


| Basic Information | |
|---|---|
| Family ID | F085909 |
| Family Type | Metagenome |
| Number of Sequences | 111 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MAIHELELDALAQTGEQRRPVSGKDRLHKELVLVDQSQICQRQ |
| Number of Associated Samples | 87 |
| Number of Associated Scaffolds | 111 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 98.20 % |
| % of genes near scaffold ends (potentially truncated) | 97.30 % |
| % of genes from short scaffolds (< 2000 bps) | 88.29 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.24 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (84.685 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (25.225 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.126 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (48.649 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.66% β-sheet: 0.00% Coil/Unstructured: 56.34% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.24 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 111 Family Scaffolds |
|---|---|---|
| PF00478 | IMPDH | 3.60 |
| PF08031 | BBE | 3.60 |
| PF00144 | Beta-lactamase | 3.60 |
| PF01784 | NIF3 | 2.70 |
| PF08281 | Sigma70_r4_2 | 1.80 |
| PF00005 | ABC_tran | 1.80 |
| PF00685 | Sulfotransfer_1 | 1.80 |
| PF12850 | Metallophos_2 | 1.80 |
| PF02219 | MTHFR | 1.80 |
| PF00903 | Glyoxalase | 0.90 |
| PF00440 | TetR_N | 0.90 |
| PF13602 | ADH_zinc_N_2 | 0.90 |
| PF01243 | Putative_PNPOx | 0.90 |
| PF03060 | NMO | 0.90 |
| PF12401 | FhaA_N | 0.90 |
| PF07992 | Pyr_redox_2 | 0.90 |
| PF13302 | Acetyltransf_3 | 0.90 |
| PF02371 | Transposase_20 | 0.90 |
| PF13840 | ACT_7 | 0.90 |
| PF00464 | SHMT | 0.90 |
| PF02955 | GSH-S_ATP | 0.90 |
| PF04551 | GcpE | 0.90 |
| PF12681 | Glyoxalase_2 | 0.90 |
| PF13649 | Methyltransf_25 | 0.90 |
| PF01872 | RibD_C | 0.90 |
| PF02574 | S-methyl_trans | 0.90 |
| PF03841 | SelA | 0.90 |
| PF00291 | PALP | 0.90 |
| PF12697 | Abhydrolase_6 | 0.90 |
| PF07366 | SnoaL | 0.90 |
| PF02774 | Semialdhyde_dhC | 0.90 |
| PF13561 | adh_short_C2 | 0.90 |
| PF01418 | HTH_6 | 0.90 |
| PF01106 | NifU | 0.90 |
| PF13275 | S4_2 | 0.90 |
| PF13376 | OmdA | 0.90 |
| PF05222 | AlaDh_PNT_N | 0.90 |
| PF12680 | SnoaL_2 | 0.90 |
| PF11578 | DUF3237 | 0.90 |
| COG ID | Name | Functional Category | % Frequency in 111 Family Scaffolds |
|---|---|---|---|
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 3.60 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 3.60 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 3.60 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 3.60 |
| COG0327 | Putative GTP cyclohydrolase 1 type 2, NIF3 family | Coenzyme transport and metabolism [H] | 2.70 |
| COG3323 | PII-like insert in the uncharacterized protein YqfO, YbgI/NIF3 family | Function unknown [S] | 2.70 |
| COG0189 | Glutathione synthase, LysX or RimK-type ligase, ATP-grasp superfamily | Translation, ribosomal structure and biogenesis [J] | 1.80 |
| COG0685 | 5,10-methylenetetrahydrofolate reductase | Amino acid transport and metabolism [E] | 1.80 |
| COG0002 | N-acetyl-gamma-glutamylphosphate reductase | Amino acid transport and metabolism [E] | 0.90 |
| COG0112 | Glycine/serine hydroxymethyltransferase | Amino acid transport and metabolism [E] | 0.90 |
| COG0136 | Aspartate-semialdehyde dehydrogenase | Amino acid transport and metabolism [E] | 0.90 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.90 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.90 |
| COG0516 | IMP dehydrogenase/GMP reductase | Nucleotide transport and metabolism [F] | 0.90 |
| COG0646 | Methionine synthase I (cobalamin-dependent), methyltransferase domain | Amino acid transport and metabolism [E] | 0.90 |
