


| Basic Information | |
|---|---|
| Family ID | F085544 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 111 |
| Average Sequence Length | 45 residues |
| Representative Sequence | NNEVAPKQRGLMLKRGQALYVAASGATALTTGFYCNVQGGYY |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 111 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 21.62 % |
| % of genes from short scaffolds (< 2000 bps) | 16.22 % |
| Associated GOLD sequencing projects | 82 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.28 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (77.477 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (19.820 % of family members) |
| Environment Ontology (ENVO) | Unclassified (64.865 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (70.270 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.57% β-sheet: 0.00% Coil/Unstructured: 61.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 77.48 % |
| All Organisms | root | All Organisms | 22.52 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001969|GOS2233_1018324 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1533 | Open in IMG/M |
| 3300009481|Ga0114932_10050645 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 2672 | Open in IMG/M |
| 3300009790|Ga0115012_10887031 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 729 | Open in IMG/M |
| 3300009790|Ga0115012_11289525 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 618 | Open in IMG/M |
| 3300009790|Ga0115012_11678866 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 553 | Open in IMG/M |
| 3300010148|Ga0098043_1002215 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 6930 | Open in IMG/M |
| 3300012919|Ga0160422_10017859 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 4129 | Open in IMG/M |
| 3300012919|Ga0160422_10668201 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 662 | Open in IMG/M |
| 3300017731|Ga0181416_1144441 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 573 | Open in IMG/M |
| 3300017732|Ga0181415_1007999 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 2544 | Open in IMG/M |
| 3300017746|Ga0181389_1153603 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 611 | Open in IMG/M |
| 3300020436|Ga0211708_10069938 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1360 | Open in IMG/M |
| 3300020436|Ga0211708_10288173 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 667 | Open in IMG/M |
| 3300020445|Ga0211564_10438835 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 640 | Open in IMG/M |
| 3300020452|Ga0211545_10087270 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1475 | Open in IMG/M |
| 3300022198|Ga0196905_1041302 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1344 | Open in IMG/M |
| 3300025110|Ga0208158_1018119 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1863 | Open in IMG/M |
| 3300025110|Ga0208158_1085189 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 750 | Open in IMG/M |
| 3300025151|Ga0209645_1036704 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1779 | Open in IMG/M |
| 3300025151|Ga0209645_1156765 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 698 | Open in IMG/M |
| 3300025151|Ga0209645_1178973 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 638 | Open in IMG/M |
| 3300027906|Ga0209404_10022538 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 3469 | Open in IMG/M |
