


| Basic Information | |
|---|---|
| Family ID | F085930 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 111 |
| Average Sequence Length | 42 residues |
| Representative Sequence | GQTPAGSWVDIPPYQGDALVRGSEALSKTKDGRMARTVI |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 111 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.92 % |
| % of genes near scaffold ends (potentially truncated) | 96.40 % |
| % of genes from short scaffolds (< 2000 bps) | 86.49 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.23 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (55.856 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (19.820 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.333 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (64.865 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 8.96% Coil/Unstructured: 91.04% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.23 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 111 Family Scaffolds |
|---|---|---|
| PF00146 | NADHdh | 84.68 |
| PF00499 | Oxidored_q3 | 5.41 |
| PF12838 | Fer4_7 | 2.70 |
| PF00662 | Proton_antipo_N | 1.80 |
| PF00361 | Proton_antipo_M | 1.80 |
| PF07690 | MFS_1 | 0.90 |
| PF00420 | Oxidored_q2 | 0.90 |
| PF02321 | OEP | 0.90 |
| PF00037 | Fer4 | 0.90 |
| COG ID | Name | Functional Category | % Frequency in 111 Family Scaffolds |
|---|---|---|---|
| COG0650 | Formate hydrogenlyase subunit HyfC | Energy production and conversion [C] | 84.68 |
| COG1005 | NADH:ubiquinone oxidoreductase subunit 1 (chain H) | Energy production and conversion [C] | 84.68 |
| COG0839 | NADH:ubiquinone oxidoreductase subunit 6 (chain J) | Energy production and conversion [C] | 5.41 |
| COG1009 | Membrane H+-translocase/NADH:ubiquinone oxidoreductase subunit 5 (chain L)/Multisubunit Na+/H+ antiporter, MnhA subunit | Energy production and conversion [C] | 3.60 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.80 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 55.86 % |
| All Organisms | root | All Organisms | 44.14 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001396|JGI20175J14863_1016072 | Not Available | 1042 | Open in IMG/M |
| 3300001593|JGI12635J15846_10566455 | Not Available | 664 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100432633 | Not Available | 1193 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100809211 | Not Available | 817 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101301761 | Not Available | 618 | Open in IMG/M |
| 3300004080|Ga0062385_10750221 | Not Available | 634 | Open in IMG/M |
| 3300004082|Ga0062384_100374237 | Not Available | 909 | Open in IMG/M |
| 3300004082|Ga0062384_100571328 | Not Available | 761 | Open in IMG/M |
| 3300004152|Ga0062386_101075556 | Not Available | 667 | Open in IMG/M |
| 3300004635|Ga0062388_100983606 | Not Available | 818 | Open in IMG/M |
| 3300004635|Ga0062388_101166747 | Not Available | 760 | Open in IMG/M |
| 3300005712|Ga0070764_10453959 | Not Available | 765 | Open in IMG/M |
| 3300005944|Ga0066788_10153338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 587 | Open in IMG/M |
| 3300005994|Ga0066789_10274146 | Not Available | 707 | Open in IMG/M |
