


| Basic Information | |
|---|---|
| Family ID | F085790 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 111 |
| Average Sequence Length | 38 residues |
| Representative Sequence | PNPPLNSDPACIAFRSLSAFRFLGFAHRLGAGGAG |
| Number of Associated Samples | 72 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 18.02 % |
| % of genes near scaffold ends (potentially truncated) | 75.68 % |
| % of genes from short scaffolds (< 2000 bps) | 73.87 % |
| Associated GOLD sequencing projects | 70 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (78.378 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen (34.234 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.225 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (37.838 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.51% β-sheet: 0.00% Coil/Unstructured: 63.49% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF08818 | DUF1801 | 2.75 |
| PF04365 | BrnT_toxin | 1.83 |
| PF14384 | BrnA_antitoxin | 1.83 |
| PF08695 | Coa1 | 1.83 |
| PF08592 | Anthrone_oxy | 0.92 |
| PF10387 | DUF2442 | 0.92 |
| PF06940 | DUF1287 | 0.92 |
| PF12850 | Metallophos_2 | 0.92 |
| PF07883 | Cupin_2 | 0.92 |
| PF07166 | DUF1398 | 0.92 |
| PF13577 | SnoaL_4 | 0.92 |
| PF00565 | SNase | 0.92 |
| PF12441 | CopG_antitoxin | 0.92 |
| PF01844 | HNH | 0.92 |
| PF09832 | DUF2059 | 0.92 |
| PF00072 | Response_reg | 0.92 |
| PF04657 | DMT_YdcZ | 0.92 |
| PF08401 | ArdcN | 0.92 |
| PF10077 | DUF2314 | 0.92 |
| PF05016 | ParE_toxin | 0.92 |
| PF00583 | Acetyltransf_1 | 0.92 |
| PF01845 | CcdB | 0.92 |
| PF00903 | Glyoxalase | 0.92 |
| PF03050 | DDE_Tnp_IS66 | 0.92 |
| PF14659 | Phage_int_SAM_3 | 0.92 |
| PF03544 | TonB_C | 0.92 |
| PF02278 | Lyase_8 | 0.92 |
| PF04191 | PEMT | 0.92 |
| PF04072 | LCM | 0.92 |
| PF01694 | Rhomboid | 0.92 |
| PF15428 | Imm26 | 0.92 |
| PF01936 | NYN | 0.92 |
| PF13714 | PEP_mutase | 0.92 |
| PF06271 | RDD | 0.92 |
| PF13671 | AAA_33 | 0.92 |
| PF14317 | YcxB | 0.92 |
| PF06580 | His_kinase | 0.92 |
| PF02493 | MORN | 0.92 |
| PF02796 | HTH_7 | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 2.75 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 2.75 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 2.75 |
| COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 1.83 |
| COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 0.92 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.92 |
| COG1432 | NYN domain, predicted PIN-related RNAse, tRNA/rRNA maturation | General function prediction only [R] | 0.92 |
| COG1714 | Uncharacterized membrane protein YckC, RDD family | Function unknown [S] | 0.92 |
| COG2849 | Antitoxin component YwqK of the YwqJK toxin-antitoxin module | Defense mechanisms [V] | 0.92 |
| COG2972 | Sensor histidine kinase YesM | Signal transduction mechanisms [T] | 0.92 |
| COG3238 | Uncharacterized membrane protein YdcZ, DUF606 family | Function unknown [S] | 0.92 |
| COG3275 | Sensor histidine kinase, LytS/YehU family | Signal transduction mechanisms [T] | 0.92 |
| COG3315 | O-Methyltransferase involved in polyketide biosynthesis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.92 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.92 |
| COG3738 | Uncharacterized conserved protein YijF, DUF1287 family | Function unknown [S] | 0.92 |
| COG4227 | Antirestriction protein ArdC | Replication, recombination and repair [L] | 0.92 |
| COG4642 | Uncharacterized conserved protein | Function unknown [S] | 0.92 |
| COG5562 | Prophage-encoded protein YbcV, DUF1398 family | Mobilome: prophages, transposons [X] | 0.92 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 79.28 % |
| Unclassified | root | N/A | 20.72 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000203|TB18AUG2009E_c002485 | All Organisms → cellular organisms → Bacteria | 2982 | Open in IMG/M |
| 3300000439|TBL_comb48_EPIDRAFT_1010950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. M15 | 4884 | Open in IMG/M |
| 3300003852|Ga0031655_10118317 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
| 3300003887|Ga0062443_1075623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → unclassified Candidatus Competibacteraceae → Candidatus Competibacteraceae bacterium | 1571 | Open in IMG/M |
| 3300003888|Ga0062442_1002988 | All Organisms → cellular organisms → Bacteria | 9543 | Open in IMG/M |
| 3300003888|Ga0062442_1006455 | Not Available | 10327 | Open in IMG/M |