| 3300029319|Ga0183748_1015051 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 2976 | Open in IMG/M |
| 3300031773|Ga0315332_10891235 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 534 | Open in IMG/M |
| 3300032047|Ga0315330_10037509 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 3248 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 19.82% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 18.02% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 12.61% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 7.21% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 6.31% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.50% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 4.50% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 2.70% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.80% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.80% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.80% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 1.80% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 1.80% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 1.80% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 1.80% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 1.80% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.90% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.90% |
| Environmental And Host-Associated | Environmental → Aquatic → Marine → Oceanic → Unclassified → Environmental And Host-Associated | 0.90% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.90% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.90% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.90% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.90% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.90% |
| Marine Sponge (Stylissa Sp.) | Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Marine Sponge (Stylissa Sp.) | 0.90% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.90% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559018 | Marine microbial communities from the Atlantic Ocean, for comparison studies - Ocean6 (GOS4441574) | Environmental | Open in IMG/M |
| 3300001969 | Marine microbial communities from Yucatan Channel, Mexico - GS017 | Environmental | Open in IMG/M |
| 3300001971 | Marine microbial communities from the Sargasso Sea - GS000c | Environmental | Open in IMG/M |
| 3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003388 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300005606 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV84 | Environmental | Open in IMG/M |
| 3300005608 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302PF84A | Environmental | Open in IMG/M |
| 3300006751 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300007214 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface layer) 9 sequencing projects | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007750 | Marine sponge Stylissa sp. microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'bubble', st44is 200bp-25jan2016 | Host-Associated | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010151 | Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300012919 | Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300013130 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2 | Environmental | Open in IMG/M |
| 3300013188 | Marine hypoxic microbial communities from the Gulf of Mexico, USA - 6m_Station1_GOM_Metagenome | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017732 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11 | Environmental | Open in IMG/M |
