


| Basic Information | |
|---|---|
| Family ID | F085708 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 111 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MNRLLTTLVQLALAIPALYMGRMMWREIVADFREWDKSH |
| Number of Associated Samples | 74 |
| Number of Associated Scaffolds | 111 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 88.29 % |
| % of genes near scaffold ends (potentially truncated) | 9.91 % |
| % of genes from short scaffolds (< 2000 bps) | 53.15 % |
| Associated GOLD sequencing projects | 61 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Predicted Viral (42.342 % of family members) |
| NCBI Taxonomy ID | 10239 (predicted) |
| Taxonomy | All Organisms → Viruses → Predicted Viral |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (22.523 % of family members) |
| Environment Ontology (ENVO) | Unclassified (51.351 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (54.054 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.73% β-sheet: 0.00% Coil/Unstructured: 46.27% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 111 Family Scaffolds |
|---|---|---|
| PF06067 | DUF932 | 10.81 |
| PF04488 | Gly_transf_sug | 1.80 |
| PF13640 | 2OG-FeII_Oxy_3 | 1.80 |
| PF01464 | SLT | 1.80 |
| PF11397 | GlcNAc | 1.80 |
| PF04860 | Phage_portal | 1.80 |
| PF08241 | Methyltransf_11 | 0.90 |
| PF04973 | NMN_transporter | 0.90 |
| PF14579 | HHH_6 | 0.90 |
| PF07463 | NUMOD4 | 0.90 |
| PF03567 | Sulfotransfer_2 | 0.90 |
| COG ID | Name | Functional Category | % Frequency in 111 Family Scaffolds |
|---|---|---|---|
| COG3774 | Mannosyltransferase OCH1 or related enzyme | Cell wall/membrane/envelope biogenesis [M] | 1.80 |
| COG3201 | Nicotinamide riboside transporter PnuC | Coenzyme transport and metabolism [H] | 0.90 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 64.86 % |
| Unclassified | root | N/A | 35.14 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352004|2199788704 | All Organisms → Viruses → Predicted Viral | 2206 | Open in IMG/M |
| 3300000756|JGI12421J11937_10019815 | All Organisms → Viruses → Predicted Viral | 2488 | Open in IMG/M |
| 3300000882|FwDRAFT_10078009 | All Organisms → Viruses → Predicted Viral | 1585 | Open in IMG/M |
| 3300003277|JGI25908J49247_10002632 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5739 | Open in IMG/M |
| 3300003413|JGI25922J50271_10002987 | Not Available | 4883 | Open in IMG/M |
| 3300003430|JGI25921J50272_10001498 | Not Available | 7853 | Open in IMG/M |
| 3300003430|JGI25921J50272_10113372 | Not Available | 572 | Open in IMG/M |
| 3300004054|Ga0063232_10125947 | Not Available | 735 | Open in IMG/M |
| 3300004112|Ga0065166_10331705 | Not Available | 626 | Open in IMG/M |
| 3300004124|Ga0066178_10165556 | Not Available | 627 | Open in IMG/M |
| 3300005069|Ga0071350_1119829 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 838 | Open in IMG/M |
| 3300005517|Ga0070374_10061540 | All Organisms → Viruses → Predicted Viral | 1955 | Open in IMG/M |
| 3300005517|Ga0070374_10252330 | Not Available | 902 | Open in IMG/M |
| 3300005517|Ga0070374_10311376 | Not Available | 799 | Open in IMG/M |
| 3300005585|Ga0049084_10045449 | All Organisms → Viruses → Predicted Viral | 1668 | Open in IMG/M |
| 3300005662|Ga0078894_10159549 | Not Available | 2030 | Open in IMG/M |
| 3300005662|Ga0078894_10241008 | All Organisms → Viruses → Predicted Viral | 1639 | Open in IMG/M |