| 3300006050|Ga0075028_100053064 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1957 | Open in IMG/M |
| 3300006050|Ga0075028_100982539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 524 | Open in IMG/M |
| 3300006052|Ga0075029_100714429 | Not Available | 677 | Open in IMG/M |
| 3300006059|Ga0075017_100618150 | Not Available | 829 | Open in IMG/M |
| 3300006162|Ga0075030_100103353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2322 | Open in IMG/M |
| 3300006176|Ga0070765_100953937 | Not Available | 811 | Open in IMG/M |
| 3300006176|Ga0070765_101763852 | Not Available | 581 | Open in IMG/M |
| 3300007819|Ga0104322_144930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales | 3931 | Open in IMG/M |
| 3300009633|Ga0116129_1037484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1567 | Open in IMG/M |
| 3300009633|Ga0116129_1243004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 510 | Open in IMG/M |
| 3300009635|Ga0116117_1067709 | Not Available | 881 | Open in IMG/M |
| 3300012359|Ga0137385_10299414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1384 | Open in IMG/M |
| 3300012362|Ga0137361_10055922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3277 | Open in IMG/M |
| 3300012927|Ga0137416_11930653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 541 | Open in IMG/M |
| 3300014165|Ga0181523_10304969 | Not Available | 899 | Open in IMG/M |
| 3300014495|Ga0182015_10710968 | Not Available | 633 | Open in IMG/M |
| 3300015264|Ga0137403_10067688 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3633 | Open in IMG/M |
| 3300015264|Ga0137403_10276811 | Not Available | 1580 | Open in IMG/M |
| 3300017946|Ga0187879_10513728 | Not Available | 665 | Open in IMG/M |
| 3300017948|Ga0187847_10561090 | Not Available | 636 | Open in IMG/M |
| 3300018038|Ga0187855_10846302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 534 | Open in IMG/M |
| 3300019787|Ga0182031_1041017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300019890|Ga0193728_1176032 | Not Available | 919 | Open in IMG/M |
| 3300020021|Ga0193726_1015222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4014 | Open in IMG/M |
| 3300020579|Ga0210407_11040427 | Not Available | 623 | Open in IMG/M |
| 3300020580|Ga0210403_10915474 | Not Available | 691 | Open in IMG/M |
| 3300020581|Ga0210399_10754846 | Not Available | 797 | Open in IMG/M |
| 3300021168|Ga0210406_10030253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4903 | Open in IMG/M |
| 3300021168|Ga0210406_10251457 | Not Available | 1450 | Open in IMG/M |
| 3300021171|Ga0210405_11369431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 517 | Open in IMG/M |
| 3300021180|Ga0210396_10498527 | Not Available | 1066 | Open in IMG/M |
| 3300021403|Ga0210397_10061096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2444 | Open in IMG/M |
| 3300021404|Ga0210389_10165242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1720 | Open in IMG/M |
| 3300021405|Ga0210387_10644490 | Not Available | 940 | Open in IMG/M |
| 3300021406|Ga0210386_10794772 | Not Available | 813 | Open in IMG/M |
| 3300021406|Ga0210386_11084680 | Not Available | 680 | Open in IMG/M |