| COG0694 | Fe-S cluster biogenesis protein NfuA, 4Fe-4S-binding domain | Posttranslational modification, protein turnover, chaperones [O] | 0.90 |
| COG0821 | 4-hydroxy-3-methylbut-2-enyl diphosphate synthase IspG/GcpE | Lipid transport and metabolism [I] | 0.90 |
| COG1737 | DNA-binding transcriptional regulator, MurR/RpiR family, contains HTH and SIS domains | Transcription [K] | 0.90 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.90 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.90 |
| COG2040 | Homocysteine/selenocysteine methylase (S-methylmethionine-dependent) | Amino acid transport and metabolism [E] | 0.90 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.90 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.90 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 84.68 % |
| Unclassified | root | N/A | 15.32 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459015|G14TP7Y02IZ973 | Not Available | 500 | Open in IMG/M |
| 3300000956|JGI10216J12902_100967629 | Not Available | 858 | Open in IMG/M |
| 3300000956|JGI10216J12902_101955111 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_108949823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 795 | Open in IMG/M |
| 3300002568|C688J35102_119501843 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300004067|Ga0055485_10038904 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
| 3300004463|Ga0063356_100051799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4143 | Open in IMG/M |
| 3300005338|Ga0068868_100575053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 996 | Open in IMG/M |
| 3300005548|Ga0070665_100198011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2010 | Open in IMG/M |
| 3300005564|Ga0070664_100988603 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300005764|Ga0066903_100189694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3051 | Open in IMG/M |
| 3300005840|Ga0068870_11410169 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300006047|Ga0075024_100018551 | All Organisms → cellular organisms → Bacteria | 2804 | Open in IMG/M |
| 3300006178|Ga0075367_10237246 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
| 3300006353|Ga0075370_10141889 | All Organisms → cellular organisms → Bacteria | 1404 | Open in IMG/M |
| 3300006854|Ga0075425_101488905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 764 | Open in IMG/M |
| 3300006894|Ga0079215_10944461 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300006904|Ga0075424_101280566 | Not Available | 780 | Open in IMG/M |
| 3300006954|Ga0079219_10046106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus | 1845 | Open in IMG/M |
| 3300009100|Ga0075418_10055581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4234 | Open in IMG/M |
| 3300009101|Ga0105247_10640159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 793 | Open in IMG/M |
| 3300009148|Ga0105243_10660713 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
| 3300009148|Ga0105243_10873188 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300009156|Ga0111538_13782141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 524 | Open in IMG/M |
| 3300009176|Ga0105242_11228707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 770 | Open in IMG/M |
| 3300009553|Ga0105249_10241520 | All Organisms → cellular organisms → Bacteria | 1786 | Open in IMG/M |
| 3300009789|Ga0126307_10033088 | All Organisms → cellular organisms → Bacteria | 3988 | Open in IMG/M |
| 3300010036|Ga0126305_10292110 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300010037|Ga0126304_10262005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1139 | Open in IMG/M |