| 3300005662|Ga0078894_10429661 | All Organisms → Viruses → Predicted Viral | 1191 | Open in IMG/M |
| 3300005662|Ga0078894_10435368 | Not Available | 1182 | Open in IMG/M |
| 3300005662|Ga0078894_10464445 | All Organisms → Viruses → Predicted Viral | 1139 | Open in IMG/M |
| 3300005662|Ga0078894_10467895 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1134 | Open in IMG/M |
| 3300005662|Ga0078894_10519729 | All Organisms → Viruses → Predicted Viral | 1067 | Open in IMG/M |
| 3300005662|Ga0078894_10662683 | Not Available | 924 | Open in IMG/M |
| 3300005662|Ga0078894_10789673 | Not Available | 831 | Open in IMG/M |
| 3300005662|Ga0078894_11163041 | Not Available | 655 | Open in IMG/M |
| 3300005662|Ga0078894_11171336 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 652 | Open in IMG/M |
| 3300005662|Ga0078894_11655438 | Not Available | 526 | Open in IMG/M |
| 3300005941|Ga0070743_10039824 | Not Available | 1610 | Open in IMG/M |
| 3300005941|Ga0070743_10046704 | All Organisms → Viruses → Predicted Viral | 1479 | Open in IMG/M |
| 3300005941|Ga0070743_10078903 | All Organisms → Viruses → Predicted Viral | 1112 | Open in IMG/M |
| 3300006484|Ga0070744_10013004 | All Organisms → Viruses → Predicted Viral | 2469 | Open in IMG/M |
| 3300006484|Ga0070744_10028287 | All Organisms → Viruses → Predicted Viral | 1660 | Open in IMG/M |
| 3300006484|Ga0070744_10041821 | All Organisms → Viruses → Predicted Viral | 1348 | Open in IMG/M |
| 3300006484|Ga0070744_10130596 | Not Available | 722 | Open in IMG/M |
| 3300006484|Ga0070744_10201258 | Not Available | 566 | Open in IMG/M |
| 3300006639|Ga0079301_1030713 | All Organisms → Viruses → Predicted Viral | 1815 | Open in IMG/M |
| 3300006641|Ga0075471_10072734 | Not Available | 1877 | Open in IMG/M |
| 3300006641|Ga0075471_10413259 | Not Available | 676 | Open in IMG/M |
| 3300006641|Ga0075471_10430448 | Not Available | 660 | Open in IMG/M |
| 3300006805|Ga0075464_10523710 | Not Available | 726 | Open in IMG/M |
| 3300006805|Ga0075464_10607228 | Not Available | 674 | Open in IMG/M |
| 3300007548|Ga0102877_1028319 | All Organisms → Viruses → Predicted Viral | 1639 | Open in IMG/M |
| 3300007559|Ga0102828_1182579 | Not Available | 534 | Open in IMG/M |
| 3300007561|Ga0102914_1093612 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 939 | Open in IMG/M |
| 3300007606|Ga0102923_1221491 | Not Available | 586 | Open in IMG/M |
| 3300008111|Ga0114344_1094636 | All Organisms → Viruses → Predicted Viral | 1091 | Open in IMG/M |
| 3300008261|Ga0114336_1055146 | Not Available | 2034 | Open in IMG/M |
| 3300008953|Ga0104241_1001518 | All Organisms → Viruses → Predicted Viral | 1795 | Open in IMG/M |
| 3300008996|Ga0102831_1030251 | All Organisms → Viruses → Predicted Viral | 1837 | Open in IMG/M |
| 3300009059|Ga0102830_1028569 | All Organisms → Viruses → Predicted Viral | 1728 | Open in IMG/M |
| 3300009159|Ga0114978_10050249 | All Organisms → Viruses → Predicted Viral | 2883 | Open in IMG/M |
| 3300009160|Ga0114981_10000317 | All Organisms → Viruses | 30900 | Open in IMG/M |
| 3300009161|Ga0114966_10736017 | Not Available | 537 | Open in IMG/M |
| 3300009164|Ga0114975_10000669 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 25624 | Open in IMG/M |
| 3300009180|Ga0114979_10038339 | All Organisms → Viruses → Predicted Viral | 3025 | Open in IMG/M |