| 3300021411|Ga0193709_1034130 | Not Available | 1218 | Open in IMG/M |
| 3300021420|Ga0210394_11559485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 557 | Open in IMG/M |
| 3300021474|Ga0210390_10735416 | Not Available | 820 | Open in IMG/M |
| 3300021477|Ga0210398_10845626 | Not Available | 735 | Open in IMG/M |
| 3300022533|Ga0242662_10142631 | Not Available | 718 | Open in IMG/M |
| 3300024049|Ga0233359_1040077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 548 | Open in IMG/M |
| 3300024251|Ga0247679_1089126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 521 | Open in IMG/M |
| 3300024323|Ga0247666_1028563 | Not Available | 1171 | Open in IMG/M |
| 3300026291|Ga0209890_10242765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 562 | Open in IMG/M |
| 3300026294|Ga0209839_10159830 | Not Available | 740 | Open in IMG/M |
| 3300026489|Ga0257160_1092012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 544 | Open in IMG/M |
| 3300027176|Ga0208992_1044786 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 602 | Open in IMG/M |
| 3300027334|Ga0209529_1033238 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 880 | Open in IMG/M |
| 3300027370|Ga0209010_1013110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1494 | Open in IMG/M |
| 3300027388|Ga0208995_1058486 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 678 | Open in IMG/M |
| 3300027496|Ga0208987_1034515 | Not Available | 893 | Open in IMG/M |
| 3300027559|Ga0209222_1011078 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1827 | Open in IMG/M |
| 3300027567|Ga0209115_1085035 | Not Available | 719 | Open in IMG/M |
| 3300027591|Ga0209733_1140662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 591 | Open in IMG/M |
| 3300027635|Ga0209625_1003039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3688 | Open in IMG/M |
| 3300027660|Ga0209736_1078615 | Not Available | 909 | Open in IMG/M |
| 3300027660|Ga0209736_1172449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 569 | Open in IMG/M |
| 3300027680|Ga0207826_1018024 | All Organisms → cellular organisms → Bacteria | 1937 | Open in IMG/M |
| 3300027701|Ga0209447_10013867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 2299 | Open in IMG/M |
| 3300027727|Ga0209328_10091192 | Not Available | 931 | Open in IMG/M |
| 3300027729|Ga0209248_10102198 | Not Available | 864 | Open in IMG/M |
| 3300027768|Ga0209772_10028437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1613 | Open in IMG/M |
| 3300027812|Ga0209656_10214599 | Not Available | 926 | Open in IMG/M |
| 3300027855|Ga0209693_10112441 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1348 | Open in IMG/M |
| 3300027860|Ga0209611_10743978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 527 | Open in IMG/M |
| 3300027879|Ga0209169_10151290 | Not Available | 1209 | Open in IMG/M |
| 3300027908|Ga0209006_10970218 | Not Available | 678 | Open in IMG/M |
| 3300027908|Ga0209006_11163330 | Not Available | 605 | Open in IMG/M |
| 3300027911|Ga0209698_10108030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2322 | Open in IMG/M |
| 3300028047|Ga0209526_10548494 | Not Available | 747 | Open in IMG/M |