| 3300017740 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300017989 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_MS_2 metaG | Environmental | Open in IMG/M |
| 3300017990 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_S_2 metaG | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020190 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surface | Environmental | Open in IMG/M |
| 3300020264 | Marine microbial communities from Tara Oceans - TARA_B100000066 (ERX556116-ERR599158) | Environmental | Open in IMG/M |
| 3300020325 | Marine microbial communities from Tara Oceans - TARA_B100000034 (ERX556073-ERR598966) | Environmental | Open in IMG/M |
| 3300020395 | Marine microbial communities from Tara Oceans - TARA_B100000427 (ERX555987-ERR599133) | Environmental | Open in IMG/M |
| 3300020401 | Marine microbial communities from Tara Oceans - TARA_B100000212 (ERX555985-ERR599139) | Environmental | Open in IMG/M |
| 3300020414 | Marine microbial communities from Tara Oceans - TARA_B100000035 (ERX556019-ERR599028) | Environmental | Open in IMG/M |
| 3300020436 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984) | Environmental | Open in IMG/M |
| 3300020445 | Marine microbial communities from Tara Oceans - TARA_B100001996 (ERX555961-ERR599087) | Environmental | Open in IMG/M |
| 3300020452 | Marine microbial communities from Tara Oceans - TARA_B100001173 (ERX556054-ERR599078) | Environmental | Open in IMG/M |
| 3300020464 | Marine microbial communities from Tara Oceans - TARA_B100000530 (ERX556075-ERR599101) | Environmental | Open in IMG/M |
| 3300020470 | Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX555976-ERR599053) | Environmental | Open in IMG/M |
| 3300021424 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surface | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300023176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG | Environmental | Open in IMG/M |
| 3300024344 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025110 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026572 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300029318 | Marine giant viral communities collected during Tara Oceans survey from station TARA_038 - TARA_Y100000289 | Environmental | Open in IMG/M |
| 3300029319 | Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516 | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031773 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 34915 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032047 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915 | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ocean6-_01688610 | 2166559018 | Environmental And Host-Associated | NFGSANNALAPKQRGLMLKRGQALYVAASGATALTNGFYCNVQGGFY |
| GOS2233_10183242 | 3300001969 | Marine | FGSANNALAPKQRGLMLKRGQALYVAASGANALTNGFYCNVQGGFY* |
| GOS2215_101125092 | 3300001971 | Marine | QRGLMLKRGQALYVAASGATALTNGFYCNVQGGFY* |
| KVRMV2_1000641641 | 3300002231 | Marine Sediment | RGLMLKRGQALYVSVSGTAALTNGFYCNIQGGYY* |
| B570J40625_1001460691 | 3300002835 | Freshwater | GANFSSTNSTVSPKIRGLMLQRGQALYVAASGATSLTNGFYAGVQAGYY* |
| B570J40625_1006782441 | 3300002835 | Freshwater | SATSPKIRGMMLKRGQALYASYSGTTALTNGFYVTAQGGYY* |
| JGI25910J50241_100272882 | 3300003388 | Freshwater Lake | ANFTSANSTTAPKLRGLTLQRGQSLYAAFSGATSLTNGFYVNVEAGYY* |