| 3300009181|Ga0114969_10012969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 6062 | Open in IMG/M |
| 3300009183|Ga0114974_10002650 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13751 | Open in IMG/M |
| 3300010388|Ga0136551_1007812 | All Organisms → Viruses → Predicted Viral | 2300 | Open in IMG/M |
| 3300010970|Ga0137575_10006053 | All Organisms → Viruses → Predicted Viral | 2203 | Open in IMG/M |
| 3300011268|Ga0151620_1039062 | All Organisms → Viruses → Predicted Viral | 1592 | Open in IMG/M |
| 3300012667|Ga0157208_10000909 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7345 | Open in IMG/M |
| 3300013092|Ga0163199_1016909 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3736 | Open in IMG/M |
| 3300020483|Ga0207418_100326 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8933 | Open in IMG/M |
| 3300021519|Ga0194048_10002161 | Not Available | 9756 | Open in IMG/M |
| 3300021519|Ga0194048_10002662 | Not Available | 8831 | Open in IMG/M |
| 3300021602|Ga0194060_10039802 | All Organisms → Viruses → Predicted Viral | 2802 | Open in IMG/M |
| 3300021962|Ga0222713_10049632 | All Organisms → Viruses → Predicted Viral | 3215 | Open in IMG/M |
| 3300021963|Ga0222712_10000205 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 86163 | Open in IMG/M |
| 3300021963|Ga0222712_10004743 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14076 | Open in IMG/M |
| 3300021963|Ga0222712_10064488 | All Organisms → Viruses → Predicted Viral | 2671 | Open in IMG/M |
| 3300022553|Ga0212124_10135694 | All Organisms → Viruses → Predicted Viral | 1362 | Open in IMG/M |
| 3300023174|Ga0214921_10056325 | All Organisms → Viruses → Predicted Viral | 3382 | Open in IMG/M |
| 3300023174|Ga0214921_10106651 | All Organisms → Viruses → Predicted Viral | 2076 | Open in IMG/M |
| 3300023184|Ga0214919_10000994 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 47901 | Open in IMG/M |
| 3300023184|Ga0214919_10129413 | All Organisms → Viruses → Predicted Viral | 2057 | Open in IMG/M |
| 3300024346|Ga0244775_10003330 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 17094 | Open in IMG/M |
| 3300024346|Ga0244775_10010688 | Not Available | 8741 | Open in IMG/M |
| 3300024346|Ga0244775_10014706 | Not Available | 7289 | Open in IMG/M |
| 3300024346|Ga0244775_10133916 | All Organisms → Viruses → Predicted Viral | 2096 | Open in IMG/M |
| 3300024348|Ga0244776_10051937 | All Organisms → Viruses → Predicted Viral | 3196 | Open in IMG/M |
| 3300024348|Ga0244776_10263838 | All Organisms → Viruses → Predicted Viral | 1192 | Open in IMG/M |
| 3300024348|Ga0244776_10856258 | Not Available | 543 | Open in IMG/M |
| 3300025732|Ga0208784_1026711 | Not Available | 1851 | Open in IMG/M |
| 3300027127|Ga0255071_1021687 | All Organisms → Viruses → Predicted Viral | 1004 | Open in IMG/M |
| 3300027142|Ga0255065_1001393 | Not Available | 5858 | Open in IMG/M |
| 3300027193|Ga0208800_1000118 | Not Available | 13158 | Open in IMG/M |
| 3300027218|Ga0208165_1005006 | All Organisms → Viruses → Predicted Viral | 1996 | Open in IMG/M |
| 3300027250|Ga0208310_1011739 | All Organisms → Viruses → Predicted Viral | 1493 | Open in IMG/M |
| 3300027631|Ga0208133_1045912 | All Organisms → Viruses → Predicted Viral | 1063 | Open in IMG/M |
| 3300027689|Ga0209551_1193549 | Not Available | 625 | Open in IMG/M |
| 3300027710|Ga0209599_10005440 | All Organisms → Viruses → Predicted Viral | 4428 | Open in IMG/M |
