


| Basic Information | |
|---|---|
| Family ID | F085911 |
| Family Type | Metagenome |
| Number of Sequences | 111 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MWASGHNGDIKRAAHGYEATREAAMAAFAKSWRRE |
| Number of Associated Samples | 61 |
| Number of Associated Scaffolds | 111 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 42.45 % |
| % of genes near scaffold ends (potentially truncated) | 45.95 % |
| % of genes from short scaffolds (< 2000 bps) | 86.49 % |
| Associated GOLD sequencing projects | 58 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (54.054 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (22.523 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.333 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (45.045 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.03% β-sheet: 0.00% Coil/Unstructured: 53.97% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 111 Family Scaffolds |
|---|---|---|
| PF04392 | ABC_sub_bind | 2.70 |
| PF14279 | HNH_5 | 1.80 |
| PF11185 | DUF2971 | 1.80 |
| PF03401 | TctC | 0.90 |
| PF04120 | Iron_permease | 0.90 |
| PF06411 | HdeA | 0.90 |
| PF12787 | EcsC | 0.90 |
| PF14232 | DUF4334 | 0.90 |
| PF00027 | cNMP_binding | 0.90 |
| PF00111 | Fer2 | 0.90 |
| PF01300 | Sua5_yciO_yrdC | 0.90 |
| PF00589 | Phage_integrase | 0.90 |
| PF02265 | S1-P1_nuclease | 0.90 |
| PF13414 | TPR_11 | 0.90 |
| PF00313 | CSD | 0.90 |
| PF01381 | HTH_3 | 0.90 |
| PF01594 | AI-2E_transport | 0.90 |
| PF13192 | Thioredoxin_3 | 0.90 |
| PF03869 | Arc | 0.90 |
| PF13751 | DDE_Tnp_1_6 | 0.90 |
| PF05036 | SPOR | 0.90 |
| PF01266 | DAO | 0.90 |
| PF13557 | Phenol_MetA_deg | 0.90 |
| PF07396 | Porin_O_P | 0.90 |
| PF03466 | LysR_substrate | 0.90 |
| PF06114 | Peptidase_M78 | 0.90 |
| PF12244 | DUF3606 | 0.90 |
| COG ID | Name | Functional Category | % Frequency in 111 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 2.70 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.90 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.90 |
| COG3746 | Phosphate-selective porin | Inorganic ion transport and metabolism [P] | 0.90 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 54.05 % |
| All Organisms | root | All Organisms | 45.95 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2035918004|FACENC_F56XM5W01EUEEG | Not Available | 517 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100460863 | Not Available | 537 | Open in IMG/M |
| 3300000955|JGI1027J12803_104961284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1792 | Open in IMG/M |
| 3300002568|C688J35102_120863317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1881 | Open in IMG/M |
| 3300005093|Ga0062594_101626467 | Not Available | 670 | Open in IMG/M |
| 3300005332|Ga0066388_103600825 | Not Available | 791 | Open in IMG/M |
| 3300005332|Ga0066388_103820881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 768 | Open in IMG/M |
| 3300005544|Ga0070686_100448392 | Not Available | 991 | Open in IMG/M |
| 3300005713|Ga0066905_100079858 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2145 | Open in IMG/M |
| 3300005713|Ga0066905_100294148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1271 | Open in IMG/M |
| 3300005713|Ga0066905_100576864 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 948 | Open in IMG/M |
| 3300005713|Ga0066905_100633395 | Not Available | 909 | Open in IMG/M |