| Ga0065166_105026451 | 3300004112 | Freshwater Lake | PVPHAGGNFGSATNEVAPKNRGLVIQRGQAIYAAVGGTTNLTSGFYVCAQGGYY* |
| Ga0074648_10431931 | 3300005512 | Saline Water And Sediment | VPHAGANFVSANNEVSPKMRGLMLPRGTALYAAVSGTTALTNGFYVNVQAGYY* |
| Ga0066835_103603222 | 3300005606 | Marine | RGLMLKRGQALYVATSGATALTNGFYCNVQGGFY* |
| Ga0066840_101019481 | 3300005608 | Marine | NNALAPKQRGLMLKRGQALYVAASGANALTNGFYCNVQGGFY* |
| Ga0098040_10707322 | 3300006751 | Marine | AQSGANVSSSNSNILPKQRGLMLQRGQALYCSVSGATALTNGFYCNVQAGYY* |
| Ga0070749_103093252 | 3300006802 | Aqueous | PVVQAGSNFVTANNEVAPKQRGLILQRGQAIYAAVSGTTALTNGFYVNIQGGYY* |
| Ga0103959_12859872 | 3300007214 | Freshwater Lake | ANFTSTNSTTSPKMRGLMLQRGQALYAAASGGTSLTNGFYVGVQGGYY* |
| Ga0075460_103245172 | 3300007234 | Aqueous | MRGLMLQRGQALYAAVSGATSLANGFYVNVQAGYY* |
| Ga0099851_10426943 | 3300007538 | Aqueous | EVSPKMRGLMLPRGTALYAAVSGTTALTNGFYVNIQAGYY* |
| Ga0099849_11362271 | 3300007539 | Aqueous | MRGLMLPRGTALYAAVSGTVALTNGFYVNVQSGYY* |
| Ga0099849_12830413 | 3300007539 | Aqueous | ANNEVAPKMRGLMLPRGTALYAAVSGTTALTNGFYVNVQAGYY* |
| Ga0099848_11904301 | 3300007541 | Aqueous | PKIRGLVLQRGQALYAAVSGTTSLTNGFFINIQGGYY* |
| Ga0099846_11620361 | 3300007542 | Aqueous | GSNFGSANNEVAPKMRGLMLPRGTALYAAVSGTTALTNGFYINIQAGYY* |
| Ga0099846_13378801 | 3300007542 | Aqueous | VPHAGGNFGSATNEVAPKNRGLVIQRGQAIYAAVGGTTNLTSGFYVCAQGGYY* |
| Ga0105547_10496331 | 3300007750 | Marine Sponge (Stylissa Sp.) | NEIAPKQRGLMLRRGQALYVAASGSTALTNGFYCNVQGGFY* |
| Ga0099850_14020212 | 3300007960 | Aqueous | ANNEVAPKNRGLVLQRGQALYAAVSGTSALTGGFYVCLQGGYY* |
| Ga0105746_12489461 | 3300007973 | Estuary Water | KMRGLVMERGQALYAAVSGTTALTNGFYVCVQGGFY* |
| Ga0108970_117492061 | 3300008055 | Estuary | PVVQAGANFSSTNNEVAAKHRGLVLQRGQAIYAAVSGTTALTNGFYVNVQAGYY* |
| Ga0114876_11818031 | 3300008448 | Freshwater Lake | GSNFVSANNEVSPKTRGLVMERGQALYATVSGTTALTSGFYVCVQGGFY* |
| Ga0114932_100506453 | 3300009481 | Deep Subsurface | ANNEIAPKQRGLMLKRGQALYVAASGATALTNGFFCNLQGGFY* |
| Ga0115011_107636692 | 3300009593 | Marine | EVAPKQRGIMLKRGQALYVASTGSTALTTGFYCNVQGGYY* |
| Ga0115012_108870311 | 3300009790 | Marine | GSNFVSANNEVAPKQRGLMLKRGQALYVAASGATALTNGFYCNVQGGFY* |
| Ga0115012_112895251 | 3300009790 | Marine | SANNEVAPKQRGLMLKRGQALYVSVSGTAALTNGFYCNIQGGYY* |
| Ga0115012_116788661 | 3300009790 | Marine | VAPKQRGLMLKRGQALYVAASGSTALTTGFYCNVQGGYY* |
| Ga0098043_100221510 | 3300010148 | Marine | GSNNEIAPKQRGLMLRRGQALYVAASGATALTNGFYCNVQGGFY* |
| Ga0098061_10353531 | 3300010151 | Marine | APKQRGLMLKRGQALYVSVSGTSALTNGFYCNIQGGYY* |
| Ga0098059_13623381 | 3300010153 | Marine | PVAQSGNNVSSSNSNILPKQRGLMLQRGQALYCSVGGAISLTNGFYCNVQAGYY* |
| Ga0129348_12107971 | 3300010296 | Freshwater To Marine Saline Gradient | KMRGLMLKRGQALYAAASGATALTNGFYVNVQAGFY* |
| Ga0129348_12527553 | 3300010296 | Freshwater To Marine Saline Gradient | NNEVSPKMRGLMLPRGTALYAAVSGTTALTNGFYVNVQAGYY* |
| Ga0129348_12611522 | 3300010296 | Freshwater To Marine Saline Gradient | AATTTAPKMRGLMMRKGQSLYVAASGAVALTNGFYVNVQAGYY* |
| Ga0129342_10705881 | 3300010299 | Freshwater To Marine Saline Gradient | PVPHAGANFGSANNEVAPKMRGLMLPRGTALYAAVSGTTALTNGFYVNVQAGYY* |
| Ga0129342_12548131 | 3300010299 | Freshwater To Marine Saline Gradient | NFYSTNSTVAPKNRGLMLKRGQALYAAFSGATALTNGFYVTCQGGYY* |
| Ga0129336_104258801 | 3300010370 | Freshwater To Marine Saline Gradient | NNEVAPKNRGLVLQKGQAIYVAAGGSTALTSGFYINAQGGFY* |