| 3300028047|Ga0209526_10644436 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 673 | Open in IMG/M |
| 3300028762|Ga0302202_10297600 | Not Available | 779 | Open in IMG/M |
| 3300028800|Ga0265338_10491630 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 865 | Open in IMG/M |
| 3300028906|Ga0308309_11283046 | Not Available | 630 | Open in IMG/M |
| 3300028906|Ga0308309_11443825 | Not Available | 589 | Open in IMG/M |
| 3300029911|Ga0311361_10734550 | Not Available | 894 | Open in IMG/M |
| 3300029913|Ga0311362_10527926 | Not Available | 1083 | Open in IMG/M |
| 3300030007|Ga0311338_10785874 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Elateriformia → Elateroidea → Lampyridae → Luciolinae → Abscondita → Abscondita terminalis | 951 | Open in IMG/M |
| 3300030520|Ga0311372_10036860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 9818 | Open in IMG/M |
| 3300030524|Ga0311357_11629978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 542 | Open in IMG/M |
| 3300030580|Ga0311355_11871488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 507 | Open in IMG/M |
| 3300030677|Ga0302317_10461829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 555 | Open in IMG/M |
| 3300030687|Ga0302309_10366305 | Not Available | 704 | Open in IMG/M |
| 3300030878|Ga0265770_1000647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 4832 | Open in IMG/M |
| 3300030923|Ga0138296_1817693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 553 | Open in IMG/M |
| 3300031023|Ga0073998_11686755 | Not Available | 681 | Open in IMG/M |
| 3300031057|Ga0170834_111032549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 539 | Open in IMG/M |
| 3300031474|Ga0170818_105153064 | Not Available | 820 | Open in IMG/M |
| 3300031507|Ga0307509_10728066 | Not Available | 658 | Open in IMG/M |
| 3300031524|Ga0302320_10211411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2753 | Open in IMG/M |
| 3300031524|Ga0302320_10691300 | Not Available | 1161 | Open in IMG/M |
| 3300031708|Ga0310686_100208892 | Not Available | 1215 | Open in IMG/M |
| 3300031788|Ga0302319_10602739 | Not Available | 1143 | Open in IMG/M |
| 3300032756|Ga0315742_13290388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 521 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 19.82% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 18.92% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 9.01% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 6.31% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 5.41% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.41% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.41% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 5.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.50% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 3.60% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.70% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.70% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.70% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.90% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Permafrost Soil | 