| 3300005713|Ga0066905_100713918 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300005713|Ga0066905_100817453 | Not Available | 809 | Open in IMG/M |
| 3300005713|Ga0066905_101695920 | Not Available | 580 | Open in IMG/M |
| 3300005713|Ga0066905_101978964 | Not Available | 540 | Open in IMG/M |
| 3300005764|Ga0066903_100137937 | All Organisms → cellular organisms → Bacteria | 3457 | Open in IMG/M |
| 3300005764|Ga0066903_102112649 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
| 3300005764|Ga0066903_102195906 | Not Available | 1064 | Open in IMG/M |
| 3300005764|Ga0066903_102472686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1005 | Open in IMG/M |
| 3300005764|Ga0066903_108514436 | Not Available | 523 | Open in IMG/M |
| 3300005764|Ga0066903_108751021 | Not Available | 514 | Open in IMG/M |
| 3300005764|Ga0066903_108863689 | Not Available | 510 | Open in IMG/M |
| 3300005937|Ga0081455_10003645 | All Organisms → cellular organisms → Bacteria | 17644 | Open in IMG/M |
| 3300005937|Ga0081455_10018692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6582 | Open in IMG/M |
| 3300005937|Ga0081455_10077784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2728 | Open in IMG/M |
| 3300005937|Ga0081455_10477852 | Not Available | 844 | Open in IMG/M |
| 3300005937|Ga0081455_10625877 | Not Available | 697 | Open in IMG/M |
| 3300005937|Ga0081455_10746606 | Not Available | 619 | Open in IMG/M |
| 3300006038|Ga0075365_10405123 | Not Available | 963 | Open in IMG/M |
| 3300006051|Ga0075364_10096056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1971 | Open in IMG/M |
| 3300006051|Ga0075364_10303055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1088 | Open in IMG/M |
| 3300006177|Ga0075362_10171479 | Not Available | 1048 | Open in IMG/M |
| 3300006844|Ga0075428_100833262 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| 3300006844|Ga0075428_100876097 | Not Available | 953 | Open in IMG/M |
| 3300006844|Ga0075428_102085509 | Not Available | 587 | Open in IMG/M |
| 3300006844|Ga0075428_102254291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 561 | Open in IMG/M |
| 3300006845|Ga0075421_100939264 | Not Available | 984 | Open in IMG/M |
| 3300006845|Ga0075421_101952357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 627 | Open in IMG/M |
| 3300006845|Ga0075421_101962140 | Not Available | 625 | Open in IMG/M |
| 3300006846|Ga0075430_100948254 | Not Available | 709 | Open in IMG/M |
| 3300006846|Ga0075430_101521576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseicella → Roseicella frigidaeris | 550 | Open in IMG/M |
| 3300006846|Ga0075430_101646345 | Not Available | 527 | Open in IMG/M |
| 3300006847|Ga0075431_100457834 | Not Available | 1271 | Open in IMG/M |
| 3300006847|Ga0075431_100702692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 989 | Open in IMG/M |
| 3300006847|Ga0075431_101196731 | Not Available | 723 | Open in IMG/M |
| 3300006847|Ga0075431_101519604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 628 | Open in IMG/M |
| 3300006853|Ga0075420_100512895 | Not Available | 1036 | Open in IMG/M |
| 3300006880|Ga0075429_100763625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 847 | Open in IMG/M |
| 3300006880|Ga0075429_101427689 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300009100|Ga0075418_10813934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1009 | Open in IMG/M |
