


| Basic Information | |
|---|---|
| Family ID | F085710 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 111 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MDYNDYYDDIYLDIYLEFGADSVSDPAYAEQLAKDKGVR |
| Number of Associated Samples | 75 |
| Number of Associated Scaffolds | 111 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 75.68 % |
| % of genes near scaffold ends (potentially truncated) | 21.62 % |
| % of genes from short scaffolds (< 2000 bps) | 69.37 % |
| Associated GOLD sequencing projects | 70 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.68 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (54.054 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater (16.216 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.721 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (53.153 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.78% β-sheet: 0.00% Coil/Unstructured: 55.22% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.68 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 111 Family Scaffolds |
|---|---|---|
| PF13640 | 2OG-FeII_Oxy_3 | 3.60 |
| PF06067 | DUF932 | 3.60 |
| PF02675 | AdoMet_dc | 1.80 |
| PF02867 | Ribonuc_red_lgC | 1.80 |
| PF00255 | GSHPx | 0.90 |
| PF00041 | fn3 | 0.90 |
| PF01555 | N6_N4_Mtase | 0.90 |
| PF13155 | Toprim_2 | 0.90 |
| PF02945 | Endonuclease_7 | 0.90 |
| PF01926 | MMR_HSR1 | 0.90 |
| COG ID | Name | Functional Category | % Frequency in 111 Family Scaffolds |
|---|---|---|---|
| COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 1.80 |
| COG1586 | S-adenosylmethionine decarboxylase | Amino acid transport and metabolism [E] | 1.80 |
| COG0386 | Thioredoxin/glutathione peroxidase BtuE, reduces lipid peroxides | Defense mechanisms [V] | 0.90 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.90 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.90 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.90 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 54.05 % |
| All Organisms | root | All Organisms | 45.95 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001282|B570J14230_10018528 | Not Available | 2569 | Open in IMG/M |
| 3300001843|RCM34_1065372 | Not Available | 803 | Open in IMG/M |
| 3300002835|B570J40625_100048512 | Not Available | 6105 | Open in IMG/M |
| 3300005580|Ga0049083_10086196 | All Organisms → Viruses → Predicted Viral | 1093 | Open in IMG/M |
| 3300005662|Ga0078894_11596436 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
| 3300005805|Ga0079957_1053198 | Not Available | 2462 | Open in IMG/M |
| 3300005805|Ga0079957_1107292 | Not Available | 1507 | Open in IMG/M |
| 3300005942|Ga0070742_10027036 | All Organisms → Viruses → Predicted Viral | 1532 | Open in IMG/M |
| 3300006030|Ga0075470_10198616 | Not Available | 575 | Open in IMG/M |
| 3300006030|Ga0075470_10235159 | Not Available | 519 | Open in IMG/M |
| 3300006484|Ga0070744_10008330 | Not Available | 3090 | Open in IMG/M |
| 3300006641|Ga0075471_10263800 | Not Available | 883 | Open in IMG/M |
| 3300006641|Ga0075471_10303073 | Not Available | 813 | Open in IMG/M |
| 3300006641|Ga0075471_10376452 | Not Available | 715 | Open in IMG/M |
| 3300007171|Ga0102977_1056216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1184 | Open in IMG/M |
| 3300007212|Ga0103958_1141320 | Not Available | 1657 | Open in IMG/M |
| 3300007559|Ga0102828_1064689 | Not Available | 863 | Open in IMG/M |