0.90% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.90% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.90% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.90% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.90% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.90% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.90% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 0.90% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001396 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-072012 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300007819 | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-1-2 Soapdenovo | Environmental | Open in IMG/M |
| 3300009633 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 | Environmental | Open in IMG/M |
| 3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021411 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3c2 | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024049 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-P30 | Environmental | Open in IMG/M |
| 3300024251 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20 | Environmental | Open in IMG/M |
| 3300024323 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07 | Environmental | Open in IMG/M |
| 3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
| 3300027176 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027334 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027370 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027388 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027496 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027559 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027860 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028762 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_3 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030677 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030687 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_1 | Environmental | Open in IMG/M |
| 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030923 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300031023 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil TCEFA (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Host-Associated | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
| 3300032756 | Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined Assembly | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI20175J14863_10160721 | 3300001396 | Arctic Peat Soil | GLWVDIPPYQTDVLVRGSASLSKTKDGLMARAVI* |
| JGI12635J15846_103746642 | 3300001593 | Forest Soil | GVDAGARAAAVGAPGGQAPAGSWVDIPPYQCDALVRGSEALSKTKDGRMARTVI* |
| JGI12635J15846_105664551 | 3300001593 | Forest Soil | IPKGSWVEIPPYQVDLLVRGSEPLQKTKDGRLTRAVI* |
| JGIcombinedJ26739_1004326332 | 3300002245 | Forest Soil | VAMPNGRVPTGSWVDIPPYQSDVLVRGSDALQKTKDGRMTRSVI* |
| JGIcombinedJ26739_1008092112 | 3300002245 | Forest Soil | ASAGAWVDIPPYQGDVLVRGSESLAKTKEGREARAVL* |
| JGIcombinedJ26739_1013017611 | 3300002245 | Forest Soil | MPNGQTPSGPWVDIPPYQSDALVRGSEALSKTKDGRMARTVI* |
| Ga0062385_107502211 | 3300004080 | Bog Forest Soil | EASSLALDGRVAVMPNGHAPAGSWVDIPPYQSDMLVRGSEALSKTKDGRMARTVI* |
| Ga0062384_1003742371 | 3300004082 | Bog Forest Soil | EAASAGGGPMPNGETPKGSWLEIPPYQCDVLVRGSEPLQKTKDGRATRAVI* |