| 3300010037|Ga0126304_10884014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 607 | Open in IMG/M |
| 3300010039|Ga0126309_10878930 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300010045|Ga0126311_10738059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 789 | Open in IMG/M |
| 3300010166|Ga0126306_10102522 | All Organisms → cellular organisms → Bacteria | 2071 | Open in IMG/M |
| 3300010166|Ga0126306_10515334 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300012042|Ga0136627_1164151 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300012090|Ga0153956_1001411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 21076 | Open in IMG/M |
| 3300012094|Ga0136638_10637112 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300012183|Ga0136624_1168230 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300012186|Ga0136620_10397209 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300012188|Ga0136618_10010487 | All Organisms → cellular organisms → Bacteria | 4066 | Open in IMG/M |
| 3300012188|Ga0136618_10090470 | All Organisms → cellular organisms → Bacteria | 1350 | Open in IMG/M |
| 3300012208|Ga0137376_10284142 | All Organisms → cellular organisms → Bacteria | 1436 | Open in IMG/M |
| 3300012354|Ga0137366_10267778 | Not Available | 1263 | Open in IMG/M |
| 3300012355|Ga0137369_10696830 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300012684|Ga0136614_10384861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → environmental samples → uncultured Acidimicrobiales bacterium | 1028 | Open in IMG/M |
| 3300012955|Ga0164298_10357222 | Not Available | 928 | Open in IMG/M |
| 3300012957|Ga0164303_11303637 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300012986|Ga0164304_10991366 | Not Available | 664 | Open in IMG/M |
| 3300013096|Ga0157307_1082820 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300013296|Ga0157374_11396677 | Not Available | 723 | Open in IMG/M |
| 3300014325|Ga0163163_12880900 | Not Available | 537 | Open in IMG/M |
| 3300014325|Ga0163163_13310880 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300014326|Ga0157380_10473476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1209 | Open in IMG/M |
| 3300014745|Ga0157377_10144912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1463 | Open in IMG/M |
| 3300014745|Ga0157377_10887165 | Not Available | 665 | Open in IMG/M |
| 3300014969|Ga0157376_10920984 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300014969|Ga0157376_11202790 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300015170|Ga0120098_1018339 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300015371|Ga0132258_10688497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2573 | Open in IMG/M |
| 3300015371|Ga0132258_11651186 | Not Available | 1617 | Open in IMG/M |
| 3300015374|Ga0132255_100473779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1836 | Open in IMG/M |
| 3300015374|Ga0132255_105112113 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300017792|Ga0163161_10868872 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300018067|Ga0184611_1336477 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300018073|Ga0184624_10232797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 825 | Open in IMG/M |
| 3300018083|Ga0184628_10169140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1140 | Open in IMG/M |
| 3300018422|Ga0190265_10359103 | All Organisms → cellular organisms → Bacteria | 1545 | Open in IMG/M |
| 3300018422|Ga0190265_11683764 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 744 | Open in IMG/M |
| 3300018429|Ga0190272_11105562 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 769 | Open in IMG/M |