| 3300007639|Ga0102865_1108640 | Not Available | 829 | Open in IMG/M |
| 3300007647|Ga0102855_1041944 | All Organisms → Viruses → Predicted Viral | 1249 | Open in IMG/M |
| 3300007708|Ga0102859_1187096 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 614 | Open in IMG/M |
| 3300007862|Ga0105737_1101738 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 726 | Open in IMG/M |
| 3300008107|Ga0114340_1001257 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 25585 | Open in IMG/M |
| 3300008107|Ga0114340_1002965 | Not Available | 13259 | Open in IMG/M |
| 3300008107|Ga0114340_1007121 | Not Available | 8235 | Open in IMG/M |
| 3300008107|Ga0114340_1107007 | All Organisms → Viruses → Predicted Viral | 1685 | Open in IMG/M |
| 3300008107|Ga0114340_1137355 | Not Available | 920 | Open in IMG/M |
| 3300008107|Ga0114340_1205772 | Not Available | 654 | Open in IMG/M |
| 3300008110|Ga0114343_1143312 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 772 | Open in IMG/M |
| 3300008113|Ga0114346_1181299 | Not Available | 863 | Open in IMG/M |
| 3300008113|Ga0114346_1247235 | Not Available | 666 | Open in IMG/M |
| 3300008116|Ga0114350_1002364 | Not Available | 12906 | Open in IMG/M |
| 3300008116|Ga0114350_1014209 | Not Available | 5824 | Open in IMG/M |
| 3300008120|Ga0114355_1056777 | All Organisms → Viruses → Predicted Viral | 1743 | Open in IMG/M |
| 3300008962|Ga0104242_1007010 | Not Available | 2028 | Open in IMG/M |
| 3300008962|Ga0104242_1007558 | Not Available | 1944 | Open in IMG/M |
| 3300008962|Ga0104242_1015245 | Not Available | 1343 | Open in IMG/M |
| 3300009161|Ga0114966_10008135 | Not Available | 8556 | Open in IMG/M |
| 3300009194|Ga0114983_1013451 | All Organisms → Viruses → Predicted Viral | 2314 | Open in IMG/M |
| 3300009194|Ga0114983_1029729 | All Organisms → Viruses → Predicted Viral | 1377 | Open in IMG/M |
| 3300009233|Ga0103856_10093726 | Not Available | 566 | Open in IMG/M |
| 3300009233|Ga0103856_10114220 | Not Available | 519 | Open in IMG/M |
| 3300009419|Ga0114982_1292876 | Not Available | 510 | Open in IMG/M |
| 3300010354|Ga0129333_10008450 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9717 | Open in IMG/M |
| 3300010354|Ga0129333_10021483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 6128 | Open in IMG/M |
| 3300010354|Ga0129333_10031996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 4966 | Open in IMG/M |
| 3300010354|Ga0129333_10040493 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4388 | Open in IMG/M |
| 3300010354|Ga0129333_10231713 | Not Available | 1671 | Open in IMG/M |
| 3300010354|Ga0129333_10339514 | All Organisms → Viruses → Predicted Viral | 1338 | Open in IMG/M |
| 3300010354|Ga0129333_11323968 | Not Available | 594 | Open in IMG/M |
| 3300010354|Ga0129333_11539250 | Not Available | 544 | Open in IMG/M |
| 3300010354|Ga0129333_11757246 | Not Available | 503 | Open in IMG/M |
| 3300010885|Ga0133913_11619623 | All Organisms → Viruses → Predicted Viral | 1632 | Open in IMG/M |
| 3300012000|Ga0119951_1004654 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6730 | Open in IMG/M |
| 3300012663|Ga0157203_1000021 | Not Available | 66216 | Open in IMG/M |
| 3300012663|Ga0157203_1001153 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6659 | Open in IMG/M |