| 3300003888|Ga0062442_1008533 | All Organisms → cellular organisms → Bacteria | 6904 | Open in IMG/M |
| 3300003888|Ga0062442_1008533 | All Organisms → cellular organisms → Bacteria | 6904 | Open in IMG/M |
| 3300003888|Ga0062442_1011422 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3309 | Open in IMG/M |
| 3300003888|Ga0062442_1032855 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → Holophagales → Holophagaceae → Geothrix → unclassified Geothrix → Geothrix sp. SG10 | 728 | Open in IMG/M |
| 3300003888|Ga0062442_1080039 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → Holophagales → Holophagaceae → Geothrix → unclassified Geothrix → Geothrix sp. SG10 | 524 | Open in IMG/M |
| 3300005261|Ga0071345_1013351 | All Organisms → cellular organisms → Bacteria | 11564 | Open in IMG/M |
| 3300005261|Ga0071345_1013536 | All Organisms → cellular organisms → Bacteria | 3161 | Open in IMG/M |
| 3300005263|Ga0071346_1013123 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → Holophagales → Holophagaceae → Geothrix | 568 | Open in IMG/M |
| 3300006109|Ga0007870_1021957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium RIFOXYD12_FULL_60_8 | 1272 | Open in IMG/M |
| 3300006354|Ga0075021_10845432 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → Holophagales → Holophagaceae → Geothrix → unclassified Geothrix → Geothrix sp. SG10 | 593 | Open in IMG/M |
| 3300006354|Ga0075021_11069493 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → Holophagales → Holophagaceae → Geothrix → unclassified Geothrix → Geothrix sp. SG10 | 527 | Open in IMG/M |
| 3300006642|Ga0075521_10150681 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → Holophagales → Holophagaceae → Geothrix → unclassified Geothrix → Geothrix sp. SG10 | 1090 | Open in IMG/M |
| 3300007959|Ga0079306_1186552 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → Holophagales → Holophagaceae → Geothrix → unclassified Geothrix → Geothrix sp. SG10 | 525 | Open in IMG/M |
| 3300009032|Ga0105048_10907515 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 770 | Open in IMG/M |
| 3300009175|Ga0073936_10313283 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → Holophagales → Holophagaceae → Geothrix → unclassified Geothrix → Geothrix sp. SG10 | 1011 | Open in IMG/M |
| 3300011442|Ga0137437_1184066 | Not Available | 724 | Open in IMG/M |
| 3300012228|Ga0137459_1193624 | Not Available | 595 | Open in IMG/M |
| 3300014496|Ga0182011_10888792 | Not Available | 555 | Open in IMG/M |
| 3300014498|Ga0182019_10172723 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → Holophagales → Holophagaceae → Geothrix → unclassified Geothrix → Geothrix sp. SG10 | 1383 | Open in IMG/M |
| 3300014498|Ga0182019_10248901 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
| 3300014502|Ga0182021_10236583 | All Organisms → cellular organisms → Bacteria | 2139 | Open in IMG/M |
| 3300014502|Ga0182021_13615670 | Not Available | 514 | Open in IMG/M |
| 3300016422|Ga0182039_10537598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → Holophagales → Holophagaceae → Geothrix → unclassified Geothrix → Geothrix sp. SG10 | 1014 | Open in IMG/M |
| 3300016682|Ga0180044_1017617 | Not Available | 1658 | Open in IMG/M |
| 3300019788|Ga0182028_1369239 | Not Available | 4883 | Open in IMG/M |
| 3300020680|Ga0214215_101395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Bowmanella → Bowmanella dokdonensis | 2437 | Open in IMG/M |
| 3300020681|Ga0214253_100508 | All Organisms → cellular organisms → Bacteria | 8755 | Open in IMG/M |
| 3300020689|Ga0214210_1007425 | Not Available | 1076 | Open in IMG/M |
| 3300020700|Ga0214225_1000392 | All Organisms → cellular organisms → Bacteria | 10373 | Open in IMG/M |
| 3300020708|Ga0214228_1004982 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1437 | Open in IMG/M |
| 3300020712|Ga0214255_1013197 | Not Available | 1078 | Open in IMG/M |
| 3300020719|Ga0214257_1000679 | All Organisms → cellular organisms → Bacteria | 9090 | Open in IMG/M |
| 3300021069|Ga0194062_1112622 | Not Available | 815 | Open in IMG/M |
| 3300021072|Ga0194057_10024672 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → Holophagales → Holophagaceae → Geothrix | 2387 | Open in IMG/M |
| 3300021126|Ga0214187_1007841 | Not Available | 1375 | Open in IMG/M |
| 3300021137|Ga0214165_1036129 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1137 | Open in IMG/M |