| 3300027754|Ga0209596_1004285 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10932 | Open in IMG/M |
| 3300027754|Ga0209596_1004730 | Not Available | 10299 | Open in IMG/M |
| 3300027759|Ga0209296_1002329 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13728 | Open in IMG/M |
| 3300027763|Ga0209088_10039735 | All Organisms → Viruses → Predicted Viral | 2330 | Open in IMG/M |
| 3300027797|Ga0209107_10000099 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 52410 | Open in IMG/M |
| 3300027892|Ga0209550_10126007 | All Organisms → Viruses → Predicted Viral | 1867 | Open in IMG/M |
| 3300027892|Ga0209550_10261457 | All Organisms → Viruses → Predicted Viral | 1137 | Open in IMG/M |
| 3300027969|Ga0209191_1000524 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 29376 | Open in IMG/M |
| 3300031519|Ga0307488_10119281 | All Organisms → Viruses → Predicted Viral | 1893 | Open in IMG/M |
| 3300032092|Ga0315905_10122416 | All Organisms → Viruses → Predicted Viral | 2610 | Open in IMG/M |
| 3300032093|Ga0315902_10414491 | All Organisms → Viruses → Predicted Viral | 1211 | Open in IMG/M |
| 3300033992|Ga0334992_0004996 | Not Available | 9534 | Open in IMG/M |
| 3300033992|Ga0334992_0466594 | Not Available | 553 | Open in IMG/M |
| 3300034066|Ga0335019_0081036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Neisseriaceae → Eikenella → unclassified Eikenella → Eikenella sp. HMSC061C02 | 2190 | Open in IMG/M |
| 3300034066|Ga0335019_0198604 | All Organisms → Viruses → Predicted Viral | 1299 | Open in IMG/M |
| 3300034068|Ga0334990_0006282 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6432 | Open in IMG/M |
| 3300034082|Ga0335020_0000786 | All Organisms → Viruses | 23397 | Open in IMG/M |
| 3300034102|Ga0335029_0006417 | Not Available | 9239 | Open in IMG/M |
| 3300034106|Ga0335036_0005113 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11131 | Open in IMG/M |
| 3300034168|Ga0335061_0020810 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3483 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 22.52% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 13.51% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 11.71% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 10.81% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 10.81% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.41% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.60% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 2.70% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.80% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 1.80% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.80% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.80% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.80% |
| Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 1.80% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.80% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.90% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.90% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.90% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.90% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.90% |