| 3300009147|Ga0114129_10980875 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300009147|Ga0114129_11032675 | Not Available | 1033 | Open in IMG/M |
| 3300009147|Ga0114129_13411442 | Not Available | 511 | Open in IMG/M |
| 3300009156|Ga0111538_10320551 | Not Available | 1962 | Open in IMG/M |
| 3300009162|Ga0075423_12300047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 586 | Open in IMG/M |
| 3300009792|Ga0126374_10812561 | Not Available | 716 | Open in IMG/M |
| 3300010043|Ga0126380_11544433 | Not Available | 590 | Open in IMG/M |
| 3300010046|Ga0126384_10651241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium erdmanii | 928 | Open in IMG/M |
| 3300010046|Ga0126384_11270944 | Not Available | 681 | Open in IMG/M |
| 3300010047|Ga0126382_10683711 | Not Available | 858 | Open in IMG/M |
| 3300010047|Ga0126382_11941511 | Not Available | 558 | Open in IMG/M |
| 3300010362|Ga0126377_13409589 | Not Available | 514 | Open in IMG/M |
| 3300010366|Ga0126379_10556301 | Not Available | 1227 | Open in IMG/M |
| 3300010366|Ga0126379_13534891 | Not Available | 523 | Open in IMG/M |
| 3300010398|Ga0126383_10941871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 951 | Open in IMG/M |
| 3300010398|Ga0126383_12790869 | Not Available | 570 | Open in IMG/M |
| 3300012204|Ga0137374_10106772 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2620 | Open in IMG/M |
| 3300012209|Ga0137379_10225350 | All Organisms → cellular organisms → Bacteria | 1789 | Open in IMG/M |
| 3300012356|Ga0137371_10777838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 730 | Open in IMG/M |
| 3300012948|Ga0126375_11471957 | Not Available | 581 | Open in IMG/M |
| 3300012948|Ga0126375_11661452 | Not Available | 552 | Open in IMG/M |
| 3300014969|Ga0157376_11167046 | Not Available | 797 | Open in IMG/M |
| 3300015371|Ga0132258_11522439 | Not Available | 1689 | Open in IMG/M |
| 3300015371|Ga0132258_11547295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1675 | Open in IMG/M |
| 3300015372|Ga0132256_101154984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 888 | Open in IMG/M |
| 3300015372|Ga0132256_103794749 | Not Available | 508 | Open in IMG/M |
| 3300015373|Ga0132257_101279879 | Not Available | 930 | Open in IMG/M |
| 3300015373|Ga0132257_101789982 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 789 | Open in IMG/M |
| 3300015373|Ga0132257_101957235 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300015374|Ga0132255_103535268 | Not Available | 665 | Open in IMG/M |
| 3300015374|Ga0132255_103717527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 648 | Open in IMG/M |
| 3300015374|Ga0132255_105596466 | Not Available | 532 | Open in IMG/M |
| 3300016294|Ga0182041_10714004 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300016404|Ga0182037_10296742 | All Organisms → cellular organisms → Bacteria | 1297 | Open in IMG/M |
| 3300021510|Ga0222621_1110393 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300027646|Ga0209466_1098763 | Not Available | 591 | Open in IMG/M |
| 3300027748|Ga0209689_1030976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3183 | Open in IMG/M |
| 3300027909|Ga0209382_11120037 | Not Available | 811 | Open in IMG/M |
| 3300027909|Ga0209382_11222146 | Not Available | 767 | Open in IMG/M |
| 3300028784|Ga0307282_10325882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCBAU 15635 | 741 | Open in IMG/M |