| 3300012714|Ga0157601_1185361 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 609 | Open in IMG/M |
| 3300012720|Ga0157613_1207014 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 744 | Open in IMG/M |
| 3300012968|Ga0129337_1177116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 2765 | Open in IMG/M |
| 3300012968|Ga0129337_1205250 | All Organisms → Viruses → Predicted Viral | 1151 | Open in IMG/M |
| 3300013005|Ga0164292_10046205 | Not Available | 3446 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10268477 | All Organisms → Viruses → Predicted Viral | 1235 | Open in IMG/M |
| 3300020141|Ga0211732_1358029 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
| 3300020159|Ga0211734_10643844 | Not Available | 879 | Open in IMG/M |
| 3300020493|Ga0208591_1016619 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 966 | Open in IMG/M |
| 3300021325|Ga0210301_1229848 | Not Available | 519 | Open in IMG/M |
| 3300021519|Ga0194048_10015027 | All Organisms → Viruses → Predicted Viral | 3446 | Open in IMG/M |
| 3300021961|Ga0222714_10103351 | All Organisms → Viruses → Predicted Viral | 1797 | Open in IMG/M |
| 3300022748|Ga0228702_1139372 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 536 | Open in IMG/M |
| 3300023174|Ga0214921_10006379 | All Organisms → Viruses | 16205 | Open in IMG/M |
| 3300024289|Ga0255147_1000951 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7499 | Open in IMG/M |
| 3300024289|Ga0255147_1095707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 548 | Open in IMG/M |
| 3300024289|Ga0255147_1107086 | Not Available | 511 | Open in IMG/M |
| 3300024346|Ga0244775_11398140 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
| 3300024348|Ga0244776_10261702 | All Organisms → Viruses → Predicted Viral | 1198 | Open in IMG/M |
| 3300024352|Ga0255142_1064947 | Not Available | 554 | Open in IMG/M |
| 3300024484|Ga0256332_1042640 | Not Available | 975 | Open in IMG/M |
| 3300024484|Ga0256332_1121092 | Not Available | 560 | Open in IMG/M |
| 3300024495|Ga0255164_1003517 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2947 | Open in IMG/M |
| 3300024561|Ga0255288_1042915 | Not Available | 1023 | Open in IMG/M |
| 3300024562|Ga0256336_1042700 | Not Available | 983 | Open in IMG/M |
| 3300024570|Ga0255276_1068026 | Not Available | 963 | Open in IMG/M |
| 3300024572|Ga0255268_1032991 | Not Available | 1294 | Open in IMG/M |
| 3300024574|Ga0255275_1211374 | Not Available | 514 | Open in IMG/M |
| 3300024857|Ga0256339_1067354 | Not Available | 750 | Open in IMG/M |
| 3300024867|Ga0255267_1051547 | Not Available | 960 | Open in IMG/M |
| 3300025585|Ga0208546_1115154 | Not Available | 593 | Open in IMG/M |
| 3300025872|Ga0208783_10300484 | Not Available | 638 | Open in IMG/M |
| 3300026473|Ga0255166_1006028 | All Organisms → Viruses → Predicted Viral | 2826 | Open in IMG/M |
| 3300027217|Ga0208928_1032092 | Not Available | 827 | Open in IMG/M |
| 3300027467|Ga0255154_1057644 | Not Available | 867 | Open in IMG/M |
| 3300027563|Ga0209552_1123642 | Not Available | 679 | Open in IMG/M |
| 3300027586|Ga0208966_1092631 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 833 | Open in IMG/M |
| 3300027710|Ga0209599_10018432 | All Organisms → Viruses → Predicted Viral | 1994 | Open in IMG/M |
| 3300027710|Ga0209599_10037831 | All Organisms → Viruses → Predicted Viral | 1295 | Open in IMG/M |