| Freshwater And Marine | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine | 0.90% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.90% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352004 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300000882 | Freshwater microbial communities from the Columbia River | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003413 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD | Environmental | Open in IMG/M |
| 3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
| 3300004054 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (v2) | Environmental | Open in IMG/M |
| 3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
| 3300004124 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (version 2) | Environmental | Open in IMG/M |
| 3300005069 | Metagenomes from Harmful Algal Blooms in Lake Erie, HABS-E2014-0024 | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007548 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3 | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007561 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3 | Environmental | Open in IMG/M |
| 3300007606 | Estuarine microbial communities from the Columbia River estuary - metaG 1569-02 | Environmental | Open in IMG/M |
| 3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008953 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT4 | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300010388 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015 | Environmental | Open in IMG/M |
| 3300010970 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1, april 2016 | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300012667 | Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15 | Environmental | Open in IMG/M |
| 3300013092 | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_150m | Environmental | Open in IMG/M |
| 3300020483 | Freshwater microbial communities from Lake Mendota, WI - 05AUG2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021602 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L222-5m | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022553 | Powell_combined assembly | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027127 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8h | Environmental | Open in IMG/M |
| 3300027142 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h | Environmental | Open in IMG/M |
| 3300027193 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes) | Environmental | Open in IMG/M |
| 3300027218 | Estuarine microbial communities from the Columbia River estuary - metaG 1546B-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027250 | Estuarine microbial communities from the Columbia River estuary - metaG 1557A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027689 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034068 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031 | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034168 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2199948558 | 2199352004 | Freshwater | MNRLLTTLVQLGIGIPALIMLRLVWREIVADYREWANSH |
| JGI12421J11937_100198152 | 3300000756 | Freshwater And Sediment | MTTNRLLTTLVQLGIGIPALLMARLVWREIVSDYREWANSH* |
| FwDRAFT_100780095 | 3300000882 | Freshwater And Marine | MNRLLTTLVQLSIAIPALYMGRMMWREMLADFREWDKSQ* |
| JGI25908J49247_100026327 | 3300003277 | Freshwater Lake | MNRLLTTLVQLGIAIPALIMGRMVWREIVADYREWANSH* |
| JGI25922J50271_100029871 | 3300003413 | Freshwater Lake | MNRLLTTLVQLSLALPALYMGRMMWREIVADYREWANSH* |