| 3300028796|Ga0307287_10274034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCBAU 15635 | 638 | Open in IMG/M |
| 3300028814|Ga0307302_10171274 | Not Available | 1055 | Open in IMG/M |
| 3300028814|Ga0307302_10191164 | Not Available | 998 | Open in IMG/M |
| 3300031184|Ga0307499_10217581 | Not Available | 595 | Open in IMG/M |
| 3300031573|Ga0310915_10062074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2440 | Open in IMG/M |
| 3300031573|Ga0310915_10077300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 2206 | Open in IMG/M |
| 3300031573|Ga0310915_10375199 | Not Available | 1009 | Open in IMG/M |
| 3300031679|Ga0318561_10739056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 541 | Open in IMG/M |
| 3300031747|Ga0318502_11035301 | Not Available | 501 | Open in IMG/M |
| 3300031748|Ga0318492_10357509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 765 | Open in IMG/M |
| 3300031765|Ga0318554_10332197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 864 | Open in IMG/M |
| 3300031910|Ga0306923_10125167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2920 | Open in IMG/M |
| 3300031941|Ga0310912_10257078 | All Organisms → cellular organisms → Bacteria | 1345 | Open in IMG/M |
| 3300031942|Ga0310916_10391749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1182 | Open in IMG/M |
| 3300031959|Ga0318530_10471209 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 521 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 22.52% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 18.02% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.81% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 7.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.41% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 5.41% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 3.60% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.70% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.80% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.90% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.90% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2035918004 | Soil microbial communities from sample at FACE Site 2 North Carolina CO2- | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006051 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Host-Associated | Open in IMG/M |
| 3300006177 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300021510 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FACENCA_2759600 | 2035918004 | Soil | MMWASGHNGEIKRAAHGYEPTREAAMAAFAKSWRRELKA |
| INPhiseqgaiiFebDRAFT_1004608632 | 3300000364 | Soil | MWASGHNADIKRAAHGYEATREAGTAAFAKXWRRG* |
| JGI1027J12803_1049612848 | 3300000955 | Soil | WMWASGHNGDIRRAAHGYEATREQAMAAFKRSWHREG* |
| C688J35102_1208633173 | 3300002568 | Soil | MWASGHSADSIKRAAHGYEPTREAAMAVFAKSWRRCQPPIE* |
| Ga0062594_1016264672 | 3300005093 | Soil | ASGHSADSIKRAAHGYEPTREAAMAVFAKSWRRCQPPIE* |
| Ga0066388_1036008252 | 3300005332 | Tropical Forest Soil | PEGRPWMWASGHGGHHIERAAHGYEATREAAMTAFAKSWGRQ* |
| Ga0066388_1038208812 | 3300005332 | Tropical Forest Soil | SDRPWMWASGHNGDFRRVAHGYESTCEAAMEAFARSWQRD* |
| Ga0070686_1004483921 | 3300005544 | Switchgrass Rhizosphere | MWASGHSADSIKRATHGYEPTREQAMAAFAKSWRRCQPPIE* |
| Ga0066905_1000798585 | 3300005713 | Tropical Forest Soil | MWASGHSADSVKRAAHGYEATREAAMAAFAKSWRRE* |