| 3300018429|Ga0190272_11668016 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300018432|Ga0190275_10329974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1508 | Open in IMG/M |
| 3300018432|Ga0190275_12059343 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300018469|Ga0190270_10154515 | Not Available | 1870 | Open in IMG/M |
| 3300018469|Ga0190270_10470483 | Not Available | 1188 | Open in IMG/M |
| 3300018469|Ga0190270_11202457 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300018469|Ga0190270_12834990 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300018476|Ga0190274_11314756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 810 | Open in IMG/M |
| 3300018481|Ga0190271_10657758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1169 | Open in IMG/M |
| 3300018481|Ga0190271_11258466 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300018481|Ga0190271_11731992 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300018481|Ga0190271_12476815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 621 | Open in IMG/M |
| 3300018481|Ga0190271_12958100 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300018481|Ga0190271_13231155 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300019356|Ga0173481_10046507 | All Organisms → cellular organisms → Bacteria | 1474 | Open in IMG/M |
| 3300019361|Ga0173482_10516878 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300019361|Ga0173482_10540053 | Not Available | 574 | Open in IMG/M |
| 3300022932|Ga0247807_10249979 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300025908|Ga0207643_10135365 | All Organisms → cellular organisms → Bacteria | 1468 | Open in IMG/M |
| 3300026067|Ga0207678_10811719 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300026075|Ga0207708_11017004 | Not Available | 720 | Open in IMG/M |
| 3300026121|Ga0207683_10109649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 2471 | Open in IMG/M |
| 3300027636|Ga0214469_1005855 | All Organisms → cellular organisms → Bacteria | 4492 | Open in IMG/M |
| 3300027694|Ga0209170_1169227 | Not Available | 756 | Open in IMG/M |
| 3300027909|Ga0209382_12153759 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300028589|Ga0247818_10753811 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300028589|Ga0247818_10784199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae | 664 | Open in IMG/M |
| 3300028592|Ga0247822_10251607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1337 | Open in IMG/M |
| 3300028592|Ga0247822_11743950 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300028790|Ga0307283_10206446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 564 | Open in IMG/M |
| 3300028889|Ga0247827_10656502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Agromyces | 678 | Open in IMG/M |
| 3300030336|Ga0247826_11225162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 602 | Open in IMG/M |
| 3300030606|Ga0299906_10298490 | All Organisms → cellular organisms → Bacteria | 1258 | Open in IMG/M |
| 3300031228|Ga0299914_10403679 | All Organisms → cellular organisms → Bacteria | 1192 | Open in IMG/M |
| 3300031229|Ga0299913_10148046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2316 | Open in IMG/M |
| 3300031671|Ga0307372_10365169 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300031731|Ga0307405_11143206 | Not Available | 671 | Open in IMG/M |
| 3300031938|Ga0308175_102453955 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300031940|Ga0310901_10065342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Agromyces → Agromyces ramosus | 1231 | Open in IMG/M |
| 3300032012|Ga0310902_11092407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae | 558 | Open in IMG/M |