| 3300021354|Ga0194047_10328097 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → Holophagales → Holophagaceae → Geothrix → unclassified Geothrix → Geothrix sp. SG10 | 581 | Open in IMG/M |
| 3300021520|Ga0194053_10041052 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → Holophagales → Holophagaceae → Geothrix | 2071 | Open in IMG/M |
| 3300023075|Ga0224520_1020402 | All Organisms → cellular organisms → Bacteria | 1617 | Open in IMG/M |
| 3300023075|Ga0224520_1080951 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → Holophagales → Holophagaceae → Geothrix → unclassified Geothrix → Geothrix sp. SG10 | 728 | Open in IMG/M |
| 3300023254|Ga0224524_1023496 | All Organisms → cellular organisms → Bacteria | 1257 | Open in IMG/M |
| 3300024233|Ga0224521_1055079 | Not Available | 882 | Open in IMG/M |
| 3300024233|Ga0224521_1106502 | Not Available | 602 | Open in IMG/M |
| 3300025366|Ga0208505_1004791 | All Organisms → cellular organisms → Bacteria | 2117 | Open in IMG/M |
| 3300027265|Ga0208789_1001267 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 15132 | Open in IMG/M |
| 3300027894|Ga0209068_10945369 | Not Available | 511 | Open in IMG/M |
| 3300028069|Ga0255358_1000943 | Not Available | 3695 | Open in IMG/M |
| 3300028069|Ga0255358_1000943 | Not Available | 3695 | Open in IMG/M |
| 3300028736|Ga0302214_1021089 | All Organisms → cellular organisms → Bacteria | 1316 | Open in IMG/M |
| 3300028857|Ga0302289_1059756 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 891 | Open in IMG/M |
| 3300028868|Ga0302163_10126678 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → Holophagales → Holophagaceae → Geothrix → unclassified Geothrix → Geothrix sp. SG10 | 668 | Open in IMG/M |
| 3300029987|Ga0311334_11401314 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → Holophagales → Holophagaceae → Geothrix → unclassified Geothrix → Geothrix sp. SG10 | 590 | Open in IMG/M |
| 3300029990|Ga0311336_10531345 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → Holophagales → Holophagaceae → Geothrix → unclassified Geothrix → Geothrix sp. SG10 | 999 | Open in IMG/M |
| 3300030000|Ga0311337_10051796 | All Organisms → cellular organisms → Bacteria | 3192 | Open in IMG/M |
| 3300030000|Ga0311337_11456326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → Holophagales → Holophagaceae → Geothrix → unclassified Geothrix → Geothrix sp. SG10 | 600 | Open in IMG/M |
| 3300030002|Ga0311350_10032100 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → Holophagales → Holophagaceae → Geothrix | 4573 | Open in IMG/M |
| 3300030002|Ga0311350_10628982 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300030003|Ga0302172_10159678 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300030048|Ga0302273_1233868 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300030294|Ga0311349_10871368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 847 | Open in IMG/M |
| 3300030339|Ga0311360_11231321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Neisseriaceae → Chitinolyticbacter → Chitinolyticbacter meiyuanensis | 588 | Open in IMG/M |
| 3300030339|Ga0311360_11482563 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300030838|Ga0311335_10627696 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → Holophagales → Holophagaceae → Geothrix → unclassified Geothrix → Geothrix sp. SG10 | 753 | Open in IMG/M |
| 3300030838|Ga0311335_10657657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae | 735 | Open in IMG/M |
| 3300030943|Ga0311366_10505796 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → Holophagales → Holophagaceae → Geothrix → unclassified Geothrix → Geothrix sp. SG10 | 1051 | Open in IMG/M |
| 3300030943|Ga0311366_11694406 | Not Available | 540 | Open in IMG/M |
| 3300031232|Ga0302323_100066239 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → Holophagales → Holophagaceae → Geothrix | 3376 | Open in IMG/M |
| 3300031232|Ga0302323_100239294 | All Organisms → cellular organisms → Bacteria | 1854 | Open in IMG/M |
| 3300031232|Ga0302323_101841564 | Not Available | 686 | Open in IMG/M |
| 3300031232|Ga0302323_102787311 | Not Available | 558 | Open in IMG/M |
| 3300031238|Ga0265332_10138049 | Not Available | 1022 | Open in IMG/M |
| 3300031251|Ga0265327_10039117 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → Holophagales → Holophagaceae → Holophaga → Holophaga foetida | 2579 | Open in IMG/M |
