103327933 | 3300021433 | Soil | MVNWGTINEEEYKMLQFADSVDEAFDHIRAGLEKYHMEVDPFLQAY |
| Ga0210391_109723162 | 3300021433 | Soil | LNWKAMVKWGTINEDEYKMLQFADSVDEAFDHIRAGLEKYHMEVDPFLQAY |
| Ga0210392_110526122 | 3300021475 | Soil | NMVRWGTISQADFDNLQYADSVDEAFDKIRMGLEKYHMEGDPFLQAY |
| Ga0210402_109358281 | 3300021478 | Soil | EYKMLQFADTVDDAFDYIRGGLEKYHMNVDPFLQTY |
| Ga0210402_110935811 | 3300021478 | Soil | NEDEYKMLQFADTVDEAFDHIRGGLEKYHMDVDPFLQTY |
| Ga0210409_111697671 | 3300021559 | Soil | FDNLQYADSVDEAFDKIRMGLEKYHMEGDPFLQAY |
| Ga0126371_107003721 | 3300021560 | Tropical Forest Soil | SSEYKLLKFADTVDEAFNVVRATLEKYHMEVDPFLQTY |
| Ga0242662_103568691 | 3300022533 | Soil | EEEYKMLQFADSVDEAFDHIRAGLEKYHMDVDPFMQAY |
| Ga0242654_102605812 | 3300022726 | Soil | YKMLQFADTVDEAFDHIRAGLEKYHMDADPFLQAY |
| Ga0247668_10831741 | 3300024331 | Soil | INEEEYKMLQFADSVDEAFDHIRAGLEKYHMEVDPFLQAY |
| Ga0207646_105058243 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | AEYKLLQFADNVDDAFDVIRSGLEKYHMEVDPVLQAY |
| Ga0257158_10501942 | 3300026515 | Soil | NENEYKMLQFADTVDEAFDYIRAGLEKYHMDGDPFLQAY |
| Ga0209577_108708521 | 3300026552 | Soil | EAEYKLLQFADNVDDAFEVIRSGLEKYHMEVDPVLQAY |
| Ga0207630_1046822 | 3300026760 | Soil | TINEEEYKMLQFADSVDEAFDHIRAGLEKYHMEVDPFLQAY |
| Ga0207765_1180121 | 3300026819 | Tropical Forest Soil | WGTINQEEYDLLQYADTVAEAFEVIRSGLEKYHMEVDPFLQAY |
| Ga0207766_10134683 | 3300027042 | Tropical Forest Soil | QEEYDLLQYADTVAEAFEVIRSGLEKYHMEVDPFLQAY |
| Ga0209274_105579961 | 3300027853 | Soil | EEYKMLQFADSVDEAFDHIRAGLEKYHMEIDPFLQAY |
| Ga0209693_104331501 | 3300027855 | Soil | NWGTINEEEYKMLQFADSVDEAFDHIRAGLEKYHMEVDPFLQAY |
| Ga0209067_100086781 | 3300027898 | Watersheds | SEYRMLQFADTVDEAFDHIRAGLEKYHMEVDPFLYAY |
| Ga0209488_104015672 | 3300027903 | Vadose Zone Soil | YKLLQFADTVDEAFDRIRAGLEKYHMRGEPFLQAY |
| Ga0222749_100358034 | 3300029636 | Soil | KLKNMVRWGTISQADFDNLQYADSVDEAFDKIRMGLEKYHMEGDPFLQAY |
| Ga0265753_10658452 | 3300030862 | Soil | VNWGTINEDEYKMLQFADSVDEAFDHIRAGLEKYHMEVDPFLQAY |
| Ga0318516_108507172 | 3300031543 | Soil | QNEYDLLQYADTVDEAFEVIRSGLEKYHMEVDPFLQAY |
| Ga0318515_100339755 | 3300031572 | Soil | VRWGMINQEEYDLLKYADNVDEAFEVIRSGLEKYHLEVDPFLQAY |