| 3300033412|Ga0310810_11232864 | Not Available | 601 | Open in IMG/M |
| 3300033475|Ga0310811_11173406 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 25.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 8.11% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 7.21% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 6.31% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.50% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.50% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.60% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.70% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 2.70% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.70% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.70% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.80% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.80% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.80% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.90% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.90% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.90% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.90% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.90% |
| Fossill | Environmental → Terrestrial → Soil → Fossil → Unclassified → Fossill | 0.90% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.90% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.90% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.90% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.90% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.90% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.90% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459015 | Litter degradation PV4 | Engineered | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004067 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006178 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Host-Associated | Open in IMG/M |
| 3300006353 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300012042 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ489 (22.06) | Environmental | Open in IMG/M |
| 3300012090 | Attine ant fungus gardens microbial communities from Florida, USA - TSFL040 MetaG | Host-Associated | Open in IMG/M |
| 3300012094 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ858 (22.06) | Environmental | Open in IMG/M |
| 3300012183 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ469 (22.06) | Environmental | Open in IMG/M |
| 3300012186 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ416 (21.06) | Environmental | Open in IMG/M |
| 3300012188 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ330 (21.06) | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013096 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015170 | Fossil microbial communities from human bone sample from Teposcolula Yucundaa, Mexico - TP48 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300022932 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L074-202C-1 | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027636 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 HiSeq | Environmental | Open in IMG/M |
| 3300027694 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_bulk (SPAdes) | Engineered | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028790 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300030606 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 | Environmental | Open in IMG/M |
| 3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031671 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-1 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 4PV_03158570 | 2170459015 | Switchgrass, Maize And Mischanthus Litter | VAIRQLELDALVQTGEQRRTVSGKDRLHYEPVLVDQSQVCQRQGDVSRPPT |