| 3300027754|Ga0209596_1005319 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9543 | Open in IMG/M |
| 3300027754|Ga0209596_1020422 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3980 | Open in IMG/M |
| 3300028112|Ga0256335_1024349 | All Organisms → Viruses → Predicted Viral | 1571 | Open in IMG/M |
| 3300028286|Ga0256331_1047028 | Not Available | 978 | Open in IMG/M |
| 3300031758|Ga0315907_10003962 | Not Available | 16938 | Open in IMG/M |
| 3300031758|Ga0315907_10052383 | All Organisms → Viruses → Predicted Viral | 3587 | Open in IMG/M |
| 3300031758|Ga0315907_10419922 | All Organisms → Viruses → Predicted Viral | 1074 | Open in IMG/M |
| 3300031758|Ga0315907_11180409 | Not Available | 537 | Open in IMG/M |
| 3300031857|Ga0315909_10006383 | Not Available | 13317 | Open in IMG/M |
| 3300031951|Ga0315904_10291343 | Not Available | 1536 | Open in IMG/M |
| 3300031951|Ga0315904_10407964 | All Organisms → Viruses → Predicted Viral | 1229 | Open in IMG/M |
| 3300033521|Ga0316616_100705474 | All Organisms → Viruses → Predicted Viral | 1209 | Open in IMG/M |
| 3300033557|Ga0316617_100060441 | All Organisms → Viruses → Predicted Viral | 2426 | Open in IMG/M |
| 3300033557|Ga0316617_100995056 | Not Available | 819 | Open in IMG/M |
| 3300033557|Ga0316617_101568142 | Not Available | 666 | Open in IMG/M |
| 3300033994|Ga0334996_0048617 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2642 | Open in IMG/M |
| 3300034523|Ga0310143_00917 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 11783 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 16.22% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 10.81% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 8.11% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 8.11% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 6.31% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 6.31% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.41% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.41% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 4.50% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.60% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.60% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.70% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.70% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 1.80% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.80% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.80% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.80% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 1.80% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.90% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.90% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.90% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.90% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.90% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.90% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.90% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.90% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
| 3300001843 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM34, ROCA_DNA218_2.0um_bLM_C_2b | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300005942 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757 | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007171 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface layer) 8 sequencing projects | Environmental | Open in IMG/M |