| 3300031521|Ga0311364_10643728 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
| 3300031521|Ga0311364_11651654 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 632 | Open in IMG/M |
| 3300031521|Ga0311364_12009166 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300031521|Ga0311364_12129839 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → Holophagales → Holophagaceae → Geothrix → unclassified Geothrix → Geothrix sp. SG10 | 549 | Open in IMG/M |
| 3300031521|Ga0311364_12358900 | Not Available | 519 | Open in IMG/M |
| 3300031669|Ga0307375_10821710 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 523 | Open in IMG/M |
| 3300031681|Ga0318572_10329364 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300031681|Ga0318572_10396488 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → Holophagales → Holophagaceae → Geothrix → unclassified Geothrix → Geothrix sp. SG10 | 820 | Open in IMG/M |
| 3300031681|Ga0318572_10573540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → Holophagales → Holophagaceae → Geothrix → unclassified Geothrix → Geothrix sp. SG195 | 672 | Open in IMG/M |
| 3300031726|Ga0302321_100183179 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → Holophagales → Holophagaceae → Geothrix → unclassified Geothrix → Geothrix sp. SG10 | 2178 | Open in IMG/M |
| 3300031726|Ga0302321_100565977 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → Holophagales → Holophagaceae | 1262 | Open in IMG/M |
| 3300031726|Ga0302321_100835844 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → Holophagales → Holophagaceae → Geothrix → unclassified Geothrix → Geothrix sp. SG10 | 1040 | Open in IMG/M |
| 3300031726|Ga0302321_101099833 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300031726|Ga0302321_103165500 | Not Available | 536 | Open in IMG/M |
| 3300031726|Ga0302321_103485985 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300031726|Ga0302321_103639764 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → Holophagales → Holophagaceae → Geothrix → unclassified Geothrix → Geothrix sp. SG10 | 501 | Open in IMG/M |
| 3300031819|Ga0318568_10805453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Polaromonas → unclassified Polaromonas → Polaromonas sp. A23 | 583 | Open in IMG/M |
| 3300031821|Ga0318567_10066652 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → Holophagales → Holophagaceae → Geothrix → unclassified Geothrix → Geothrix sp. SG10 | 1895 | Open in IMG/M |
| (restricted) 3300031825|Ga0255338_1114599 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 877 | Open in IMG/M |
| 3300031902|Ga0302322_100063404 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3724 | Open in IMG/M |
| 3300031902|Ga0302322_101055030 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 981 | Open in IMG/M |
| 3300031902|Ga0302322_101361764 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300031902|Ga0302322_102312438 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300031902|Ga0302322_103065163 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → Holophagales → Holophagaceae → Geothrix → Geothrix fermentans | 574 | Open in IMG/M |
| 3300031902|Ga0302322_103807080 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → Holophagales → Holophagaceae → Geothrix → unclassified Geothrix → Geothrix sp. SG10 | 515 | Open in IMG/M |
| 3300031918|Ga0311367_11682840 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → Holophagales → Holophagaceae → Geothrix → unclassified Geothrix → Geothrix sp. SG10 | 619 | Open in IMG/M |
| 3300032275|Ga0315270_10014081 | All Organisms → cellular organisms → Bacteria | 4303 | Open in IMG/M |
| 3300032668|Ga0316230_1051836 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → Holophagales → Holophagaceae → Geothrix → unclassified Geothrix → Geothrix sp. SG10 | 1807 | Open in IMG/M |
| 3300032675|Ga0316225_1036655 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Peniculida → Parameciidae → Paramecium | 1946 | Open in IMG/M |
| 3300033408|Ga0316605_10003733 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → Holophagales → Holophagaceae → Geothrix | 8618 | Open in IMG/M |
| 3300033408|Ga0316605_12126336 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → Holophagales → Holophagaceae → Geothrix → unclassified Geothrix → Geothrix sp. SG10 | 546 | Open in IMG/M |
| 3300033821|Ga0334818_019200 | Not Available | 910 | Open in IMG/M |