| Ga0062384_1005713281 | 3300004082 | Bog Forest Soil | AVMPTGQTPAGSWVDIPPYQSDALVRGSEALSKTKDGRMTRTVI* |
| Ga0062386_1010755562 | 3300004152 | Bog Forest Soil | GQIPKGVWVDIPPYQNDVLVRGSDALAKTKDGRLTRSVL* |
| Ga0062388_1009836062 | 3300004635 | Bog Forest Soil | VPNGQTPQGSWVDIPPYQGDALVRGSEALAKTKDGRMARAVI* |
| Ga0062388_1011667472 | 3300004635 | Bog Forest Soil | MPNGAAPTGSWVDIPPYQSDVLVRGSEPLQKTKDGRMTRSVI* |
| Ga0070764_104539591 | 3300005712 | Soil | AGGGPMPNGEIPKGSWVEIPPYQCDVLVRGSEPLQKTKDGRATRAVI* |
| Ga0066788_101533381 | 3300005944 | Soil | GATVGAMPNGEIPKGAWVNIPPYQADVLVRGSEPLQKTKDGRLTRAVL* |
| Ga0066789_102741462 | 3300005994 | Soil | RVAAPCSGIGAAVMPEGPKPAGSWVDIPPYQCDALVRGSEALAKTKDGRMARTVI* |
| Ga0075028_1000530641 | 3300006050 | Watersheds | SGAGAPVMPEGDSPAGAWVDIPPYQCDALVRGSEALSKTKDGRMTRSLI* |
| Ga0075028_1009825392 | 3300006050 | Watersheds | PKGEAPSGAWVDIPPYQGDALVRGSEALSKTKDGRLARTVI* |
| Ga0075029_1007144291 | 3300006052 | Watersheds | RSAATPGRWVDIPPYQVDVLVRGSEALSKTKDGRVARVVL* |
| Ga0075017_1006181502 | 3300006059 | Watersheds | SVNGEAPSGAWVDIPPYQGDVLVRGSEALGKTKDGRLARAVI* |
| Ga0075030_1001033531 | 3300006162 | Watersheds | PWTELPPYQVDALVRGSEALSKTSDGRLARAVIAP* |
| Ga0070765_1009539372 | 3300006176 | Soil | GAGPNGETPKGSWVDIPPYQGDLLVRGSEPLQKTKDGRLTRAVI* |
| Ga0070765_1017638521 | 3300006176 | Soil | RPPGSWVDIPPYQSDALVRGSEALAKTKDGRLARTVI* |
| Ga0104322_1449306 | 3300007819 | Permafrost Soil | PTGSWVDIPPYQSDVLVRGSEALQKTKDGRLTRSVI* |
| Ga0116129_10374843 | 3300009633 | Peatland | RAAAGGAIPNGEIPKGSWVEIPPYQTDLLVRGSEPLQKTKDGRLTRAVL* |
| Ga0116129_12430041 | 3300009633 | Peatland | TRAAVSTPDGQAPAGSWVDIPPYQSDALVRGSEALSKTKDGRMARTVI* |
| Ga0116117_10677092 | 3300009635 | Peatland | SGQWVDIPPYQIDVLVRGSESLAKTKDGQAARAVL* |
| Ga0137385_102994141 | 3300012359 | Vadose Zone Soil | PGSWVDIPPYQSDALVRGSEALSKTKDGRMTRTVI* |
| Ga0137361_100559221 | 3300012362 | Vadose Zone Soil | QTLEQRPPGSWVDIPPYQVDALVRGSEALSKTKDGRLARTVI* |
| Ga0137416_119306532 | 3300012927 | Vadose Zone Soil | GQTPAGSWVDIPPYQGDALVRGSEALSKTKDGRMARTVI* |
| Ga0181523_103049691 | 3300014165 | Bog | PPGAAGPWVDIPPYQIDVLVRGSTSLGKTKDGLMVRAVI* |
| Ga0182015_107109682 | 3300014495 | Palsa | AAGPWVDVPPYQVDVLVRGSDALSKTLDGRMARSVI* |
| Ga0137403_100676881 | 3300015264 | Vadose Zone Soil | TGSWVDIPPYQSDALVRGSEALQKTKDGRMTRTVI* |
| Ga0137403_102768111 | 3300015264 | Vadose Zone Soil | AARATPAAMPNGQVPTGSWVDIPPYQSDTLVRGSEPLQKTKDGRMTRSVI* |
| Ga0187879_105137282 | 3300017946 | Peatland | PSGRWVDIPPYQGDVLVRGSEALAKTKDGHVTRDVI |
| Ga0187847_105610901 | 3300017948 | Peatland | ANGTGARSPPGRWVDIPPYQGDVLVRGSEALSKTKDGYVTRDVI |
| Ga0187855_108463021 | 3300018038 | Peatland | GAAAAASPGAWVDIPPYQVDVLVRGSESLAKTKDGHMSRAVL |
| Ga0182031_10410172 | 3300019787 | Bog | RGGRGDGAAGIPEDAPTGAWLDIPPYQSDALVRGSEALSKTKDGRMTRTVI |
| Ga0193728_11760321 | 3300019890 | Soil | GAETSGPWIDIPPYQVDALVRGSEALGKTKDGRLARDVI |
| Ga0193726_10152226 | 3300020021 | Soil | APAGGAIPNGQVPAGSWVDIPPYQSDVLVRGAEALQKTKDGRLARSVI |
| Ga0210407_110404271 | 3300020579 | Soil | VDGIGSAAAPAPGPWVDIPPYQGDTLVRGSESLAKTKDGHLARAVL |
| Ga0210403_109154741 | 3300020580 | Soil | PGSWVDIPPYQSDALVRGSEALSKTKDGRLARTVL |
| Ga0210399_107548462 | 3300020581 | Soil | GENPQGSWVDIPPYQTDVLVRGSEPLQKTKDGRLTRAVI |