| JGI10216J12902_1009676291 | 3300000956 | Soil | VNELEWDALPQTGEQRRTVTGEDRLNDELVLVDQPQIC |
| JGI10216J12902_1019551111 | 3300000956 | Soil | MAIHQRELDALAQTGQQRRPMAGEDRLHDKRVLVDQSQICQRQGERH |
| JGIcombinedJ13530_1089498233 | 3300001213 | Wetland | VAIHQLELDALAQTREQCRPVSGKDRLYEELVLVDQSQICQRQG |
| C688J35102_1195018431 | 3300002568 | Soil | MAIHELELDAVAQTGEQRRSVSGKDWLHKELVLVDESQICQ |
| Ga0055485_100389042 | 3300004067 | Natural And Restored Wetlands | MASHELDLDALAQTGEQRRPVSGKDRLHEELVLVDQSQICQRQG |
| Ga0063356_1000517991 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MAIHQLELDALAQTAEQRRPVSRKDRLHKELELVDQSQICQR |
| Ga0068868_1005750532 | 3300005338 | Miscanthus Rhizosphere | MAMHELELDPLLQTGEQRRPMARQNRLHEELVLVDQSQIRQ |
| Ga0070665_1001980114 | 3300005548 | Switchgrass Rhizosphere | MAIHELELDAFAQTGEQRRPVSGQDRLHKELVLVDQSQICQRQGERHATHE |
| Ga0070664_1009886032 | 3300005564 | Corn Rhizosphere | MAIHELELDALAQTGEQRRPVSGKDRLHKERVLVDQSQICQRQGERH |
| Ga0066903_1001896945 | 3300005764 | Tropical Forest Soil | MALDQLELDALAQTGEQRRPVSGKNRLDKELVLVDQSQICQRQ |
| Ga0068870_114101691 | 3300005840 | Miscanthus Rhizosphere | MAIHELELDALAQTSEQRRPVSGKDRLHKELVLVDQSQ |
| Ga0075024_1000185515 | 3300006047 | Watersheds | MAIHQIELDPLAQTGEQRRPVSGQDRLHKELVLVDQSQI |
| Ga0075367_102372461 | 3300006178 | Populus Endosphere | MAIHQLELDALAQTREQRRPVSGKDRLHKELVLVDQSQIG |
| Ga0075370_101418891 | 3300006353 | Populus Endosphere | MAIHQLELDALAQTREQRRPVSGKDRLHKELVLVDQSQICQRQGERH |
| Ga0075425_1014889052 | 3300006854 | Populus Rhizosphere | MAIHELELDALAQTGEQRRPVPGKDRLHKELVLVDQSQICQRQGECHATHEQ |
| Ga0079215_109444612 | 3300006894 | Agricultural Soil | MHELELDPLVQTGEQRRPMARQNRLHEELVLVDQSQIR |
| Ga0075424_1012805662 | 3300006904 | Populus Rhizosphere | MHELEPDPVLQTGEQRRPMARQNRLHEELVLVDQSQIRQGQ |
| Ga0079219_100461063 | 3300006954 | Agricultural Soil | MAIHELKLDALMQTGEQRRSVSGKDRLHKELVLVD |
| Ga0075418_100555811 | 3300009100 | Populus Rhizosphere | MAIHQLELDALAQTGEQRRPVSGKDRLHKELVLVDQ |
| Ga0105247_106401591 | 3300009101 | Switchgrass Rhizosphere | MPIHQLELDALAQTREQRRPVSRKDRLHDERVLVDESQICQRQRER |
| Ga0105243_106607131 | 3300009148 | Miscanthus Rhizosphere | MAIHELELDALAQTGEQRRPVSGKDRLHKERVLVDQSQICQRQGE |
| Ga0105243_108731881 | 3300009148 | Miscanthus Rhizosphere | MAIRELELDALAQTGEQRRPVSGKDRLHKEHVLVDQSQ |
| Ga0111538_137821412 | 3300009156 | Populus Rhizosphere | MAIHEFELDALAQTGEQRRPVSGEDRLHKELVLVDQS |
| Ga0105242_112287073 | 3300009176 | Miscanthus Rhizosphere | MAIHELDLDALAQTCEQRRPVSGEDRLHEELVLVD |
| Ga0105249_102415201 | 3300009553 | Switchgrass Rhizosphere | MAIHELELDALAQTGEQRRPVSGKDRLHKERVLVDQSQICQRQG |
| Ga0126307_100330881 | 3300009789 | Serpentine Soil | VAIHELELDALAQTGEQRRPVSGKDRLHKELVLVDQ |
| Ga0126305_102921102 | 3300010036 | Serpentine Soil | MAIHELELDALAQTGEQRRPVSGKDRLHKELVLVDQSQICQ |
| Ga0126304_102620052 | 3300010037 | Serpentine Soil | MAIHELELNALAQTGEQRRPVSGKDRLHKELVLVDQSQICQR |
| Ga0126304_108840142 | 3300010037 | Serpentine Soil | MAVHELELDAPAQTGEQRRPVSGEDRLHKEHVLVDQS |
| Ga0126309_108789302 | 3300010039 | Serpentine Soil | MAIHDLELDALAQTGEQRRPMSGKDRLHKEHVLVDQSEICQRQS* |
| Ga0126311_107380591 | 3300010045 | Serpentine Soil | MAMHELKLDPLLQTGEQRRPMARQNRLHEELVLVDQSQI |
| Ga0126306_101025221 | 3300010166 | Serpentine Soil | VAIHELELDALAQTGEQRRPVSGKDRLHKELVLVDQSQICQRQGERHA |
| Ga0126306_105153341 | 3300010166 | Serpentine Soil | MAIHELELDALAQTGEQRRPVSGKDRLHKEHVLVDQSQI |
| Ga0136627_11641512 | 3300012042 | Polar Desert Sand | MAIHQLELDALAQTGEQRRPVSGKDRLHKELVLVDQSQICQRQGERHAT |