| 3300034080|Ga0373897_028044 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → Holophagales → Holophagaceae → Geothrix → unclassified Geothrix → Geothrix sp. SG10 | 1013 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 34.23% |
| Anaerobic Enrichment Culture | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Anaerobic Enrichment Culture | 9.91% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 8.11% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 7.21% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 5.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.50% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.60% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 3.60% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.70% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.70% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.80% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.80% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.80% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.80% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.80% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.90% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.90% |
| Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 0.90% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.90% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.90% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.90% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.90% |
| Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 0.90% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000203 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 epilimnion | Environmental | Open in IMG/M |
| 3300000439 | Trout Bog Lake June 7 2007 Epilimnion (Trout Bog Lake Combined Assembly 48 Epilimnion Samples, Aug 2012 Assem) | Environmental | Open in IMG/M |
| 3300003852 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB | Environmental | Open in IMG/M |
| 3300003887 | Freshwater pond sediment microbial communities from Middleton WI, HM 5/6 enriched by Humin under anaerobic conditions -HM Sample 3 | Environmental | Open in IMG/M |
| 3300003888 | Freshwater pond sediment microbial communities from Midddleton WI, HM 3/4 enriched by Glucose under anaerobic conditions -HM Sample 2 | Environmental | Open in IMG/M |
| 3300005261 | Freshwater pond sediment microbial communities from Midddleton WI, HA 3/4 enriched by Glucose under anaerobic conditions -HA Sample 2 | Environmental | Open in IMG/M |
| 3300005263 | Freshwater pond sediment microbial communities from Middleton WI, enriched with Humic Acid Only under anaerobic conditions - HA Sample 3 | Environmental | Open in IMG/M |
| 3300006109 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH04Jul08 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300007959 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanotroph_Enrichment_5 | Environmental | Open in IMG/M |
| 3300009032 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-05 | Environmental | Open in IMG/M |
| 3300009175 | Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaG | Environmental | Open in IMG/M |
| 3300011442 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2 | Environmental | Open in IMG/M |
| 3300012228 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT700_2 | Environmental | Open in IMG/M |
| 3300014496 | Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016682 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES101 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020680 | Freshwater microbial communities from Trout Bog Lake, WI - 13JUN2007 hypolimnion | Environmental | Open in IMG/M |
| 3300020681 | Freshwater microbial communities from Trout Bog Lake, WI - 21JUL2009 hypolimnion | Environmental | Open in IMG/M |
| 3300020689 | Freshwater microbial communities from Trout Bog Lake, WI - 03AUG2009 epilimnion | Environmental | Open in IMG/M |
| 3300020700 | Freshwater microbial communities from Trout Bog Lake, WI - 17SEP2007 hypolimnion | Environmental | Open in IMG/M |
| 3300020708 | Freshwater microbial communities from Trout Bog Lake, WI - 05NOV2007 hypolimnion | Environmental | Open in IMG/M |
| 3300020712 | Freshwater microbial communities from Trout Bog Lake, WI - 03AUG2009 hypolimnion | Environmental | Open in IMG/M |
| 3300020719 | Freshwater microbial communities from Trout Bog Lake, WI - 18AUG2009 hypolimnion | Environmental | Open in IMG/M |