| Ga0210406_100302537 | 3300021168 | Soil | TLGAIPNGEIPKGSWVDIPPYQTDVLVRGSEPLQKTKDGRLTRAVI |
| Ga0210406_102514571 | 3300021168 | Soil | SVTNGQRPPGSWVDIPPYQSDALVRGSEALAKTKDGRLARTVI |
| Ga0210405_113694312 | 3300021171 | Soil | PPGSWVDIPPYQSDALVRGSEALAKTKDGRLARTVI |
| Ga0210396_104985271 | 3300021180 | Soil | AAGAWVDIPPYQVDVLVRGSESLAKTKDGHMSRTVL |
| Ga0210397_100610961 | 3300021403 | Soil | VGGAMPNGEIPKGSWVEIPPYQTDLLVRGSEPLQKTKDGRLTRAVL |
| Ga0210389_101652423 | 3300021404 | Soil | AGPWVDIPPYQSDALVRGSEPLSKTKDGRMSRTVI |
| Ga0210387_106444902 | 3300021405 | Soil | GEIPKGPWVEIPPYQTDLLVRGSEPLQKTKDGRLTRAVL |
| Ga0210386_107947722 | 3300021406 | Soil | AAAGGAMPNGEIPKGSWVEIPPYQTDLLVRGSEPLQKTKDGRLTRAVL |
| Ga0210386_110846802 | 3300021406 | Soil | DPGARMAVSTPDGQAPAGSWVDIPPYQSDVLVRGSEALSKTKDGRMARTVI |
| Ga0193709_10341302 | 3300021411 | Soil | AMPAAMPNGQVPTGSWVDIPPYQSDVLVRGSEALQKTKDGRMTRSVI |
| Ga0210394_115594852 | 3300021420 | Soil | GQTPSGPWVDIPPYQSDALVRGSEALSKTKDGRMARTVI |
| Ga0210390_107354161 | 3300021474 | Soil | AAATSSGVGAAAMPEEPKPVGSWVDIPPYQCDALVRGSEALAKTKDGRMTRTVI |
| Ga0210398_108456261 | 3300021477 | Soil | SRAAVSTSDGQAPSGAWVDVPPYQADALVRGSEALSKTKDGRMARTVI |
| Ga0242662_101426312 | 3300022533 | Soil | RIEPSVAPARAMPNGQVPTGSWVDIPPYQSDVLVRGSEALQKTKDGRLTRSVI |
| Ga0233359_10400771 | 3300024049 | Soil | AMPNGQVPTGSWVDIPPYQSDVLVRGSEALQKTKDGRMTRSVI |
| Ga0247679_10891261 | 3300024251 | Soil | GAVPAGAWLDIPPYQSDALVRGSEALSKTKDGRMSRTVI |
| Ga0247666_10285631 | 3300024323 | Soil | SRWDGASGTPAAVPQGAVPAGAWLDIPPYQSDALVRGSEALSKTKDGRMSRTVI |
| Ga0209890_102427652 | 3300026291 | Soil | PQGPVPAGAWVDIPPYQSDALVRGSEALSKTKDGRMTRAVI |
| Ga0209839_101598301 | 3300026294 | Soil | FLGGAAPSGRWVDIPPYQGDVLVRGSEALGKTKDGHVTRDVI |
| Ga0257160_10920122 | 3300026489 | Soil | QRPPGSWVDIPPYQSDALVRGSEALSKTKDGRLARTVV |
| Ga0208992_10447862 | 3300027176 | Forest Soil | LAAIGSWVDIPPYQSDVLVRGSEALQKTKDGRLTRTVI |
| Ga0209529_10332381 | 3300027334 | Forest Soil | NGEIPKGSWVEIPPYQVDLLVRGSEPLQKTKDGRLTRAVL |
| Ga0209010_10131101 | 3300027370 | Forest Soil | QTPLGAWLDIPPYQSDVLVRGSDALAKTKDGRLTRSVL |
| Ga0208995_10584861 | 3300027388 | Forest Soil | SGVAAAGGPVSIPNGQTPPGSWVDIPPYQSDALVRGSEALSKTKDGRMARTVI |
| Ga0208987_10345152 | 3300027496 | Forest Soil | PVGPWVDIPPYQSDTLVRGSEPLSKTKDGRMSRTVI |
| Ga0209222_10110781 | 3300027559 | Forest Soil | APAGSWVDIPPYQSDALVRGSEALSKTKDGRMPRTVI |
| Ga0209115_10850352 | 3300027567 | Forest Soil | GNASAGAWVDIPPYQGDVLVRGSESLAKTKEGREARAVL |
| Ga0209733_11406622 | 3300027591 | Forest Soil | GAGAAVIPSGQKPAGSWVDIPPYQCDALVRGSEALSKTKDGRMARTVI |
| Ga0209625_10030391 | 3300027635 | Forest Soil | APARAMPNGQVPTGSWVDIPPYQSDVLVRGSEALQKTKDGRLTRSVI |
| Ga0209736_10786152 | 3300027660 | Forest Soil | NGQMPKGVWVDIPPYQVDVLVRGSEPLQKTKDGRMTRTVI |
| Ga0209736_11724492 | 3300027660 | Forest Soil | NGGAEPSGPWIDIPPYQVDVLVRGSEALGKTRDGRLARDVI |
| Ga0207826_10180241 | 3300027680 | Tropical Forest Soil | GAIPNGEIPKGSWVDIPLYQTDVLVRGSEPLQKTKDGRMTRSEI |
| Ga0209447_100138671 | 3300027701 | Bog Forest Soil | GETPQGAWLDIPPYQSDVLVRGSDALAKTKDGRLTRSVL |
| Ga0209328_100911922 | 3300027727 | Forest Soil | VSIPNGRTPPGSWVDIPPYQSDVLVRGSEALSKTKDGRMARTVI |