| Ga0307483_10119561 | 3300031590 | Hardwood Forest Soil | EEYKMLQFADTVDEAFDYIRAGLEKYHMEGEQFLQAY |
| Ga0318572_108511061 | 3300031681 | Soil | TISPSEYGLLKFADTVDDAFEVIRAGLERYHMEVDPFLQAY |
| Ga0307476_110802392 | 3300031715 | Hardwood Forest Soil | EDEYKMLQFADSVDEAFDLIRAGLEKYHMEVDPFLQAY |
| Ga0307469_110981632 | 3300031720 | Hardwood Forest Soil | LNLKAMVRWGTINQNEYNLLQYADTPEEAFNLIRAGLEKYHMEVDPFLQAY |
| Ga0306918_104025513 | 3300031744 | Soil | YDLLKYADNVDEAFEVIRSGLEKYHLEVDPFLQAY |
| Ga0307475_112512381 | 3300031754 | Hardwood Forest Soil | MVDAGTINEEEYKMLQFADSVDEAFDHIRASLEKYHMEVDPFLQAY |
| Ga0318535_100894664 | 3300031764 | Soil | WGMINQEEYDLLKYADNVDEAFEVIRSGLEKYHLEVDPFLQAY |
| Ga0318535_104360261 | 3300031764 | Soil | LRWGTISQEDFDNLQYADSVDEAFEKIRMGLEKYHMQVDPFLQAY |
| Ga0318509_102218301 | 3300031768 | Soil | EEYDLLKYADNVDEAFEVIRSGLEKYHLEVDPFLQAY |
| Ga0307473_109033552 | 3300031820 | Hardwood Forest Soil | QIDYDELQYADNVDEAIEAERSGLEKYHMNVDPFLQAY |
| Ga0318522_101706761 | 3300031894 | Soil | LKGMVRWGMINQEEYDLLKYADNVDEAFEVIRSGLEKYHLEVDPFLQAY |
| Ga0306923_116867362 | 3300031910 | Soil | GTINQEEYDLLQYADNVDEAFEVIRSGLEKYHMEADPILQAY |
| Ga0306921_119868081 | 3300031912 | Soil | TISQIDYDQLQYADNVDEAFEAVRSGLEKYHMDVDPFLQAY |
| Ga0306921_119997501 | 3300031912 | Soil | MVRWGTINQEEYDLLQYADTVAEAFEVIRSGLEKYHMEIDPFLQTY |
| Ga0306926_107496011 | 3300031954 | Soil | FDQLQFADNVDEAFELIRFGLEKYHMEVDPFLQAY |
| Ga0306922_107170961 | 3300032001 | Soil | YDLLQYADTVAEAFEVIRSGLEKYHMEVDPFLQAY |
| Ga0310911_105316411 | 3300032035 | Soil | QEEYDLLQYADTVDEAFEVIRSGLEKYHMEIDPFLQAY |
| Ga0318506_105026832 | 3300032052 | Soil | INQEEYDLLKYADNVDEAFEVIRSGLEKYHLEVDPFLQAY |
| Ga0306924_102612441 | 3300032076 | Soil | GMVRWGMINQEEYDLLKYADNVDEAFEVIRSGLEKYHLEVDPFLQAY |
| Ga0306920_1009173321 | 3300032261 | Soil | VLKLKNMVRWGTISQEDFDNLQYADSVDEAFDKIRMGLEKYHMQVDPFLQAY |
| Ga0335085_105430111 | 3300032770 | Soil | NESEYKLLQFADNVDEAFDIVRSGLEKYHMEVDPFLQAY |
| Ga0335083_102103391 | 3300032954 | Soil | INQQEYEKLEFADTVDEAFDVIRAGLEKYHMQVDPFLQAY |
| Ga0335077_116264411 | 3300033158 | Soil | NEYDLLQYADTVDEAFEVIRSGLEKYHMQVDPFLQAY |
| ⦗Top⦘ |