| 3300021069 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L224-25m | Environmental | Open in IMG/M |
| 3300021072 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L442-15m | Environmental | Open in IMG/M |
| 3300021126 | Freshwater microbial communities from Trout Bog Lake, WI - 24JUN2008 epilimnion | Environmental | Open in IMG/M |
| 3300021137 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 hypolimnion | Environmental | Open in IMG/M |
| 3300021354 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L221-5m | Environmental | Open in IMG/M |
| 3300021520 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L227-8m | Environmental | Open in IMG/M |
| 3300023075 | Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T-25 | Environmental | Open in IMG/M |
| 3300023254 | Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T75 | Environmental | Open in IMG/M |
| 3300024233 | Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T0 | Environmental | Open in IMG/M |
| 3300025366 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH15Jul08 (SPAdes) | Environmental | Open in IMG/M |
| 3300027265 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanotroph_Enrichment_5 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028069 | Peat soil microbial communities from Stordalen Mire, Sweden - G.F.S.T0 | Environmental | Open in IMG/M |
| 3300028736 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_3 | Environmental | Open in IMG/M |
| 3300028857 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N1_2 | Environmental | Open in IMG/M |
| 3300028868 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_3 | Environmental | Open in IMG/M |
| 3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300030000 | I_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030003 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_3 | Environmental | Open in IMG/M |
| 3300030048 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N1_3 | Environmental | Open in IMG/M |
| 3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030339 | III_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030838 | I_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030943 | III_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Host-Associated | Open in IMG/M |
| 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Host-Associated | Open in IMG/M |
| 3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031825 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - MeOH1_35cm_T4_195 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
| 3300032668 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18025 | Environmental | Open in IMG/M |
| 3300032675 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18015 | Environmental | Open in IMG/M |
| 3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
| 3300033821 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-2-X0 | Environmental | Open in IMG/M |
| 3300034080 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A5A4.1 | Engineered | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| TB18AUG2009E_0024855 | 3300000203 | Freshwater | MPNPPLNSDPARTVFRSFSSFRFLGFVQRLGAGEAA* |
| TBL_comb48_EPIDRAFT_10109506 | 3300000439 | Freshwater | MTPNPSLKSDPACIAFRSLSTFRYLGSAHRLGAGVAA* |
| Ga0031655_101183171 | 3300003852 | Freshwater Lake Sediment | PAKSGLTPPLNSDSACTVFRCFSSSRFLGSAHRLGADGAG* |
| Ga0062443_10756233 | 3300003887 | Anaerobic Enrichment Culture | PCVNPCSPNLSLKSDPACIAFRSLSAFSYLGSARHLGAGVAA* |
| Ga0062442_10029882 | 3300003888 | Anaerobic Enrichment Culture | MIDIFSHLPTRPNPALKSDPACIASRSLSSFRYLGSAHRLGAGVAA* |
| Ga0062442_10064556 | 3300003888 | Anaerobic Enrichment Culture | MREPPNPRLNSDPTCIAFRSLSTFCYLGFVQRLGAGGAG* |
| Ga0062442_10085331 | 3300003888 | Anaerobic Enrichment Culture | MRKSLLANLSLKSDPACIAFRSLSAFSYLGSARHLGAGVAA* |
| Ga0062442_10085337 | 3300003888 | Anaerobic Enrichment Culture | MVPGLPNPPLKSDPACIALRSLSAFRYHGSAHRLGAGVAA* |
| Ga0062442_10114227 | 3300003888 | Anaerobic Enrichment Culture | MEWTLAQSRLPNPPLKSDPACIAFRSLSTSRYPGSAHRLGAGVAA* |
| Ga0062442_10328552 | 3300003888 | Anaerobic Enrichment Culture | VPNPALHSDPACIAFRSLSTSRFLGFARRLGAGVAGELHSLG |
| Ga0062442_10800393 | 3300003888 | Anaerobic Enrichment Culture | MNHRLPNLPLNSDPACIAFRSLSASRFLGFARRLGAGGAG |
| Ga0071345_101335110 | 3300005261 | Anaerobic Enrichment Culture | MKQNHDFPPAPNPPLKSDPACIAFLSLSTSRYLGSARRLGAGVAA* |