| Ga0066905_1002941482 | 3300005713 | Tropical Forest Soil | LDVASGHNGDIKRAAYGYEPTREDAMAAFAKSWRRE* |
| Ga0066905_1005768643 | 3300005713 | Tropical Forest Soil | MWASGHNGEIRRAAHGNESTREAAMKAFAKSWRRE* |
| Ga0066905_1006333953 | 3300005713 | Tropical Forest Soil | MMRGLDVGGGHGGHIKRAAHGYEATREAAMAAFAKSWRRR* |
| Ga0066905_1007139181 | 3300005713 | Tropical Forest Soil | WMWASGHNGDIKRAACGYEETREVAMAAFAKSWRREI* |
| Ga0066905_1008174532 | 3300005713 | Tropical Forest Soil | MWASGHSADSVKRAAHGYEATREAAMAAFAKSWRRD* |
| Ga0066905_1016959201 | 3300005713 | Tropical Forest Soil | MWASGHGGHHIERAAHGYEATREAAMAAFAKSWPRE* |
| Ga0066905_1019789641 | 3300005713 | Tropical Forest Soil | WASGHGGHIKRAAHGYEPTREAAMEAFAKSWRCERPKERSPV* |
| Ga0066903_1001379373 | 3300005764 | Tropical Forest Soil | MWASGHSADSIERAAHGYEATREAAIAAFAKSYSPR* |
| Ga0066903_1021126495 | 3300005764 | Tropical Forest Soil | MWASGHNGDFSRVAHGHAPTREDALAAFAKSWRRV* |
| Ga0066903_1021959062 | 3300005764 | Tropical Forest Soil | MWASGHDGDIKRAAYGYEATREAAMAAFAKSWHGS* |
| Ga0066903_1024726863 | 3300005764 | Tropical Forest Soil | MWASGHGGHIERAAHGYEATREAGMAAFAKSWRRKPG |
| Ga0066903_1042768111 | 3300005764 | Tropical Forest Soil | MWASGHGGHVKRAAHGYEPTREAAMAAFARAGGRS |
| Ga0066903_1046219621 | 3300005764 | Tropical Forest Soil | ARGVGEHNGHGDIKRAAHGYEATREAAMAAFANSWRRE* |
| Ga0066903_1085144362 | 3300005764 | Tropical Forest Soil | MWASGHSAATIKRAAHGYEPKREAAMAAFAKSWRRQLQD* |
| Ga0066903_1087510212 | 3300005764 | Tropical Forest Soil | MWASGHNGDIKRAARGYEPTREAAMAAFAKSWRRGGALG* |
| Ga0066903_1088636892 | 3300005764 | Tropical Forest Soil | LEWASGHNGDIKRAAHGYETREAATAAFAKSWRRGGALG* |
| Ga0081455_1000364533 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MWASGHNGQIARAHGYEPTREAAMAAFAKSWRGWELAKAGR* |
| Ga0081455_100186928 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MWASGHNGDIKRAAHGYEPTREAAMAAFAKSWRK* |
| Ga0081455_100777842 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MWASGHDGQIRRAAHGYEPTRAAAMAAFAKSWRGK* |
| Ga0081455_104778523 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MRASGHNGDIKRAAHGYEATREAAMAAFAKSWRRS* |
| Ga0081455_106258772 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MDFRNSELRRAAHGYEATREAAMAAFAKSWRRGYG* |
| Ga0081455_107466062 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MWASGHSAATVKRAAHGYEATREAAMAAFAESWRRS |
| Ga0075365_104051232 | 3300006038 | Populus Endosphere | MLWASGHNGDIRRTAHGYEPTREAAMAAFAKNWRRQ* |
| Ga0075364_100960561 | 3300006051 | Populus Endosphere | MWASGHSAATVKRAAHGYERTREAAMAAFAKSWRRS* |
| Ga0075364_103030553 | 3300006051 | Populus Endosphere | PQERARMWASGHNGDIPCAALGDEPTREAAMAAFAKSRRRE* |
| Ga0075362_101714792 | 3300006177 | Populus Endosphere | MRASGHSADSVSRAAHGYEPTREAAMAAFAKSWRRA* |
| Ga0075428_1008332622 | 3300006844 | Populus Rhizosphere | PQDRHWMWASGHNGQIRGAAHGYEATREAAMAAFAKSWRME* |
| Ga0075428_1008760972 | 3300006844 | Populus Rhizosphere | MWASGHSAATVKRAAHGYEPTREAAMAAFAKSWRR |
| Ga0075428_1020855091 | 3300006844 | Populus Rhizosphere | MDVGDGHSAATVERAAHGYEPTREAAMAAFAKSWR |
| Ga0075428_1022542912 | 3300006844 | Populus Rhizosphere | GRSWKWASGHNGDYRRAAHGYEPTRESAMAAFAKSWRRSTP* |
| Ga0075421_1009392641 | 3300006845 | Populus Rhizosphere | MTEGGQVWASGHSAAMVKRAAHGYEPTREAVMAAFAKSRRRE |
| Ga0075421_1019523571 | 3300006845 | Populus Rhizosphere | RPWMWASGHSAATVKRAAHGYEATREAAMAAFAKSWRGE* |