| 3300007212 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Bottom layer) 7 sequencing projects | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007639 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02 | Environmental | Open in IMG/M |
| 3300007647 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02 | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300007862 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_0.2um | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009194 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT | Environmental | Open in IMG/M |
| 3300009233 | Microbial communities of water from Amazon river, Brazil - RCM9 | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
| 3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
| 3300012714 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES125 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012720 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES141 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012968 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020493 | Freshwater microbial communities from Lake Mendota, WI - 14NOV2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021325 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1033 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300022748 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MG | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300024352 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_0h | Environmental | Open in IMG/M |
| 3300024484 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024495 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8d | Environmental | Open in IMG/M |
| 3300024561 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024562 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024570 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024572 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024574 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024857 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024867 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025872 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026473 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8d | Environmental | Open in IMG/M |
| 3300027217 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027467 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8h | Environmental | Open in IMG/M |
| 3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028112 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028286 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300034523 | Fracking water microbial communities from deep shales in Oklahoma, United States - K-4-A | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J14230_100185285 | 3300001282 | Freshwater | MDYNDYYDEIYLEIYEEFGAESVSDPAYAESLKK* |
| RCM34_10653721 | 3300001843 | Marine Plankton | MFNEYDEYYNDIYLDIYETFGAEAVSDPAYAEQLLKEGK* |
| B570J40625_10004851213 | 3300002835 | Freshwater | LKGVQMDYNDYYDEIYLEIYEEFGAESVSDPAYAESLKK* |
| Ga0049083_100861961 | 3300005580 | Freshwater Lentic | MNDYYDDIYLEIYEEFGASAVSDPDYAEQLAKDKGVR* |
| Ga0078894_115964362 | 3300005662 | Freshwater Lake | MNDYYDDIYLDIYLEFGADSVSDPVYAEQLAKDKGVR* |
| Ga0079957_10531985 | 3300005805 | Lake | MDYLDYQDEIYLDIYLEFGADSVSDPDYAEQLLKKGNK* |