| Ga0071345_10135364 | 3300005261 | Anaerobic Enrichment Culture | MQARGSNLSLKSDPACIAFRSLSSFRYHGSARRLGAGVAA* |
| Ga0071346_10131233 | 3300005263 | Anaerobic Enrichment Culture | PVNRTRPNPPLKSDPACIVFRSLSASRYLGSAHRLGAGGAA* |
| Ga0007870_10219573 | 3300006109 | Freshwater | LRNSLMPNLPLYPAPACITFRSISTTRFLGSARRLGAGVAG* |
| Ga0075021_108454321 | 3300006354 | Watersheds | PNPPLKSDPACIAFRSLSTSRYLGFAQRLGAGVAA* |
| Ga0075021_110694931 | 3300006354 | Watersheds | NYWAFVQAPNPPLKSDPACIAFRSLSTSRYLGSAHRLGAGVAA* |
| Ga0075521_101506811 | 3300006642 | Arctic Peat Soil | PNPPLNSDPACIVFRSFSSFVFLGFAHRLGAGGAG* |
| Ga0079306_11865522 | 3300007959 | Deep Subsurface | APNPSLKSDPACIAFRSLSMSRFLGSAQRLGAGEAG* |
| Ga0105048_109075151 | 3300009032 | Freshwater | NPSLNSDPACIAFRSFSSFRYLGFVQRLGAGGAG* |
| Ga0073936_103132831 | 3300009175 | Freshwater Lake Hypolimnion | PNPPLNSDPARTVSRSFSLFRFLGSAHRLGAGGAG* |
| Ga0137437_11840662 | 3300011442 | Soil | GGFQREGVPNPPLKSDPACIAFRSLSVFRYLGSAHRLGAGVAA* |
| Ga0137459_11936242 | 3300012228 | Soil | GGAPNPPLKSDPACIAFRSLSSFRYLGFAHRLGAGVAG* |
| Ga0182011_108887921 | 3300014496 | Fen | KTLSECVKMPNPPLNSDPARTAIRSFSSSRFLGFVHRLGAGGAG* |
| Ga0182019_101727233 | 3300014498 | Fen | NPPLKSDPACIAFRSLSNSRYLGSARRLGAGGAA* |
| Ga0182019_102489011 | 3300014498 | Fen | PVSNAPNSPLNSDPARTTLRSFSSSRFLGFVRRLDAGGAG* |
| Ga0182021_102365831 | 3300014502 | Fen | NSPLNSDPARIVFRSLSASHFLGFVHRLGAGGAG* |
| Ga0182021_136156702 | 3300014502 | Fen | PNPPLSSDPARTVSRSFSSFRFLGFVQRLDVGGAG* |
| Ga0182039_105375981 | 3300016422 | Soil | NPSVNPTPNLSLNPDPACIAFRSLSIFRFLGSAPRLGAGGAG |
| Ga0180044_10176171 | 3300016682 | Freshwater | GPNPPLNSGPARTVFRSFSSFRFLGSAQHLGSGVAG |
| Ga0182028_13692391 | 3300019788 | Fen | KKEKKIPLNSDPTCIVFLSLSASRFLRLRSPLGAGGAG |
| Ga0214215_1013954 | 3300020680 | Freshwater | MLMPNPPLNSDPARTVFRSFSSFRFLVFAHRLGAGRAG |
| Ga0214253_1005088 | 3300020681 | Freshwater | MPNPPLNSDPARTVFRSFSSFRFLGFVQRLGAGEAA |
| Ga0214210_10074254 | 3300020689 | Freshwater | SMPNPPLNSDPARTVFRSFSSFRFLGFVQRLGAGEAA |
| Ga0214225_10003924 | 3300020700 | Freshwater | MLMPNPPLNSDRARTVFRSFSSFRFLVFAHRLGAGRAG |
| Ga0214228_10049823 | 3300020708 | Freshwater | TLWQGHSMPNPPLNSDPARTVFRSFSSFRFLGFVQRLGAGEAA |
| Ga0214255_10131973 | 3300020712 | Freshwater | RCKVTPNPPLNSDPARTAFRSLSASRFLDSAQLLGAGGAG |
| Ga0214257_10006793 | 3300020719 | Freshwater | MTPNPSLKSDPACIAFRSLSTFRYLGSAHRLGAGVAA |
| Ga0194062_11126223 | 3300021069 | Anoxic Zone Freshwater | APNRVLKSDPARIAFRSLSAPGLLGSFQHLSAGGAA |
| Ga0194057_100246723 | 3300021072 | Anoxic Zone Freshwater | MSAIPVMPNPPLKSDPACIASRSLSAFRYLGSVHRLGAGVAA |
| Ga0214187_10078411 | 3300021126 | Freshwater | WQGHSMPNPPLNSDPARTVFRSFSSFRFLGFVQRLGAGEAA |
| Ga0214165_10361293 | 3300021137 | Freshwater | MIFYRSPNPLLNADSACIAFRSLLAFLFFGFAHRLGAG |
| Ga0194047_103280972 | 3300021354 | Anoxic Zone Freshwater | VAPNPQLNSDPACIDFRSLTTFVLLGFVHRLGAGGAG |
| Ga0194053_100410521 | 3300021520 | Anoxic Zone Freshwater | PNPQLNSDPACIGTRSFSSFVLLGSVQRLGAGVAG |
| Ga0224520_10204021 | 3300023075 | Soil | PNSPLNSDPARIVFRSLSASHFLGFVHRLGAGGAG |
| Ga0224520_10809511 | 3300023075 | Soil | AVVLPPAPNPPLNSDPARTIPRSFSSFRFLGFAQRLGAGGAG |
| Ga0224524_10234963 | 3300023254 | Soil | PNPPLNSDPARTIFRSLSASGFLGFVQRLGAGGAG |
| Ga0224521_10550791 | 3300024233 | Soil | VLPPAPNPPLNSDPARTIPRSFSSFRFLGFAQRLGAGGAG |
| Ga0224521_11065021 | 3300024233 | Soil | LPNPPLNSDPARTVFRSLSPSRFLGSAQRLGAGGAG |
| Ga0208505_10047912 | 3300025366 | Freshwater | MPNLPLYPAPACITFRSISTTRFLGSARRLGAGVAA |
| Ga0208789_10012674 | 3300027265 | Deep Subsurface | MAPNLPLNSDPACIVFRSFSSFVFLGSVHRLGAGGAG |
| Ga0209068_109453692 | 3300027894 | Watersheds | PNLTLKSDPACIAFRSLSTSRYLGFVHRLGAGGAA |
| Ga0255358_10009437 | 3300028069 | Soil | MAVDSRPNPPLKSDPACIAFRSLSNSRYLGSARRLGAGGAA |
| Ga0255358_10009439 | 3300028069 | Soil | MAGDRPNPPLKSDPACIAFHSLSTSRYPGSARRLGAGVAA |
| Ga0302214_10210892 | 3300028736 | Fen | MQRSNLSLKSDPACIAFRSFSSFRYLGFVQRLGAGGAG |
| Ga0302289_10597563 | 3300028857 | Fen | LGALSNPALNSDPACIAFRSLSTFRYLGFVHRLGAGGAG |
| Ga0302163_101266782 | 3300028868 | Fen | HQPNPPLNSDPACIAFRSLSTSRFLGFAQRLGAGGAG |
| Ga0311334_114013142 | 3300029987 | Fen | MPNPPLKSDPACIAFRSLSTSRYLGSAHRLGAGVAG |
| Ga0311336_105313453 | 3300029990 | Fen | PEAPNPPLNSDPACIAFRSLSTSRYLGSAQRLGAGAAG |
| Ga0311337_100517964 | 3300030000 | Fen | MITLRPNPPLKSDPACIAFRSLSSFRYLGSAHRLGAGVAA |