| Ga0129336_105767002 | 3300010370 | Freshwater To Marine Saline Gradient | SNFGSANNEVAPKQRGLMLQRGQAIYAAVSGTTALTNGFYVNVQGGYY* |
| Ga0160422_100178596 | 3300012919 | Seawater | SGALNFAGSNNEIAPKQRGLMLRRGQALFVAASGATALTNGFYCNVQGGFY* |
| Ga0160422_106682011 | 3300012919 | Seawater | NEIAPKQRGLMLKRGQALYVAASGATALTNGFFCNVQGGFY* |
| Ga0163110_111730811 | 3300012928 | Surface Seawater | NFGSGNNEIAPKQRGLMLKRGQALYVAARGATALTNGFFCNVQGGFY* |
| Ga0163111_125515211 | 3300012954 | Surface Seawater | GSANSNKALKSRGLMLKRGQALYAAVSGSTALTNGFYVGVQGGFY* |
| (restricted) Ga0172363_105634112 | 3300013130 | Sediment | ANSTTSPKIRGLILQRGQALYVATSGATALTGGFYVNIQSGYY* |
| Ga0116834_11042191 | 3300013188 | Marine | GSNMGSANSNKALKSRGLMLKRGQALYAAVSGSTALTNGFYVGVQGGFY* |
| Ga0180120_103772602 | 3300017697 | Freshwater To Marine Saline Gradient | PKMRGLMMRKGQSLYVAASGASALTNGFYVNVQAGYY |
| Ga0181362_10204252 | 3300017723 | Freshwater Lake | FTSTNSTVSPKMRGLMLQRGQALYVSVSGTTSLTNGFYCNVQAGYY |
| Ga0181416_11444412 | 3300017731 | Seawater | SGNNEVAPKQRGLMLKRGQALYVAASGSTALTTGFYCNVQGGYY |
| Ga0181415_10079991 | 3300017732 | Seawater | PVVQSGAANFAGANNEIAPKQRGLMLKRGQALYVAASGATALTNGFFCNLQGGFY |
| Ga0181415_10562181 | 3300017732 | Seawater | FTSANNEVAPKQRGLMLKRGQALYVAASGATALTTGFYCNVQGGFY |
| Ga0181418_10240902 | 3300017740 | Seawater | MGSANSSKALKSRGLMLKRGQALYAAVSGATALTNGFYVGVQGGFY |
| Ga0181418_11308751 | 3300017740 | Seawater | VQAGSNFVSANNEVAPKQRGLMLKRGQALYVAASGATALTNGFYCNVQGGFY |
| Ga0181389_11536031 | 3300017746 | Seawater | NHPVVQAGTNMGSANSSKALKSRGLMLKRGQALYAAVSGATALTNGFYVGVQGGFY |
| Ga0187220_12503231 | 3300017768 | Seawater | GSNFGSANNEIAPKQRGLMLKRGQALYVAASGATALTNGFYCNIQGGFY |
| Ga0169931_104935891 | 3300017788 | Freshwater | AGANFTSANSKTSPKMRGLILQRGQALYVATSGATALTNGFYVNVQAGFY |
| Ga0180432_106332113 | 3300017989 | Hypersaline Lake Sediment | SANNEVAPKMRGLMLPRGTALYAAVSGTTALTNGFYVNVQAGYY |
| Ga0180436_104369691 | 3300017990 | Hypersaline Lake Sediment | PIPHAGANFVSTNNEVSPKMRGLMLPRGTALYAAVSGTTALTNGFYINVQGGYY |
| Ga0211733_101814922 | 3300020160 | Freshwater | STGSGIAPKLLGLMLPRGASIYAAVSGAVSLTTGFYVNVQAGYY |
| Ga0211726_105873831 | 3300020161 | Freshwater | ISPKMRGLMLQRGQALYVAASGSVALTNGFYVSVQGGYY |
| Ga0194115_102131113 | 3300020183 | Freshwater Lake | NEVAPKTRGLVMERGQALYATVSGTTALTSGFYVCVQGGFY |
| Ga0194118_103131781 | 3300020190 | Freshwater Lake | GSANNEVAPKTRGLVMERGQALYATVSGTTALTSGFYVCVQGGFY |
| Ga0211526_10293311 | 3300020264 | Marine | HPVVQAGANFTGANSKVSPKLRGLMLNRGQALYAAASGASALTNGFYVGVQGGYY |
| Ga0211507_10615462 | 3300020325 | Marine | PVVQAGANFTGANSKVSPKLRGLMLNRGQALYAAASGASALTNGFYVGVQGGYY |
| Ga0211705_101127151 | 3300020395 | Marine | NNEVAPKQRGLMLKRGQALYVAASGATALTTGFYCNVQGGYY |
| Ga0211617_104035691 | 3300020401 | Marine | APKQRGLMLRRGQALYVAASGATALTNGFYCNVQGGFY |
| Ga0211523_104574632 | 3300020414 | Marine | KARGLMLKRGQALYAAASGASALTNGFYVGIQGGFY |
| Ga0211708_100699381 | 3300020436 | Marine | HPTVQAGANFGSANNALAPKQRGLMLKRGQALYVAASGANALTNGFYCNVQGGFY |
| Ga0211708_102881731 | 3300020436 | Marine | EIAPKQRGLMLRRGQALYVAASGATALTNGFYCNIQGGFY |
| Ga0211564_104388351 | 3300020445 | Marine | PKQRGLMLKRGQALYVAASGTSALTTGFYCNVQGGYY |
| Ga0211545_100872701 | 3300020452 | Marine | SANNEIAPKQRGLMLKRGQALYVAASGANALTNGFYCNVQGGFY |
| Ga0211694_104957611 | 3300020464 | Marine | PTVQAGANFGSANNALAPKQRGLMLKRGQALYVAASGATALTNGFYCNVQGGFY |
| Ga0211543_102109601 | 3300020470 | Marine | KQRGLMLSRGQALYVSVSGATALTNGFYCNVQGGYY |
| Ga0194117_101901003 | 3300021424 | Freshwater Lake | NFGSANNEVAPKTRGLVMERGQALYATVSGTTALTSGFYVCVQGGFY |