| Ga0209248_101021982 | 3300027729 | Bog Forest Soil | KGSWVDIPPYQSDVLVRGSDALAKTKDGRLTRTVL |
| Ga0209772_100284371 | 3300027768 | Bog Forest Soil | SVLRGAIPDGQTPQGAWLDIPPYQSDVLVRGSDALAKTKDGRLTRSVL |
| Ga0209656_102145992 | 3300027812 | Bog Forest Soil | GVAGRGAAASGPWVDIPPYQIDILVRGSESLAKTKDGRTARTVL |
| Ga0209693_101124413 | 3300027855 | Soil | VSTLDGQAPAGSWVDIPPYQSDALVRGSEALSKTKDGRMARTVI |
| Ga0209611_107439782 | 3300027860 | Host-Associated | EGSWVDVPPYQIDALVRGSDALSRTKDGRMVRTVI |
| Ga0209169_101512901 | 3300027879 | Soil | TPGGSWVDIPPYQGEVLVRGSEPLQKTKDGRMTRSVI |
| Ga0209488_106934882 | 3300027903 | Vadose Zone Soil | SNGVAAAGAVSTANGQTPAGSWVDIPPYQSDALVRGSEALSKTKDGRMARTVI |
| Ga0209006_109702182 | 3300027908 | Forest Soil | EGAAGAAAVAWVDIPPYQVDVLVRGSESLAKTKDGHMSRAVL |
| Ga0209006_111633301 | 3300027908 | Forest Soil | LPEGETPVGTWVDIPPYQCDALVRGSEALSKTKDGRMTRTVI |
| Ga0209698_101080304 | 3300027911 | Watersheds | PWTELPPYQVDALVRGSEALSKTSDGRLARAVIAP |
| Ga0209526_105484941 | 3300028047 | Forest Soil | PNGQTPPGSWVDIPPYQSDALVRGSEALSKTKDGRMARTVI |
| Ga0209526_106444361 | 3300028047 | Forest Soil | TGVWVDIPPYQTDVLVRGSEPLQKTKDGRMTRTVI |
| Ga0302202_102976001 | 3300028762 | Bog | AGPWIDVPPYQGDALVRGSQALGKTRDGQLARVVL |
| Ga0265338_104916302 | 3300028800 | Rhizosphere | VIQGASWLDIPPYQTDPLVRGSEALSKTKDGRMTRTVI |
| Ga0308309_112830461 | 3300028906 | Soil | GAAERGAPGAWVDIPPYQGDALVRGSEALAKTKDGRLARSGV |
| Ga0308309_114438252 | 3300028906 | Soil | RPPGSWVDIPPYQSDALVRGSEALAKTKDGRLARTVI |
| Ga0311361_107345501 | 3300029911 | Bog | PVCHLPWVLLPPYQGDVLVRGSDALAKTVDGQAARTVI |
| Ga0311362_105279262 | 3300029913 | Bog | AVPEGAAAAAPWVDIPPYQCDVLVRGSEALSKTKDGRLTRTVL |
| Ga0311338_107858741 | 3300030007 | Palsa | AGAWVDIPAYQVDMLVRGSESLSKTKDGRDARAVL |
| Ga0311372_100368601 | 3300030520 | Palsa | LNGAAPVAGQWVDIPIYQGDVLVRGSEALGKTKDGHAARNVI |
| Ga0311357_116299781 | 3300030524 | Palsa | APASPGEWVDIPPYQVDMLVRGSESLAKTKDGHMSRAVF |
| Ga0311355_118714882 | 3300030580 | Palsa | GRAAVMPNGQTPTGSWVDIPPYQSDVLVRGSEALSKTKDGRMARTVI |
| Ga0302317_104618291 | 3300030677 | Palsa | PAGNKPAGDWLDIPPYQGDVLVRGSEALAKTKDGRVARTVF |
| Ga0302309_103663052 | 3300030687 | Palsa | IPKGSWVEIPPYQGDLLVRGSEPLQKTKDGRLTRAVI |
| Ga0265770_10006471 | 3300030878 | Soil | GGAMPNGEIPKGSWVEIPPYQGDLLVRGSEPLQKTKDGRLTRAVL |
| Ga0138296_18176931 | 3300030923 | Soil | EASGPWIDIPPYQVDALVRGSEALGKTKDGRMARDVI |
| Ga0073998_116867551 | 3300031023 | Soil | PTGSWVDIPPYQSDVLVRGSEALQKTKDGRLTRSVI |
| Ga0170834_1110325492 | 3300031057 | Forest Soil | GGAMPNGETPQGAWVEIPPYQTDLLVRGSEPLQKTKDGRLTRAVL |
| Ga0170818_1051530642 | 3300031474 | Forest Soil | AAGGGGASPAAPWVDIPPYQVDALVRGSEALSKTKDGRMTRTVI |
| Ga0307509_107280662 | 3300031507 | Ectomycorrhiza | AGTPAAVPQGAVPAGAWVDIPPYQSDALVRGSEALSKTKDGRMARAVI |
| Ga0302320_102114111 | 3300031524 | Bog | PLLPWIDVPLYQSDALVRRSEALAKTKDGQAARTVI |
| Ga0302320_106913002 | 3300031524 | Bog | SPAGSWVDIPPYQGDALVRGSEALSKTKDGRMTRTVI |
| Ga0310686_1002088922 | 3300031708 | Soil | KPAESWLDIPPYQGDVLVRGSEALAKTKDGRVARAVF |
| Ga0302319_106027392 | 3300031788 | Bog | PGGSWLDIPPYQGDVLVRGSEALAKTKDGRAARTVF |
| Ga0315742_132903881 | 3300032756 | Forest Soil | ARVAAGGAIPNGAIPTGSWVDIPPYQSDVLVRGSEPLQKTKDGRMNRSVI |
| ⦗Top⦘ |