| Ga0311337_114563261 | 3300030000 | Fen | VRPNPPLNSDPARIVFRSLSSSRFLGFAHRLGAGVAG |
| Ga0311350_100321002 | 3300030002 | Fen | MRPNPPLKSDPACIAFRPLSTSRYLGFAHRLGAGVAA |
| Ga0311350_106289823 | 3300030002 | Fen | TKVQVSPNLSLKSDPACIAFRSLSSFRYLGFAHRLGTGAAA |
| Ga0302172_101596781 | 3300030003 | Fen | NARNPTMQRSNLSLKSDPACIAFRSFSSFRYLGFVQRLGAGGAG |
| Ga0302273_12338682 | 3300030048 | Bog | TMQRSNLSLKSDPACIAFRSFSSFRYLGFVQRLGAGGAG |
| Ga0311349_108713681 | 3300030294 | Fen | NALPNLPLNSDPARTVFRSFSSFRFLGSVHRLGAGGAG |
| Ga0311360_112313211 | 3300030339 | Bog | RLGALANPALNSDPAYIAFRSLSTSRFLGSVQRLGAGGAG |
| Ga0311360_114825632 | 3300030339 | Bog | RPNLALKSDPACIAFRSLSTSRYLGSAHRLGAGGAA |
| Ga0311335_106276961 | 3300030838 | Fen | VHEHPPADLQLNSDPACIAFRSLSAFRYLGSAQRLGAGGAG |
| Ga0311335_106576572 | 3300030838 | Fen | SSWPNPPLNSDPACIAFRSLSTSRFLGSAQRLGAGGAG |
| Ga0311366_105057961 | 3300030943 | Fen | APNLSLKSDPACIAFRSLSTFCYLGSAHRLGAGVAA |
| Ga0311366_116944061 | 3300030943 | Fen | RPNPPLNSDPARIVFRSLSSSRFLGFAHRLGAGVAG |
| Ga0302323_1000662393 | 3300031232 | Fen | MPNPPLNSDPACIVLRSFSSFVFLGFVRRFAAGGAG |
| Ga0302323_1002392941 | 3300031232 | Fen | MITLRPNPPLKSDPACIAFRSLSSFRYLGSAHRLG |
| Ga0302323_1018415642 | 3300031232 | Fen | SIVNLASNLSLTSDHARTVLHSFSSFRFLSSAQRLGAGGAG |
| Ga0302323_1027873111 | 3300031232 | Fen | YAPTKPPNPPLKSDPACIAFRSLSAFRYLGSAQRLAAGVAA |
| Ga0265332_101380491 | 3300031238 | Rhizosphere | GFQVPNTSLNSDPARTVFRSFSSSRFLDSARRLGAGGAG |
| Ga0265327_100391173 | 3300031251 | Rhizosphere | MLVRSRGPNPPLNSDPADIAFRSFSSFRFLGFAQRLGAGVAG |
| Ga0311364_106437281 | 3300031521 | Fen | NLSTMATMPNPLLKSDPAYPVFHSFSPSRFLGSARRLGAGEAG |
| Ga0311364_116516542 | 3300031521 | Fen | SNLIHALPNPPLNSDPARTVFRSLSSSRFLGFVQRLDAGGAG |
| Ga0311364_120091662 | 3300031521 | Fen | MPTPPLNSASACIAFRSLSSFLYLGSARCLGAGGAA |
| Ga0311364_121298391 | 3300031521 | Fen | RSNSPLNSDPACIAFRSLSNSRFLGSAQRLGAGAAG |
| Ga0311364_123589001 | 3300031521 | Fen | MIILPPRPNPPLNSDPAYIVFRSLSASRFLGFVHRLGAG |
| Ga0307375_108217102 | 3300031669 | Soil | MVFLAHAPNPSLNSDPACVVFRSFSSFGFLGFVHRLGAGGA |
| Ga0318572_103293641 | 3300031681 | Soil | PNLSLKSDPACIAFRSLSAFRYLGSAHRLGAGVAA |
| Ga0318572_103964881 | 3300031681 | Soil | MYTEASFREAPNPPLKSDPACIAFRSLSIFRYLGSAHRLGAGAAA |
| Ga0318572_105735402 | 3300031681 | Soil | SVPEEMPNPSLNSDPACIAFRSLSTFRYLGSALCLGAGGAG |
| Ga0302321_1001831793 | 3300031726 | Fen | MTNNHRPNPALKSDPACIAFRSLSSFRYLGSVHRLGAGVAA |
| Ga0302321_1005659771 | 3300031726 | Fen | DSLAGRPNPPLKSDPACIAFRSLSTSRYLGSARHLGAGVAA |
| Ga0302321_1008358441 | 3300031726 | Fen | PNPPLNSDPACIAFRSLSAFRFLGFAHRLGAGGAG |
| Ga0302321_1010998331 | 3300031726 | Fen | RPNLALKSDPACIAFRSLSTLRYLGSVHRLGAGVAA |
| Ga0302321_1031655001 | 3300031726 | Fen | LSLPNPPLKSDPACIAFPSLSAFRYLGSAHRLGAGVAA |
| Ga0302321_1034859851 | 3300031726 | Fen | PNPPLNSDPACIVFRSLSTSRFPGFVQRLGAGVAG |
| Ga0302321_1036397641 | 3300031726 | Fen | MVKAFPVAPNPPLNSDPACIVFRSFSSFVFLGFVQRLGAG |
| Ga0318568_108054531 | 3300031819 | Soil | PNRTLKSDPACSAFRSLSVSRYLGSAQRLGAGVAA |
| Ga0318567_100666521 | 3300031821 | Soil | EVLASLPNPALNSDPACIAFRSFSSSRFLGFVYRLGAGGAG |
| (restricted) Ga0255338_11145992 | 3300031825 | Sandy Soil | PNPPLNSDLACIAFRSLSVSRFLGFVQRLGAGVAG |
| Ga0302322_1000634042 | 3300031902 | Fen | MESTPAPNPSLKSDPACISSRSLSLSCYLGSAHRLGAGVAA |
| Ga0302322_1010550303 | 3300031902 | Fen | MDPACIVFRSLSTARFLGFVQRLGAGGAGELHSLGLSHG |
| Ga0302322_1013617641 | 3300031902 | Fen | PNPSLKSDPTCIAFRSLSAFCYLGSAHRLGAGVAA |
| Ga0302322_1023124381 | 3300031902 | Fen | NLSLNSDPACIAFRSVSTFTFLGFARRLGAGGAGPFQSLDRQ |
| Ga0302322_1030651631 | 3300031902 | Fen | EGPNLPLKSDPACIAFRPLSSARYPGSAHRLGAGVAA |
| Ga0302322_1038070802 | 3300031902 | Fen | RPNPQLNSDPACIVFRSLSASRFLGSVQRLGAGGAG |
| Ga0311367_116828401 | 3300031918 | Fen | HRPNPALKSDPACIAFRSLSAFRYLGSAHRFGAGVAA |
| Ga0315270_100140815 | 3300032275 | Sediment | MPNPPLKSDPACIAFRSLSSFRYPGSARRLGAGGAA |
| Ga0316230_10518364 | 3300032668 | Freshwater | TPNPPLNSDPARTAFRSLSASRFLDSAQLLGAGGAG |
| Ga0316225_10366556 | 3300032675 | Freshwater | PEPNPPLNSDPARIVIFPLSSSVFLGFVQLSFAGVAG |
| Ga0316605_100037332 | 3300033408 | Soil | MPNLSLKSDPACIAFRSLSTSCYLGFAHRLGAGVAA |
| Ga0316605_121263361 | 3300033408 | Soil | PNPSLNPDPACITFRSLSTSRFHGFVQRLGAGGSG |
| Ga0334818_019200_2_121 | 3300033821 | Soil | MAEYCRVVPNLSLKSDPACIAFRSLSTFRYLGFAHRLGAG |
| Ga0373897_028044_3_155 | 3300034080 | Sediment Slurry | AGILAIYFLMQSNVRPNPPLKSDPACIAFRSLSTSRYLGSARRLGAGAAA |
| ⦗Top⦘ |