| JGI25921J50272_100014982 | 3300003430 | Freshwater Lake | MNRLLTTLVQLAIAIPALYMGRMMWQELKQDVREVIKDFR* |
| JGI25921J50272_101133723 | 3300003430 | Freshwater Lake | MNRLLTTFVQLALAIPALYMGRMMWQELKQDVREVIKDFR* |
| Ga0063232_101259472 | 3300004054 | Freshwater Lake | MNRLLTSLVQLAIAIPALYMGRMMWQELKADFREMMRGN* |
| Ga0065166_103317051 | 3300004112 | Freshwater Lake | MNRLLTTIVQLSIAIPALYMGRMMWREIVADFREWDKSH* |
| Ga0066178_101655561 | 3300004124 | Freshwater Lake | MNRLLTTLVQLGIGIPALYMGRMVLREVIADTKEMMRGN* |
| Ga0071350_11198292 | 3300005069 | Freshwater | MTTNRILTTLVQLGIGIPALYMARLMWADLKEDVREVIKDFR* |
| Ga0070374_100615409 | 3300005517 | Freshwater Lake | CVMNRLLTTLVQLGIAIPALIMGRMVWREIVADYREWANSH* |
| Ga0070374_102523302 | 3300005517 | Freshwater Lake | MNRLLTSLVQLAIAIPALYMGRMMWHEMKEDFRELRKGN* |
| Ga0070374_103113765 | 3300005517 | Freshwater Lake | MNRLLTTLVQLALAIPALYMGRMMWREIVADFREWDRSH |
| Ga0049084_100454497 | 3300005585 | Freshwater Lentic | MNRLLTTLVQLGIGIPALIMLRLVWREIVADYREWANSH* |
| Ga0078894_101595492 | 3300005662 | Freshwater Lake | MNRLLTTLVQLALAIPALYMGRMMWREIVADFREWDRSH* |
| Ga0078894_102410085 | 3300005662 | Freshwater Lake | MNRLLTTLVQLSLALPALYMGRMMWREIVADFREWDNSH* |
| Ga0078894_104296614 | 3300005662 | Freshwater Lake | MTTNRLLTTAVQIGIGIPTLLMMRLMWREIVADFREWDKSH* |
| Ga0078894_104353682 | 3300005662 | Freshwater Lake | MNRLLTTLVQLALAIPALYMGRMMWREIVADFREWDKSH* |
| Ga0078894_104644451 | 3300005662 | Freshwater Lake | MNRLLTTLVQLSIALPALYMGRMMWREIVADFREWDKSH* |
| Ga0078894_104678955 | 3300005662 | Freshwater Lake | MNRLLTSLVQLAIAIPALYMGRMMWREIVADFREWDKSH* |
| Ga0078894_105197294 | 3300005662 | Freshwater Lake | MNRLLTTLVQLGIAIPALYMGRLMWQELKEDVREVIKDFR* |
| Ga0078894_106626831 | 3300005662 | Freshwater Lake | MTTNRLLTTLVQLGIGIPALLMMRLMWREIVADFREWDKSH* |
| Ga0078894_107896731 | 3300005662 | Freshwater Lake | MTTNRLLTTAVQLGIGIPALYMLRLMWREIVSDFREWDKSH* |
| Ga0078894_111630412 | 3300005662 | Freshwater Lake | MNRLLTSLVQLAIAIPALYMGRLMWHELKQDVREVIKDFR* |
| Ga0078894_111713362 | 3300005662 | Freshwater Lake | MNRLLTTLVQLSLALPALYMGRMMWREIVADYREWAKSH* |
| Ga0078894_116554383 | 3300005662 | Freshwater Lake | MNRLLTTLVQLAIGIPALYMGRIVLQELKQDVREVIKDFR* |
| Ga0070743_100398244 | 3300005941 | Estuarine | MNRLLTTAVQLAIGIPALYMARLMWLEIVADFREWDKSH* |
| Ga0070743_100467041 | 3300005941 | Estuarine | MNRLITTLVQIALLVPALYMGRMMWREIVADFREWDNSH* |
| Ga0070743_100789036 | 3300005941 | Estuarine | MNRLLTTFVQLALAIPALYMGRMMWREIVADFREWDRSH* |
| Ga0070744_100130045 | 3300006484 | Estuarine | MSTNRILTTLVQLGIGIPALIMLRLVWREIVADFREWANSH* |
| Ga0070744_100282874 | 3300006484 | Estuarine | MNRLITTLVQVALIVPALVMGRMVWREIVADYIKWGKSH* |
| Ga0070744_100418214 | 3300006484 | Estuarine | MTTNRILTTLVQLGIGIPALLMARLVWREIVSDYREWANSH* |
| Ga0070744_101305964 | 3300006484 | Estuarine | MTTNRILTTLVQLGIGIPALLMLRLVWREIVSDYREWANSH* |
| Ga0070744_102012582 | 3300006484 | Estuarine | MNRLLTTLVQLGIGIPALLMARLVWREIVSDYREWANSH* |
| Ga0079301_10307136 | 3300006639 | Deep Subsurface | MTTNRLLTTAVQLGIGIPTLLMLRLMWREIVADFREWDKSH* |
| Ga0075471_100727341 | 3300006641 | Aqueous | MNRLLTTLVQLALVIPALVMGRMMWREIVADFREWDKSH* |
| Ga0075471_104132592 | 3300006641 | Aqueous | MNRLLTTLVQLAIGIPALYMARLMWREIVADFREWDKSH* |
| Ga0075471_104304481 | 3300006641 | Aqueous | MNRLLTTLVQLSIAIPALYMGRMMWREIVADFREWDKSH* |
| Ga0075464_105237104 | 3300006805 | Aqueous | MNRLLTTLVQLGIAIPALYMGRMMWHELKADFREMMRGN* |