| Ga0153956_10014113 | 3300012090 | Attine Ant Fungus Gardens | MAIHELHLDALAQTGEQRRPVSGKDRLHEELVCFSR* |
| Ga0136638_106371121 | 3300012094 | Polar Desert Sand | MAIHKLKLDAFAQTGEQRRPVSGKDRLHKELVLVDQSQI |
| Ga0136624_11682302 | 3300012183 | Polar Desert Sand | MAIHQLELDALAQTGEQRRPVSGKDRLHKELVLVD |
| Ga0136620_103972091 | 3300012186 | Polar Desert Sand | MAIHELELDALAQTGEQRRPVSGKDRLHKELVLVDKSQICQ |
| Ga0136618_100104871 | 3300012188 | Polar Desert Sand | MAIHELELDALAQTGEQRRPVSGKDRLHKEHVLVDQSQICQRQG |
| Ga0136618_100904701 | 3300012188 | Polar Desert Sand | MAIHKLKLDAFAQTGEQRRPVSGKDRLHKELVLVDQSQ |
| Ga0137376_102841423 | 3300012208 | Vadose Zone Soil | MAIHELELDALAQPGEQRRPVSGKDRLHKELVLVDQSQICQ |
| Ga0137366_102677782 | 3300012354 | Vadose Zone Soil | MAIHELELDALAQTGEQRRPVSGKDRLHKELVLVDQSQICQRAGERHATHE* |
| Ga0137369_106968301 | 3300012355 | Vadose Zone Soil | MAIHELELDALGQTGEQRRPVSGKDRLHKELVLVDQSQICQRQGERH |
| Ga0136614_103848612 | 3300012684 | Polar Desert Sand | MAIHQLELDALAQTGEQRRPVSGKDRLHKELVLVDQSQICQRQGE |
| Ga0164298_103572221 | 3300012955 | Soil | MAIDQLELDALSQTGKQRRPVSGKHRLHEKFVLVDQSQI |
| Ga0164303_113036372 | 3300012957 | Soil | MAIHELELDAFAQTGEQGRPVSGKDRLHKAQVLVDQSQL |
| Ga0164304_109913662 | 3300012986 | Soil | LAIHELQLDALAQTGEKGRPVSGKDRLHKERVFVDQTQICQRQGERHTTHEQ |
| Ga0157307_10828202 | 3300013096 | Soil | MAIHELELDTFAQTGEQRRPVSGKDRLHKELVLVDQSQIC |
| Ga0157374_113966772 | 3300013296 | Miscanthus Rhizosphere | MAIHERELDALAQTGEQRRPLSGKDRLHKELVLVDQSQICQRQG |
| Ga0163163_128809002 | 3300014325 | Switchgrass Rhizosphere | MAIHELELDALAQTGEQRRPMSGKDRLHEELVLVDQSQICQRQ |
| Ga0163163_133108802 | 3300014325 | Switchgrass Rhizosphere | MAIHELELDALAQTGEQRRSVSGKDRLHKEHVLVDQSQICQRQGERHATHE |
| Ga0157380_104734761 | 3300014326 | Switchgrass Rhizosphere | MAIHELDLDALAQAGEQRRPVSGKDRLHKELVLVDQSQICQ |
| Ga0157377_101449124 | 3300014745 | Miscanthus Rhizosphere | MAIHELDLDALAQTGEQRRPVSGKDRLHKERVLVDQSQICQRQGERHATHEE |
| Ga0157377_108871652 | 3300014745 | Miscanthus Rhizosphere | VAIRQLELDALVQTGEQRRTASGKDRLHYEPVLVDQSQVCQRQGECHSTHE |
| Ga0157376_109209841 | 3300014969 | Miscanthus Rhizosphere | MAIHELDLDALAQTGEQRRPVSDKDRLHDELVLVDQSQFCQRQGE |
| Ga0157376_112027902 | 3300014969 | Miscanthus Rhizosphere | MPLHELELDALAQTGEQRRPVPGKDRLHNELVLVDQSQICQ |
| Ga0120098_10183393 | 3300015170 | Fossill | MAIHELDLDALAQTGEQRRPVSGKDRLHKELVLVDQSQICQRQGERHAT |
| Ga0132258_106884975 | 3300015371 | Arabidopsis Rhizosphere | MAIHELELDALAQTGEQGRPVSGKDRLHKELVLVDQSQICQRQGERH |
| Ga0132258_116511861 | 3300015371 | Arabidopsis Rhizosphere | MAIHKLELDALAQTGEQRRPVSGKDRLHNELVLVDQSQICQRQ |
| Ga0132255_1004737791 | 3300015374 | Arabidopsis Rhizosphere | MPIHQLELNALAQTREQRRPVSRKDRLHDERVLVDES |
| Ga0132255_1051121131 | 3300015374 | Arabidopsis Rhizosphere | MAVHELELDALAQTSEQRRPVPGNDRLHKKLVLVDQSQI |
| Ga0163161_108688723 | 3300017792 | Switchgrass Rhizosphere | MAIHELELDAFAQTGEQGRPVSGKDRLHKEHVLVDQSQ |
| Ga0184611_13364771 | 3300018067 | Groundwater Sediment | MAINQLEPDALPQTGEQRRPVSGKDWLHKELVFVDQSQICQRQGE |
| Ga0184624_102327972 | 3300018073 | Groundwater Sediment | MHELELDPLAQTGEQRRPMARQNRLHEELVLVDQSQIRQGQ |
| Ga0184628_101691403 | 3300018083 | Groundwater Sediment | MHELELDPLLQTGEQRRPMARQNRLHEELVLVDQPQIRQGQRE |
| Ga0190265_103591034 | 3300018422 | Soil | MAIHELELDAFAQTGEQRRPVSGKDRLHKELVLVDQPQICQRQ |
| Ga0190265_116837641 | 3300018422 | Soil | MAIHELELYALAQTGEQRRPVSGKDRLHKELVLVDQSQICQRQ |
| Ga0190272_111055622 | 3300018429 | Soil | MAIHELELDALAQTGEQRRPVSGKDRLHKEHVLVDQSQICQRQGERHA |
| Ga0190272_116680161 | 3300018429 | Soil | MAIHELDLDALAQTGEQRRPVSGKDRLHKELVLVDQSQICQRQGERHA |
| Ga0190275_103299741 | 3300018432 | Soil | MAIDELELDSLTQTGEQRRPVSGNDRLDDELVLVDQSQIC |