| Ga0079957_11072923 | 3300005805 | Lake | MNYDNYYDEIYTDIYLEFGAEAVSDPNYAEQLLNRKDK* |
| Ga0070742_100270366 | 3300005942 | Estuarine | LGVILMNDYYDDIYLDIYLEFGADSVSDPVYAEQLAKDKGVR* |
| Ga0075470_101986162 | 3300006030 | Aqueous | MDYLDYYDEVYTDIYLEFGADSVSDPNYAEQLLKERGQNVR* |
| Ga0075470_102351592 | 3300006030 | Aqueous | MDFLDYQDEIYLDIYLEFGETSVSDVKYAEQLRKEKNA* |
| Ga0070744_1000833010 | 3300006484 | Estuarine | LGVIPMNDYYDDIYLDIYLEFGADSVSDPVYAEQLAKDKGVR* |
| Ga0075471_102638003 | 3300006641 | Aqueous | MNDYLDYQDEIYLDIYLEFGADSVSDPEYAEQLLRKEIA* |
| Ga0075471_103030731 | 3300006641 | Aqueous | MDYFDYYDEVYTDIYLEFGASAVSDPDYAEELLRDKGHTR* |
| Ga0075471_103764521 | 3300006641 | Aqueous | DYYDEVYTDIYLEFGADSVSDPNYAEELLKKGNK* |
| Ga0102977_10562164 | 3300007171 | Freshwater Lake | MSDYFDYYDEIYTDIYLEFGAEAVSDPAYAEELLSKSQR* |
| Ga0103958_11413204 | 3300007212 | Freshwater Lake | MDYLDYYDEVYTDIYLEFGADAVSDPAHAEALLGKSQN* |
| Ga0102828_10646894 | 3300007559 | Estuarine | YYDDIYLDIYLEFGADSVSDPVYAEKLAKDKGVR* |
| Ga0102865_11086404 | 3300007639 | Estuarine | MNDYYDEIYLDIYLEFGADSVSDPVYAEQLAKDKGVR* |
| Ga0102855_10419445 | 3300007647 | Estuarine | MLLLEVGSNLMNDSYDDIYLDIYLEFGADSVSDPVYAEQLAKDKGVR* |
| Ga0102859_11870961 | 3300007708 | Estuarine | MDYNDYYDDIYLDIYLEFGADSVSNPAYAEQLAKDKGVR* |
| Ga0105737_11017383 | 3300007862 | Estuary Water | MLLLEVGSNLMIDYYDDIYLDIYLEFGADSVSDPVYAEQLAKDKGVR* |
| Ga0114340_100125710 | 3300008107 | Freshwater, Plankton | MNDYYDDIYLDIYLEFGADSVSDPDYAEQLAKDKGVR* |
| Ga0114340_100296537 | 3300008107 | Freshwater, Plankton | MDYLDYYDEVYTDIYLEFGADSVSDPNYAEQLLKERK* |
| Ga0114340_10071214 | 3300008107 | Freshwater, Plankton | MDYNEYYDEIYLEIYEEFGAESVSDPAYAESLKK* |
| Ga0114340_11070075 | 3300008107 | Freshwater, Plankton | MDFNEYYDDIYLEIYEEFGASAVSDPDYAEQLAKDKGVR* |
| Ga0114340_11373551 | 3300008107 | Freshwater, Plankton | MNDYLDYQDEIYLDIYLEFGADSVSDPDYAEQLLKERNR* |
| Ga0114340_12057722 | 3300008107 | Freshwater, Plankton | MDFNEYYDDIYLDIYEEFGASAVSDPAYAEQLAKDKGVR* |
| Ga0114343_11433122 | 3300008110 | Freshwater, Plankton | MNDYYDDIYLDIYLGFGADSVSGPVYAEQLAKDKGVR* |
| Ga0114346_11812991 | 3300008113 | Freshwater, Plankton | MDYNDYYNEIYLDIFEEFGDSAVSDVSYAKELQSKKVGK* |
| Ga0114346_12472351 | 3300008113 | Freshwater, Plankton | MDYNEYYDDIYLEIYEEFGASAVSDPDYAEQLAKDKGVR* |
| Ga0114350_100236415 | 3300008116 | Freshwater, Plankton | MDYLDYQDEIYLDIYLEFGAEAVTDPAYAEELLSKSQF* |
| Ga0114350_10142099 | 3300008116 | Freshwater, Plankton | MDYFDYYDEVYTDIYLEFGADSVSDPAHAEALLGKSQN* |
| Ga0114355_10567774 | 3300008120 | Freshwater, Plankton | MDFNEYYDEIYLDIYEEFGASAVSDPAYAEQLAKDKGVR* |
| Ga0104242_10070103 | 3300008962 | Freshwater | MDYNDYYDDIYLDIYLEFGSDSVSDPAYAEQLAKDKGVR* |
| Ga0104242_10075584 | 3300008962 | Freshwater | MDYNDYYDEIYLDIYLEFGADSVSDPDYAEQLSHAKGVK* |
| Ga0104242_10152451 | 3300008962 | Freshwater | MDYNDYYDDIYLEIYEEFGADSVSNPAYAEQLAKDKGVR* |
| Ga0114966_1000813511 | 3300009161 | Freshwater Lake | MDYEDYYNDIYLDIYLEFGADSVSNPAYAEQLAKDKGVR* |
| Ga0114983_10134511 | 3300009194 | Deep Subsurface | LMDYNEYYDEIYLEIYEEFGADSVSDPSYAESLKGNK* |
| Ga0114983_10297292 | 3300009194 | Deep Subsurface | MDYNEYYDEIYLEIYEEFGADSVSDPAYAESLKGNK* |
| Ga0103856_100937262 | 3300009233 | River Water | MYNEYDEYYNDIYLDIYETFGAEAVSDPAYAEQLLKEGK* |
| Ga0103856_101142202 | 3300009233 | River Water | MSDYLDYLDDIYLDIYETFGDKSVSDPNYAKELLAERNK* |