| Ga0075421_1019621401 | 3300006845 | Populus Rhizosphere | MWSSGHSGEIRRAAHGYETTREAAMAAFAKSWRRE* |
| Ga0075430_1009482542 | 3300006846 | Populus Rhizosphere | MWASGHNGDIKRAAYGYEPTREAAMAAFAKSWRRQ* |
| Ga0075430_1015215761 | 3300006846 | Populus Rhizosphere | MWASGHNGDIKRAAHGYEPTREAAMAAFAKSWRC* |
| Ga0075430_1016463451 | 3300006846 | Populus Rhizosphere | MWASGHSAATVKRAAHGYEATREEAMAAFAKSWHGQR* |
| Ga0075431_1004578344 | 3300006847 | Populus Rhizosphere | MWASGHNGDIRRAAHGYEATREAAMAAFAKSWRRQ* |
| Ga0075431_1007026921 | 3300006847 | Populus Rhizosphere | WMWASGHSAATVKRAVHGYEPTREAAMAAFKKSWRRE* |
| Ga0075431_1011967313 | 3300006847 | Populus Rhizosphere | GRPWMWASGHSAATVKRAAHGYEATREAAMAAFAKSWRRQ* |
| Ga0075431_1015196041 | 3300006847 | Populus Rhizosphere | WMWASGHSAATIKRAAHGYETTREAAMAAFAKSWRVDSR* |
| Ga0075420_1005128952 | 3300006853 | Populus Rhizosphere | MDVGDGHSAATVERAAHGYEPTREAAMAAFAKSWRRE* |
| Ga0075429_1007636252 | 3300006880 | Populus Rhizosphere | QERPWMWASGHNGDIRRAAFGYEPTREAAMAAFAKSWRRE* |
| Ga0075429_1014276891 | 3300006880 | Populus Rhizosphere | MWASGHNGDYRRAAHRYEPTREAAMQAFAKSWRGARELP |
| Ga0075418_108139342 | 3300009100 | Populus Rhizosphere | MGWGSGHSAAVKRAAHGYEPTREAAMAAFAKSWRRR* |
| Ga0114129_109808753 | 3300009147 | Populus Rhizosphere | MWASGHNGDIRRAAHGYEPTREAAMAAFGKSWRRE* |
| Ga0114129_110326752 | 3300009147 | Populus Rhizosphere | WGWASGHSAATIRRAAHGYETTREAAVAAFAKSWRRQ* |
| Ga0114129_134114422 | 3300009147 | Populus Rhizosphere | MWTSGHNGPVRRAAHGCEAAREDAMKAFAKSWRRRS* |
| Ga0111538_103205514 | 3300009156 | Populus Rhizosphere | GPALDVASRHNGDIKRAAHGYEATREAAMAAFAKSWRPE* |
| Ga0075423_123000471 | 3300009162 | Populus Rhizosphere | MWASGHNGAIERAAHGYEPTREAALAAFAKSWRRE* |
| Ga0126374_108125611 | 3300009792 | Tropical Forest Soil | PWMWASGHNGDIKRAAHGYEPTREAAMAAFAKSWRQQ* |
| Ga0126380_115444331 | 3300010043 | Tropical Forest Soil | WASGHNGDIKRAAHGYEPTREAAMAAFAKSWRRE* |
| Ga0126384_106512411 | 3300010046 | Tropical Forest Soil | MWASGHNGDINRGAHGYKPTREAAMAAFTKSWRRK* |
| Ga0126384_112709441 | 3300010046 | Tropical Forest Soil | RPWMWASGHSADSINRAAHGYEPTREAAMAAFAKSWRRE* |
| Ga0126382_106837111 | 3300010047 | Tropical Forest Soil | MWASGHNRDIRCAAHGYEPTREAAMASFAKSWRRQ* |
| Ga0126382_119415112 | 3300010047 | Tropical Forest Soil | WMWASGHGGHHIERAAHGYEATREAAMAAFAKSWRRE* |
| Ga0126377_134095892 | 3300010362 | Tropical Forest Soil | MWASGHDGQIKRAALGYEPTREAAMAAFAKSWRRDC* |
| Ga0126379_105563012 | 3300010366 | Tropical Forest Soil | MWASGHNGDIKRAAHGYEPTREAAMAAFAKSWRRGGALG* |
| Ga0126379_135348912 | 3300010366 | Tropical Forest Soil | PWMWASGYNGEIKRAAHGYAATREEAMSAFAKSWRGEW* |
| Ga0126383_109418711 | 3300010398 | Tropical Forest Soil | MRASGHNGDIRRALHGYEPPREAAMAAFAKSWRRE* |
| Ga0126383_127908692 | 3300010398 | Tropical Forest Soil | SGHSADSVKRAAHGYEATREAAMAAFAKSWRPES* |
| Ga0137374_101067723 | 3300012204 | Vadose Zone Soil | MWASGHNGQIRRAAHGYEATREAAMAAFAKSWRREHQ* |
| Ga0137379_102253502 | 3300012209 | Vadose Zone Soil | MWASGHNRDIRRAAHGYEATRKAAMAAFSKSWRRE* |
| Ga0137371_107778383 | 3300012356 | Vadose Zone Soil | LDVGSGHNGYIRRAAHGYEPTREAAMAAFAKSWRRE* |
| Ga0126375_114719571 | 3300012948 | Tropical Forest Soil | VGSGHNGDIKRAAHGYEPTREAAMAAFAKSWRRR* |
| Ga0126375_116614522 | 3300012948 | Tropical Forest Soil | MWASGHNGDIKRAAHGYEATREAAMAAFAKSWRRE* |
| Ga0157376_111670461 | 3300014969 | Miscanthus Rhizosphere | HSADSIKRAAHGYEPTREAAMAVFAKSWRRCQPPIE* |