| Ga0075464_106072281 | 3300006805 | Aqueous | MTTNRLLTTAVQLGIGIPTLLMMRLMWREIVADFREWDKSH* |
| Ga0102877_10283194 | 3300007548 | Estuarine | MNRLLTSLVQVALIVPALYMGRMMWREIVADFKEWDKSH* |
| Ga0102828_11825793 | 3300007559 | Estuarine | MNRLLTTLVQLGIGIPALYMGRMVLREVIADTKEMIRGN* |
| Ga0102914_10936124 | 3300007561 | Estuarine | MNRLLTTAVQLAIGIPALYMARLMWREIVADFREWDKSH* |
| Ga0102923_12214912 | 3300007606 | Estuarine | MNRLITSLVQVALLVPALYMGRMMWREIVADFREWD |
| Ga0114344_10946364 | 3300008111 | Freshwater, Plankton | MNRLITSLVQIGIAIPALYCARLMWHELKEDVREVIKDFR* |
| Ga0114336_10551463 | 3300008261 | Freshwater, Plankton | MNRLLTTLVQLAIGIPALYMGRIVWQELKQDVREVIKDFR* |
| Ga0104241_10015183 | 3300008953 | Freshwater | MTTNRILTTLVQLAIGIPALYMARLMWREVLADFREWDKSH* |
| Ga0102831_10302511 | 3300008996 | Estuarine | MNRLLTTFVQLALAIPALYMGRMVLREVIADAKEMWQESH* |
| Ga0102830_10285694 | 3300009059 | Estuarine | MNRLLTTLVQLALAIPALYMGRMMWHELKQDVREVIK |
| Ga0114978_1005024913 | 3300009159 | Freshwater Lake | LMNRLLTTLVQLALIVPALIMGRMMWREIVADYREWANSH* |
| Ga0114981_1000031727 | 3300009160 | Freshwater Lake | MNRLLTTLVQLALIIPALIMGRMMWREIVANFREWANSH* |
| Ga0114966_107360171 | 3300009161 | Freshwater Lake | MNRLITTLVQIALIVPALIMGRMVWREIVADYMEWDKSH* |
| Ga0114975_1000066934 | 3300009164 | Freshwater Lake | MNRLLTSLVQIAIGIPALYMGRIVLREIVSDFREWSKSH* |
| Ga0114979_100383393 | 3300009180 | Freshwater Lake | MNRLLTTLVQLALIVPALIMGRMMWREIVADYREWANSH* |
| Ga0114969_100129691 | 3300009181 | Freshwater Lake | MTTNRILTTLVQLAIGIPALYMARLMWREIVSDFREWDKSH* |
| Ga0114974_1000265013 | 3300009183 | Freshwater Lake | MNRLLTTLVQIGIGIPALYCARLMWREISNDFREWDKTQ* |
| Ga0136551_10078123 | 3300010388 | Pond Fresh Water | MNRLITSLVQLALAVPALYMGRMVLREVIADAKEMWQESH* |
| Ga0137575_100060534 | 3300010970 | Pond Fresh Water | MNRLLTTLVQASIAVPALYMARWVWRDIVADYREWDKSH* |
| Ga0151620_10390625 | 3300011268 | Freshwater | MNRLLTTLVQLAIAIPALYMGRMMWREIVADYREWAKSH* |
| Ga0157208_100009096 | 3300012667 | Freshwater | MNRLLTTLVQLALAVPALYMGRMVLREVIADAKEMWQESH* |
| Ga0163199_10169096 | 3300013092 | Freshwater | MNRLLTTLVQLFLLVPALIMGRMVWREIVADYIEWDKSH* |
| Ga0207418_10032615 | 3300020483 | Freshwater | MTTNRLLTTAVQIGIGIPTLLMMRLMWREIVADFREWDKSH |
| Ga0194048_100021613 | 3300021519 | Anoxic Zone Freshwater | MNRLITTLVQIALLVPALYMGRMMWREIVADFREWDKSH |
| Ga0194048_100026625 | 3300021519 | Anoxic Zone Freshwater | MNRLLTSLVQVALLVPALYMGRMMWREIVADFREWDKSH |
| Ga0194060_100398028 | 3300021602 | Anoxic Zone Freshwater | MNRLLTTLVQLALIIPALYMGRMMWREIVADFREWDKSH |
| Ga0222713_1004963211 | 3300021962 | Estuarine Water | MTTNRILTTLVQLGIGIPALLMARLVWREIVSDYREWANSH |
| Ga0222712_1000020511 | 3300021963 | Estuarine Water | MNRLLTTLVQLALIVPALYMGRMMWREIVADFREWDKSH |
| Ga0222712_1000474322 | 3300021963 | Estuarine Water | MNRLLTSLVQLAIAIPALYMGRMMWREIVADFREWDKSH |
| Ga0222712_100644889 | 3300021963 | Estuarine Water | MTTNRILTTLVQLGIGIPALIMLRLVWREIVADFREWANSH |
| Ga0212124_101356946 | 3300022553 | Freshwater | MNRLLTTLVQLFLLVPALIMGRMVWREIVADYIEWDKSH |
| Ga0214921_1005632511 | 3300023174 | Freshwater | MTTNRILTTLVQLAIGIPALYMARLMWREIVADFKEWDKSH |
| Ga0214921_101066516 | 3300023174 | Freshwater | MTLNRLLTSLVQIGLIVPALYMGRMMWREIVADFREWDKSH |
| Ga0214919_1000099437 | 3300023184 | Freshwater | MTTNRILTTLVQIALLVPALYMARLMWREIVSDFREWDKSH |
| Ga0214919_101294138 | 3300023184 | Freshwater | MTTNRILTTLVQLAIGIPALYMARLMWREIIADFKEWDKSH |
| Ga0244775_1000333026 | 3300024346 | Estuarine | MNRLITTLVQIALLVPALYMGRMMWREIVADFREWDNSH |