| Ga0114982_12928763 | 3300009419 | Deep Subsurface | MDYNEYYDEIYLEIYEEFGADSVSDPSYAESLKGNK* |
| Ga0129333_100084507 | 3300010354 | Freshwater To Marine Saline Gradient | MDYNDYYDEIYLDIYLEFGADSVSDPAYAESLLKKEGI* |
| Ga0129333_1002148314 | 3300010354 | Freshwater To Marine Saline Gradient | MDYNDYYDEVYLDIYLEFGADAVSDPSYAEDLLSKSQK* |
| Ga0129333_100319968 | 3300010354 | Freshwater To Marine Saline Gradient | MDYNDYYDEIYTDIYLEFGSEAVSDPAHAQNLLGKSQS* |
| Ga0129333_1004049311 | 3300010354 | Freshwater To Marine Saline Gradient | MNYDDYYDEIYTDIYLEFGAEAVSDPNYAEQLLNRKDK* |
| Ga0129333_102317132 | 3300010354 | Freshwater To Marine Saline Gradient | MDYNDYYDDIYLDIYLEFGADSVSDPDYAEQLAHAKGVK* |
| Ga0129333_103395144 | 3300010354 | Freshwater To Marine Saline Gradient | MDYLDYYDEVYTDIYLEFGSEAVSDPAHAEALLGKSQA* |
| Ga0129333_113239682 | 3300010354 | Freshwater To Marine Saline Gradient | MDYFDYYDEVYTDIYLEFGADAVSDPAHAEELLGKSHS* |
| Ga0129333_115392501 | 3300010354 | Freshwater To Marine Saline Gradient | MDYFDYYDEVYTDIYLEFGAEAVSDPNYAEELLNRKDK* |
| Ga0129333_117572461 | 3300010354 | Freshwater To Marine Saline Gradient | MDYLDYQDEIYLDIYLEFGADSVSDPDYAESLLKKEGI* |
| Ga0133913_116196236 | 3300010885 | Freshwater Lake | MDDYYDEIYLDIYLEFGADSVSDPVYAEQLAKDKGVR* |
| Ga0119951_100465412 | 3300012000 | Freshwater | MDYNDYYDEIYLDIYLEFGADSVSDPDYAEQLAHAKGVK* |
| Ga0157203_100002110 | 3300012663 | Freshwater | MDYNEYYDEIYLEIYEEFGAQSVSDPAYAESLKK* |
| Ga0157203_100115318 | 3300012663 | Freshwater | MLLLEVGSNLMNDYYDEIYLDIYLEFGADSVSDPAYAEQLAKDKGVR* |
| Ga0157601_11853613 | 3300012714 | Freshwater | MLLLEVGSNLMNDYYDDIYLDIYLEFGADSVSDPVYAEQLAKDKGVR* |
| Ga0157613_12070144 | 3300012720 | Freshwater | EVGSNLMNDYYDDIYLDIYLEFGADSVSDPVYAEQLAKDKGVR* |
| Ga0129337_11771168 | 3300012968 | Aqueous | LGLTMDYNDYYDEVYLDIYLEFGADAVSDPSYAEDLLSKSQK* |
| Ga0129337_12052506 | 3300012968 | Aqueous | LVLTMDYNDYYDDIYLDIYLEFGADSVSDPDYAEQLAHAKGVK* |
| Ga0164292_1004620514 | 3300013005 | Freshwater | NDYYDDIYLDIYLEFGADSVSDPVYAEQLAKDKGVR* |
| (restricted) Ga0172372_102684774 | 3300013132 | Freshwater | MYNEYDEYLNDIYLDIYETFGAEAVTDPAYAEQLLKKGY* |
| Ga0211732_13580292 | 3300020141 | Freshwater | MNDYYDDIYLDIYLEFGADSVSDPVYAEQLAKDKGVR |
| Ga0211734_106438443 | 3300020159 | Freshwater | MDYNEYYDDIYLEIYEEFGADAVSDPSYAESLKGNK |
| Ga0208591_10166195 | 3300020493 | Freshwater | MNDYYDDIYLEIYEEFGASAVSDPDYAEQLAKDKGVR |
| Ga0210301_12298481 | 3300021325 | Estuarine | MDYNDYYDDIYLDIYLEFGADSVSDPAYAEQLAKDKGVR |
| Ga0194048_1001502714 | 3300021519 | Anoxic Zone Freshwater | MDYDDYYNDIYLEIYEEFGADSVSNPAYAEQLAKDKGVR |
| Ga0222714_101033512 | 3300021961 | Estuarine Water | MDYNDYYDDIYLDIYLEFGADSVTDPAYAEQLAKEKGVR |
| Ga0228702_11393721 | 3300022748 | Freshwater | MNEYFDYMDEIYLDIYEEFGASAVSDPAYAEELKEKRNA |
| Ga0214921_1000637917 | 3300023174 | Freshwater | MDYNDYYDDIYLEIYEEFGADSVSNPAYAEQLAKDKGVR |
| Ga0255147_100095110 | 3300024289 | Freshwater | MDYLDYQDEIYLDIYLEFGAEAVTDPAYAEELLSKSQF |
| Ga0255147_10957072 | 3300024289 | Freshwater | MNYNDYYDEIYTDIYLEFGADSVTDPNYAEELLKKGNK |
| Ga0255147_11070863 | 3300024289 | Freshwater | NDYYDDIYLDIYLEFGADSVTDPAYAEQLAKEKGVR |
| Ga0244775_113981402 | 3300024346 | Estuarine | MNDYYDEIYLDIYLEFGADSVSDPVYAEQLAKDKGVR |
| Ga0244776_102617021 | 3300024348 | Estuarine | ALARFMLLLEVGSNLMNDYYDDIYLDIYLEFGADSVSDPVYAEQLAKDKGVR |
| Ga0255142_10649471 | 3300024352 | Freshwater | MDYNDYYDDIYLDIYLEFGADSVSDPDYAEQLAHAKGVK |