| Ga0132258_115224391 | 3300015371 | Arabidopsis Rhizosphere | QGRPWMWASGHSAAPVKRAAHGYEATREAAMAAFAKSWRR* |
| Ga0132258_115472952 | 3300015371 | Arabidopsis Rhizosphere | MWTSGHNGDIRRAAHGYEQTREAAMEALANSWRCEGTAN* |
| Ga0132256_1011549842 | 3300015372 | Arabidopsis Rhizosphere | MWTSGHNGDIKRAAYGYEPTREAAMAAFAKSWKR* |
| Ga0132256_1037947491 | 3300015372 | Arabidopsis Rhizosphere | MWASGHSADSISRAAHGYEATREAAMTAFAKSWRRD* |
| Ga0132257_1012798792 | 3300015373 | Arabidopsis Rhizosphere | MWASGHNGEIRRAAYGYEPTREAAMAAFAKSWQQE* |
| Ga0132257_1017899821 | 3300015373 | Arabidopsis Rhizosphere | LPLLIAVKTGSPHNGDLRRAAHGYEQTREAAMAAFAKSWRRE* |
| Ga0132257_1019572351 | 3300015373 | Arabidopsis Rhizosphere | MWASGHGGRRIRDAAHGYEATREAAMAAFAKSWRRKEA* |
| Ga0132255_1035352681 | 3300015374 | Arabidopsis Rhizosphere | EGRPWMWASGHGGHIERAAHGYEATREAAMAAFAKSWRRQ* |
| Ga0132255_1037175273 | 3300015374 | Arabidopsis Rhizosphere | PQDRPWMWAGGHNGDIRRAAHGYEATREAAMAAFAKSWRRR* |
| Ga0132255_1055964661 | 3300015374 | Arabidopsis Rhizosphere | MWASGHGGRIERTAHGYEATREAAMAAFAKSWRQDMAKQI* |
| Ga0182041_107140042 | 3300016294 | Soil | APWMWASGHNGDIKRAAYGYEATREAAMAAFSKSWRREL |
| Ga0182037_102967423 | 3300016404 | Soil | VRRVWANGHNSDTIRRAAHGYEATREAAMAAFAKGWRQE |
| Ga0222621_11103931 | 3300021510 | Groundwater Sediment | PQDRQWMWSSGHDGDIRRAAHGYEATREAAMAAFAKSWQNE |
| Ga0209466_10987632 | 3300027646 | Tropical Forest Soil | VKTGSPHNGDIKRAAHGYEPTREAAMAAFAKSWRRE |
| Ga0209689_10309763 | 3300027748 | Soil | MWAIGHKGHIRRAAHGYEPTREAAMAAFAKTWRRE |
| Ga0209382_111200371 | 3300027909 | Populus Rhizosphere | RASGHNGEICRAAHGYEPTREAAMAAFAKSWRRES |
| Ga0209382_112221462 | 3300027909 | Populus Rhizosphere | VNHLMWASGHSAATVKRAAHGYEPTREAAMAAFAKDLA |
| Ga0307282_103258822 | 3300028784 | Soil | APPDRSWGWASGHNGDYRRAAYGYEATREAAMAAFAKSWRRE |
| Ga0307287_102740341 | 3300028796 | Soil | RSWGWASGHNGDYRRAAYGYEATREAAMAAFAKSWRRE |
| Ga0307302_101712743 | 3300028814 | Soil | PQDRHWMWASGHNGYSHAAHGYEATREAAMAAFAESWRRES |
| Ga0307302_101911642 | 3300028814 | Soil | MWVSGHNGGIRRAAHGYEPTREDAMAAFAKSWRRD |
| Ga0307501_102153681 | 3300031152 | Soil | MPSVPLRRHWMWANGHIRRAAHGYEPRREAAMAAFGK |
| Ga0307499_102175811 | 3300031184 | Soil | MWASGHSADSIKRAAHGYEPTREAAMAVFAKSWRRCQPPIE |
| Ga0318541_102064364 | 3300031545 | Soil | MWASGHNGHIRRAVHGYEPTREPAMTAFAKSNGDAVTS |
| Ga0310915_100620745 | 3300031573 | Soil | MWASGHSADTIHRAAKGYEPTREAAMAAFAKNRRRLSVSRKIDL |
| Ga0310915_100773003 | 3300031573 | Soil | VRRVWANGHNSDTIRRAAHGYEATREAAMAAFAKSWRRESF |
| Ga0310915_103751992 | 3300031573 | Soil | MWASGHNGDICRAAHGYEPTREAAMAAFAKSWRRE |
| Ga0318561_107390562 | 3300031679 | Soil | RRIAPWMWASSHNGDTRRAAHGYGPTREAAMAAFAKSRCRE |
| Ga0318496_100877611 | 3300031713 | Soil | DRPWMWASGHNGHTRRAVHGYETTRETAMAAFAKSWRRE |
| Ga0318502_110353011 | 3300031747 | Soil | TRSGRRIAPWMWASSHNGDTRRAAHGYGPTREAAMAAFAKSRCRE |
| Ga0318492_103575094 | 3300031748 | Soil | PWMWASGHNGQISRAAHGYEPTREAAMSAFAKSWRGQR |
| Ga0318554_103321972 | 3300031765 | Soil | PWMWASGHNRAIERAAHGYEPTREAALAAFAKSWRRE |
| Ga0306923_101251674 | 3300031910 | Soil | MKERPWMWASGHSADTIHRAAKGYEPTREAAMAAFAKNRRRLSVSRKIDL |
| Ga0310912_102570781 | 3300031941 | Soil | MWASGHSADTIHRAAKGYEPTREAAMAAFAKNRRRLSV |
| Ga0310916_103917494 | 3300031942 | Soil | QRGMRASGHNGQISRAAHGYEPTLEAAMSAFAISWRGQR |
| Ga0318530_104712092 | 3300031959 | Soil | MWASGHSADTIHRAAKGYEPTREAAMAAFAKNRRRLSVSRK |
| ⦗Top⦘ |