| Ga0244775_1001068812 | 3300024346 | Estuarine | MNRLLTTFVQLALAIPALYMGRMMWREIVADFREWDRSH |
| Ga0244775_1001470620 | 3300024346 | Estuarine | MSTNRILTTLVQLGIGIPALIMLRLVWREIVADFREWANSH |
| Ga0244775_101339165 | 3300024346 | Estuarine | MNRLLTTLVQLGIAIPALIMGRMVWREIVADYREWANSH |
| Ga0244776_100519374 | 3300024348 | Estuarine | MNRLLTTAVQLAIGIPALYMARLMWREIVADFREWDKSH |
| Ga0244776_102638381 | 3300024348 | Estuarine | MNRLLTILVQIAIGIPAIYMGRLMWREIVADFREWDKSH |
| Ga0244776_108562581 | 3300024348 | Estuarine | ILTTLVQLGIGIPALLMARLVWREIVSDYREWANSH |
| Ga0208784_10267117 | 3300025732 | Aqueous | MNRLLTTLVQLALVIPALVMGRMMWREIVADFREWDKSH |
| Ga0255071_10216873 | 3300027127 | Freshwater | MNRLLTTIVQLGIAIPALYMGRMMWQELKQDLKEM |
| Ga0255065_100139316 | 3300027142 | Freshwater | MNRLLTTIVQLGIAIPALYMGRMMWQELKQDLKEMMK |
| Ga0208800_100011836 | 3300027193 | Estuarine | MTTNRILTTLVQLGIGIPALLMLRLVWREIVSDYREWANSH |
| Ga0208165_10050064 | 3300027218 | Estuarine | MNRLLTSLVQVALIVPALYMGRMMWREIVADFKEWDKSH |
| Ga0208310_10117397 | 3300027250 | Estuarine | LTTAVQLAIGIPALYMARLMWREIVADFREWDKSH |
| Ga0208133_10459122 | 3300027631 | Estuarine | MNRLLTTLVQIALIVPALIMGRMVWREIVADYMEWDKSH |
| Ga0209551_11935493 | 3300027689 | Freshwater Lake | MNRLLTTLVQLAIAIPALYMGRMMWQELKQDVREVIKDFR |
| Ga0209599_100054405 | 3300027710 | Deep Subsurface | MTTNRLITTAVQIGIGIPTLLMMRLMWREIVADFREWDKSH |
| Ga0209596_10042853 | 3300027754 | Freshwater Lake | MNRLITTLVQIALIVPALIMGRMVWREIVADYMEWDKSH |
| Ga0209596_100473014 | 3300027754 | Freshwater Lake | MTTNRILTTLVQLAIGIPALYMARLMWREIVSDFREWDKSH |
| Ga0209296_100232913 | 3300027759 | Freshwater Lake | MNRLLTTLVQIGIGIPALYCARLMWREISNDFREWDKTQ |
| Ga0209088_100397353 | 3300027763 | Freshwater Lake | MNRLLTTLVQLALIVPALIMGRMMWREIVADYREWANSH |
| Ga0209107_1000009934 | 3300027797 | Freshwater And Sediment | MTTNRLLTTLVQLGIGIPALLMARLVWREIVSDYREWANSH |
| Ga0209550_101260074 | 3300027892 | Freshwater Lake | MNRLLTTIVQLSIAIPALYMVRLMWHDLKQDVREVIKDFR |
| Ga0209550_102614573 | 3300027892 | Freshwater Lake | MNRLLTSLVQLAIAIPALYMGRMMWHEMKEDFRELRKGN |
| Ga0209191_100052438 | 3300027969 | Freshwater Lake | MNRLLTSLVQIAIGIPALYMGRIVLREIVSDFREWSKSH |
| Ga0307488_101192814 | 3300031519 | Sackhole Brine | MTTNRLLTTAVQLGIGIPALYMLRLMWREIVSDFREWDKSH |
| Ga0315905_101224163 | 3300032092 | Freshwater | MNRLLTTLVQLSIAIPALYMGRMMWREIVADFREWDKSH |
| Ga0315902_104144911 | 3300032093 | Freshwater | MTTNRLLTTAVQIGIGIPTLLMMRLMWREIVADFRE |
| Ga0334992_0004996_9282_9401 | 3300033992 | Freshwater | MNRLLTTLVQLGIGIPALLMARLVWREILSDYRKWANSH |
| Ga0334992_0466594_446_553 | 3300033992 | Freshwater | LTTLVQLGIGIPALIMLRLVWREIVADYREWANSH |
| Ga0335019_0081036_1510_1629 | 3300034066 | Freshwater | MNRLLTTLVQLSIALPALYMGRMMWREIVADFREWDKSH |
| Ga0335019_0198604_996_1115 | 3300034066 | Freshwater | MNRLLTSLVQLAIAIPALYMGRMMWHEMKEDFKELRKGN |
| Ga0334990_0006282_2899_3024 | 3300034068 | Freshwater | MTTNRILTTLVQLGIGIPALLMARLVWREIVSDYREWAKSH |
| Ga0335020_0000786_9316_9447 | 3300034082 | Freshwater | MGRVMNRLLTTLVQLGIGIPALIMLRLVWREIVADYREWANSH |
| Ga0335029_0006417_7820_7942 | 3300034102 | Freshwater | MNRLLTTLVQLGIAIPALYMGRLMWQELKEDVREVIKDFR |
| Ga0335036_0005113_1495_1617 | 3300034106 | Freshwater | MNRLLTTLVQLSIAIPALYMGRMMWHELKQDVREVIKDFR |
| Ga0335061_0020810_2155_2280 | 3300034168 | Freshwater | MTTNRILTTLVQLAIGIPALYMARLMWREVLADFREWDKSH |
| ⦗Top⦘ |