| Ga0190275_120593432 | 3300018432 | Soil | MAIHQLELDTFAQTGEQGRPVSGKDRLHKEHVLVNQSQ |
| Ga0190270_101545153 | 3300018469 | Soil | MAVHELELDAFAQTGEQRRPVSGEDRLHEELVLVDQSQ |
| Ga0190270_104704834 | 3300018469 | Soil | MAIHELELDGRAQPGEQRRPVSGKDRLHKELVLVDQSQICQ |
| Ga0190270_112024571 | 3300018469 | Soil | MAIHELKLNALAQTGEQRRPVSGKDRLHKELVLVDESQI |
| Ga0190270_128349902 | 3300018469 | Soil | MAIHEFELDALAQTGEQRRPVSGKDRLHKELVLVDQSQICQRQGER |
| Ga0190274_113147561 | 3300018476 | Soil | MAIHELKLNALAQTGEQRRPVSGKDRLHEELVLVDQSQI |
| Ga0190271_106577581 | 3300018481 | Soil | MAIHELKLNALAQTGEQRRPVSGKDRLHKELVLVDE |
| Ga0190271_112584662 | 3300018481 | Soil | MAIHELELAALAQTGEQRRPVSGKDRLHKELVLVDQSQICQRQGE |
| Ga0190271_117319921 | 3300018481 | Soil | MAIHALELDALAQTGEQRRPVSGKDRLHKELVLVDQSQICQRQG |
| Ga0190271_124768151 | 3300018481 | Soil | MAVHELELDALAQTGEQRRPVSGKDRLHKELVLVDQ |
| Ga0190271_129581002 | 3300018481 | Soil | MAIHELKLNALTQTGEQRRPVSGKDRLHKELVLVDQSQICQ |
| Ga0190271_132311552 | 3300018481 | Soil | MAIHELELDALAQTGEQRRPVSGKDRLHKELVLVDQ |
| Ga0173481_100465073 | 3300019356 | Soil | MAVHKLELDALAQTGEQRRPVSGKDRLHEEDVLVDQSQICQRQ |
| Ga0173482_105168781 | 3300019361 | Soil | MAIHELELDTFAQTGEQRRPVSGKDRLHKELVLVDQSQICQRQGERH |
| Ga0173482_105400531 | 3300019361 | Soil | MAIHQLQLDALAQAGEQRRSVARKDRLNKELVLVDQSQICQRQGK |
| Ga0247807_102499791 | 3300022932 | Plant Litter | MAVDEVELNALAQASKQSRAVSGKDRLYKEFVLVDQSQICQSQ |
| Ga0207643_101353651 | 3300025908 | Miscanthus Rhizosphere | MAIDQLELDALSQTGKQRRPVSGKHRLHEEFVLVDQSQIRQRQGE |
| Ga0207678_108117191 | 3300026067 | Corn Rhizosphere | MAIHELDLDALAQTGEQRRPVSGKDRLHKELVLVDESQICQRQGER |
| Ga0207708_110170042 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MAIHELDLDALAQTGEERRPVSGKDRLHNEHVLVDQSQICQRQGQRHAT |
| Ga0207683_101096493 | 3300026121 | Miscanthus Rhizosphere | MAIDQLELDSLSQTGKQRRPVSGKHRLHEKFVLVDQSQICQRQG |
| Ga0214469_10058557 | 3300027636 | Soil | MAIHELELDALAQTGEQRRPVSGKDRLHKELVLVDQS |
| Ga0209170_11692273 | 3300027694 | Activated Sludge | MALHELELYALAQTGEQRRPASGKDRLHEELVLVDQSQIRQRQGKR |
| Ga0209382_121537591 | 3300027909 | Populus Rhizosphere | MAIHKLELDALAKTGEQRRPVSGQDRLHKELVLVDQSQI |
| Ga0247818_107538112 | 3300028589 | Soil | MAIHELELDALAQTGEQRRPVSGQDWLHKERVLVDQSQICQRQG |
| Ga0247818_107841991 | 3300028589 | Soil | MAIDELKLNALAQTGEQRRPVSGKDRLHKELVLVDKSQIGQRQG |
| Ga0247822_102516071 | 3300028592 | Soil | MAIHELEMDALAQTGEQRGPVSGKDRLHEEHVLVDQSQIC |
| Ga0247822_117439501 | 3300028592 | Soil | MHELELDPLLQTGEQRRPMARQNRLHEELVLVDQP |
| Ga0307283_102064461 | 3300028790 | Soil | MTIHELELDALAQTGKQRRAMSGKDRLHKKLVLVNQPQICQRQGESH |
| Ga0247827_106565021 | 3300028889 | Soil | MAIHELELNALTQAGEQRRSVSGEDRLHDELVLVDQSQ |
| Ga0247826_112251621 | 3300030336 | Soil | MAIDQLELDALSQTGKQRRPVSGKHRLHEEFVLVDQS |
| Ga0299906_102984901 | 3300030606 | Soil | MAIHELELDALAQTGEQRRPVSGKDRLHKELVLVDQSQICQRQ |
| Ga0299914_104036792 | 3300031228 | Soil | MAVHQLDLDALAQTGEQRRPVSGKDRLHKELVLVD |
| Ga0299913_101480464 | 3300031229 | Soil | MAIHELELDALAQTGEQRRPVSGEDRLHNELVLVDQSQICQ |
| Ga0307372_103651692 | 3300031671 | Soil | MATHELELDALAQTGEQRRPMSGKDRLHNELVLVDQSQICQRQG |
| Ga0307405_111432061 | 3300031731 | Rhizosphere | MAIHELELDASAKTGEQRRPVSGKDRLHKELILVDQSQICQRQGERHATQE |
| Ga0308175_1024539551 | 3300031938 | Soil | MAIHELEPDALAQTGQQRRPVPGKDGLHKEHVIVDQSQ |
| Ga0310901_100653421 | 3300031940 | Soil | MAIHQLELDALAQTGKQRRPVSGKHRLHKELVLVDQSQICQRQRE |
| Ga0310902_110924071 | 3300032012 | Soil | MAIDELKLNALAQTGEQRRPVSGKDRLHKELVLVD |
| Ga0310810_112328641 | 3300033412 | Soil | MHELELDPLLQTGEQRRPMARQNRLHEELVLVDQSQIRQRQGERHATHQQT |
| Ga0310811_111734062 | 3300033475 | Soil | MAIHELDLDALAQTGEQRRPVSGKDRLHKELVLVDQSQICQRQRERHAA |
| ⦗Top⦘ |