| Ga0196905_10413022 | 3300022198 | Aqueous | HPVVQAGSNFGSANNEVAPKQRGIMLQRGQAIYAAVSGTTALTNGFYVNVQGGYY |
| Ga0196901_10221363 | 3300022200 | Aqueous | VQAGSAATTTAPKMRGLMMRKGQSLYVAASGASALTNGFYVNVQAGYY |
| Ga0196901_10231121 | 3300022200 | Aqueous | AGSNFGSANNEVAPKMRGLMLPRGTALYAAVSGTTALTNGFYVNVQAGYY |
| Ga0196901_10588051 | 3300022200 | Aqueous | NSTVAPKNRGLMLKRGQALYAAFSGATALTNGFYVTCQGGYY |
| Ga0196901_11273731 | 3300022200 | Aqueous | INHPVAQTGANFTSANSTTSPKMRGMMLQRGQALYIAVSGGTSLTNGFYVGVQGGYY |
| Ga0196901_11925923 | 3300022200 | Aqueous | NHPVPHAGANFSSNNNEVSPKMRGLMLPRGTALYAAVSGTVALTNGFYINVQSGYY |
| Ga0255772_101036872 | 3300023176 | Salt Marsh | VSPKTRGLILQRGQALYAAVSGTTALTNGFYVNVQGGYY |
| Ga0209992_103578441 | 3300024344 | Deep Subsurface | FAGANNEIAPKQRGLMLKRGQALYVAASGATALTNGFFCNLQGGFY |
| Ga0208667_10281391 | 3300025070 | Marine | NSSKALKSRGLMLKRGQALYAAVSGSTALTNGFYVGVQGGFY |
| Ga0208666_10060726 | 3300025102 | Marine | LTIPKHRGLMLRRGQALFVATSGATALTNAFYCNVQGGFY |
| Ga0208793_10659442 | 3300025108 | Marine | NEIAPKQRGLMLKRGQALYVSASGTAALTNGFYCNVQGGYY |
| Ga0208158_10181192 | 3300025110 | Marine | IAPKQRGLMLKRGQALYVSVSGTSALTNGFYCNVQGGYY |
| Ga0208158_10851891 | 3300025110 | Marine | VQAGTNFTSANNEVAPKQRGLMLKRGQALFVAASGTTALTTGFYCNVQGGYY |
| Ga0209645_10311611 | 3300025151 | Marine | QRGLMLKRGQALYVSVSGTAALTNGFYCNIQGGYY |
| Ga0209645_10367042 | 3300025151 | Marine | NNEIAPKQRGLMLRRGQALYVAASGSTALTNGFYCNVQGGFY |
| Ga0209645_11567651 | 3300025151 | Marine | SNNEIAPKQRGLMLRRGQALYVAASGATALTNGFYCNIQGGFY |
| Ga0209645_11789731 | 3300025151 | Marine | NASLAPKQRGLMLKRGQALYVAASGATALTNGFYCNVQGGFY |
| Ga0208161_10382531 | 3300025646 | Aqueous | APKNRGLMLKRGQALYAAFSGATALTNGFYVTCQGGYY |
| Ga0208795_10177333 | 3300025655 | Aqueous | HAGANFSSNNNEVSPKMRGLMLPRGTALYAAVSGTVALTNGFYINVQSGYY |
| Ga0208795_10870641 | 3300025655 | Aqueous | TAPKMRGLMLKRGQALYAAASGATALTNGFYVNVQAGFY |
| Ga0208767_10229235 | 3300025769 | Aqueous | TNMGSANSSKALKSRGLMLKRGQALYAAVSGANALTNGFYVGVQGGFY |
| Ga0208542_10293553 | 3300025818 | Aqueous | KMRGLILPRGSALYAAASGTTALTSGFYINVQGGYY |
| Ga0255270_10778351 | 3300026572 | Freshwater | KMRGLVMERGQALYASVSGTNALTNGFYVCVQGGYY |
| Ga0209404_100225385 | 3300027906 | Marine | VQSGAANWGSANNEIAPKQRGLMLKRGQALYVSASGTAALTNGFYCNVQGGYY |
| Ga0209536_1017313551 | 3300027917 | Marine Sediment | IAPKMRGLILPRGSALYAAASGTTALTSGFYINVQGGYY |
| Ga0185543_10325731 | 3300029318 | Marine | LRGLMLNRGQALYAAASGASALTNGFYVGVQGGYY |
| Ga0183748_10150514 | 3300029319 | Marine | GALNFAGSNNEIAPKQRGLMLRRGQALYVAASGSTALTNGFYCNVQGGFY |
| Ga0307379_115689462 | 3300031565 | Soil | APKMRGLMMRKGQSLYVAASGAVALTNGFYVNVQAGYY |
| Ga0315291_101012614 | 3300031707 | Sediment | AGANFTSANSTTAPKLRGLTLQRGQSLYAAFSGATSLTNGFYVNVEAGYY |
| Ga0315907_104002412 | 3300031758 | Freshwater | NFYTANSATAPKIRGMMLKRGQALYAAYSGTTALTNGFYVTAQGGYY |
| Ga0315332_108912352 | 3300031773 | Seawater | AGNNFGSANNEIAPKQRGLMLKRGQSLYVAASGTTALTTGFYCNVQGGYY |
| Ga0315899_105361991 | 3300031784 | Freshwater | PTVQAGSNFYTANSATAPKIRGMMLKRGQALYAAYSGTTALTNGFYVTAQGGYY |
| Ga0315290_111199331 | 3300031834 | Sediment | ANFASTNSTTSPKMRGLMLQRGQAIYAAVSGPTSLTNGFYVGVQAGYY |
| Ga0315274_117934151 | 3300031999 | Sediment | MRGLMLQRGQALYVSVSGTTSLTNGFYCNVQAGYY |
| Ga0315330_100375095 | 3300032047 | Seawater | SNNEIAPKQRGLMLRRGQALYVAASGATALTNGFYCNVQGGFY |
| Ga0315287_128686841 | 3300032397 | Sediment | PVVQSGANFTSTNSTTAAKMRGLMLQRGQALYVATGGSVSLSSGFYVNCQAAYY |
| ⦗Top⦘ |