| Ga0256332_10426404 | 3300024484 | Freshwater | KVGLTMDYNDYYDEIYLDIYLEFGADSVSDPDYAEQLAHAKGVK |
| Ga0256332_11210922 | 3300024484 | Freshwater | KTIMDYLDYQDEIYLDIYLEFGAEAVTDPAYAEELLSKSQF |
| Ga0255164_10035172 | 3300024495 | Freshwater | MDYLDYQDEIYLDIYLEFGADSVSDPDYAEQLLKERNR |
| Ga0255288_10429154 | 3300024561 | Freshwater | LVLTMDYNDYYDDIYLDIYLEFGADSVSDPDYAEQLAHAKGVK |
| Ga0256336_10427001 | 3300024562 | Freshwater | VGLTMDYNDYYDEIYLDIYLEFGADSVSDPDYAEQLAHAKGVK |
| Ga0255276_10680264 | 3300024570 | Freshwater | LTMDYNDYYDEIYLDIYLEFGADSVSDPDYAEQLAHAKGVK |
| Ga0255268_10329911 | 3300024572 | Freshwater | MNDYLDYQDEIYLDIYLEFGADSVSDPDYAEKLLKERNR |
| Ga0255275_12113741 | 3300024574 | Freshwater | YNDYYDEIYLDIYLEFGADSVSDPDYAEQLAHSKGVK |
| Ga0256339_10673544 | 3300024857 | Freshwater | MNDYLDYQDEIYLDIYLEFGADSVSDPDYAEQLLKERKTKCFH |
| Ga0255267_10515471 | 3300024867 | Freshwater | DYNDYYDEIYLDIYLEFGADSVSDPDYAEQLAHAKGVK |
| Ga0208546_11151542 | 3300025585 | Aqueous | MDYLDYYDEVYTDIYLEFGADSVSDPNYAEQLLKERGQNVR |
| Ga0208783_103004842 | 3300025872 | Aqueous | MDFLDYQDEIYLDIYLEFGETSVSDVKYAEQLRKEKNA |
| Ga0255166_100602810 | 3300026473 | Freshwater | IMDYLDYQDEIYLDIYLEFGAEAVTDPAYAEELLSKSQF |
| Ga0208928_10320921 | 3300027217 | Estuarine | GVILMNDYYDDIYLDIYLEFGADSVSDPVYAEQLAKDKGVR |
| Ga0255154_10576443 | 3300027467 | Freshwater | DYNDYYDDIYLDIYLEFGADSVSDPDYAEQLAHAKGVK |
| Ga0209552_11236424 | 3300027563 | Freshwater Lake | ILMNDYYDDIYLDIYLEFGADSVSDPVYAEQLAKDKGVR |
| Ga0208966_10926313 | 3300027586 | Freshwater Lentic | MNDYYDDIYLDIYLEFGADSVSDPAYAEQLAKDKGVR |
| Ga0209599_100184323 | 3300027710 | Deep Subsurface | MDYNEYYDEIYLEIYEEFGADSVSDPSYAESLKGNK |
| Ga0209599_100378314 | 3300027710 | Deep Subsurface | MDYNEYYDEIYLEIYEEFGADSVSDPAYAESLKGNK |
| Ga0209596_100531916 | 3300027754 | Freshwater Lake | MDYNDYYDDIYLDIYLEFGADSVSNPAYAEQLAKDKGVR |
| Ga0209596_10204221 | 3300027754 | Freshwater Lake | MDYEDYYNDIYLDIYLEFGADSVSNPAYAEQLAKDKGVR |
| Ga0256335_10243492 | 3300028112 | Freshwater | MNDYLDYQDEIYLDIYLEFGAEAVTDPAYAEELLSKSQF |
| Ga0256331_10470281 | 3300028286 | Freshwater | MNDYLDYQDEIYLDIYLEFGADSVSDPDYAEQLAHAKGVK |
| Ga0315907_1000396211 | 3300031758 | Freshwater | MDFNEYYDDIYLEIYEEFGASAVSDPDYAEQLAKDKGVR |
| Ga0315907_1005238312 | 3300031758 | Freshwater | MDYFDYYDEVYTDIYLEFGADSVSDPAHAEALLGKSQS |
| Ga0315907_104199221 | 3300031758 | Freshwater | MNDYLDYQDEIYLDIYLEFGADSVSDPDYAEQLLKERNR |
| Ga0315907_111804093 | 3300031758 | Freshwater | VGSNLMNDYYDDIYLDIYLEFGADSVSDPVYAEQLAKDKGVR |
| Ga0315909_1000638331 | 3300031857 | Freshwater | MDYFDYYDEVYTDIYLEFGADSVSDPAHAEALLGKSQN |
| Ga0315904_102913431 | 3300031951 | Freshwater | MDYNDYYDEIYTDIYLEFGAEAVSDPAHAEALLGKSQS |
| Ga0315904_104079642 | 3300031951 | Freshwater | MDYLDYYDEVYTDIYLEFGAEAVSDPNYAEELLQKGNK |
| Ga0316616_1007054741 | 3300033521 | Soil | MDYLDYYDEVYTDIYLEFGADSVSDPDYAEQLLKKGNK |
| Ga0316617_1000604411 | 3300033557 | Soil | MDFLDYQDEIYLDIYLEFGADSVSDPDYAEQLLKERNR |
| Ga0316617_1009950562 | 3300033557 | Soil | MDYLDYQDEIYLDIYLEFGADSVSDPNYAEQLLKERNK |
| Ga0316617_1015681421 | 3300033557 | Soil | MDFLDYQDEIYLDIYLEFGADSVSDPDYAEQLLKKGNK |
| Ga0334996_0048617_854_973 | 3300033994 | Freshwater | MDYNDYYDEIYLEIYEEFGAESVSDPAYAESLKSGINHI |
| Ga0310143_00917_9992_10111 | 3300034523 | Fracking Water | MDYNDYYDDIYLDIYLEFGADSVTDPTYAEQLAKEKGVR |
| ⦗Top⦘ |