


| Basic Information | |
|---|---|
| Family ID | F085532 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 111 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MSALRLVLLFVVSLALTGCPGPNYAPYDNMNNNSPG |
| Number of Associated Samples | 86 |
| Number of Associated Scaffolds | 111 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 80.18 % |
| % of genes near scaffold ends (potentially truncated) | 16.22 % |
| % of genes from short scaffolds (< 2000 bps) | 85.59 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.35 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (70.270 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (32.432 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.838 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (49.550 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 25.00% β-sheet: 0.00% Coil/Unstructured: 75.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 111 Family Scaffolds |
|---|---|---|
| PF01019 | G_glu_transpept | 8.11 |
| PF10014 | 2OG-Fe_Oxy_2 | 5.41 |
| PF09931 | DUF2163 | 5.41 |
| PF00496 | SBP_bac_5 | 3.60 |
| PF06627 | DUF1153 | 3.60 |
| PF02900 | LigB | 2.70 |
| PF04519 | Bactofilin | 2.70 |
| PF07542 | ATP12 | 1.80 |
| PF01610 | DDE_Tnp_ISL3 | 1.80 |
| PF08241 | Methyltransf_11 | 1.80 |
| PF07690 | MFS_1 | 1.80 |
| PF13356 | Arm-DNA-bind_3 | 0.90 |
| PF14690 | zf-ISL3 | 0.90 |
| PF01569 | PAP2 | 0.90 |
| PF13610 | DDE_Tnp_IS240 | 0.90 |
| PF05598 | DUF772 | 0.90 |
| PF13472 | Lipase_GDSL_2 | 0.90 |
| PF02371 | Transposase_20 | 0.90 |
| PF14696 | Glyoxalase_5 | 0.90 |
| PF12146 | Hydrolase_4 | 0.90 |
| PF13467 | RHH_4 | 0.90 |
| PF07746 | LigA | 0.90 |
| PF09356 | Phage_BR0599 | 0.90 |
| PF13358 | DDE_3 | 0.90 |
| PF09297 | zf-NADH-PPase | 0.90 |
| PF02738 | MoCoBD_1 | 0.90 |
| PF00006 | ATP-synt_ab | 0.90 |
| PF13193 | AMP-binding_C | 0.90 |
| PF01464 | SLT | 0.90 |
| PF13419 | HAD_2 | 0.90 |
| COG ID | Name | Functional Category | % Frequency in 111 Family Scaffolds |
|---|---|---|---|
| COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 8.11 |
| COG1664 | Cytoskeletal protein CcmA, bactofilin family | Cytoskeleton [Z] | 2.70 |
| COG3464 | Transposase | Mobilome: prophages, transposons [X] | 1.80 |
| COG5387 | Mitochondrial FoF1-type ATP synthase assembly chaperone ATP12 | Posttranslational modification, protein turnover, chaperones [O] | 1.80 |
| COG0272 | NAD-dependent DNA ligase | Replication, recombination and repair [L] | 0.90 |
| COG2816 | NADH pyrophosphatase NudC, Nudix superfamily | Nucleotide transport and metabolism [F] | 0.90 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.90 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 70.27 % |
| Unclassified | root | N/A | 29.73 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_101714705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1892 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_105723757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1359 | Open in IMG/M |
| 3300001661|JGI12053J15887_10016597 | All Organisms → cellular organisms → Bacteria | 4094 | Open in IMG/M |
| 3300001661|JGI12053J15887_10040994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2600 | Open in IMG/M |
| 3300001661|JGI12053J15887_10083306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1757 | Open in IMG/M |
| 3300001661|JGI12053J15887_10138504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1288 | Open in IMG/M |
| 3300005435|Ga0070714_100858502 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 880 | Open in IMG/M |
| 3300005451|Ga0066681_10981515 | Not Available | 504 | Open in IMG/M |
| 3300005454|Ga0066687_10327649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 873 | Open in IMG/M |
| 3300005467|Ga0070706_100243141 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1680 | Open in IMG/M |
| 3300005467|Ga0070706_100752928 | Not Available | 902 | Open in IMG/M |
| 3300005468|Ga0070707_101613687 | Not Available | 616 | Open in IMG/M |
| 3300005471|Ga0070698_101216701 | Not Available | 703 | Open in IMG/M |
| 3300005536|Ga0070697_102141685 | Not Available | 501 | Open in IMG/M |
| 3300005561|Ga0066699_10619858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 777 | Open in IMG/M |
| 3300005564|Ga0070664_101041013 | Not Available | 770 | Open in IMG/M |
| 3300005564|Ga0070664_101754376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 589 | Open in IMG/M |
| 3300005598|Ga0066706_10670180 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 824 | Open in IMG/M |
| 3300005614|Ga0068856_100806182 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 958 | Open in IMG/M |
| 3300005614|Ga0068856_100889175 | Not Available | 910 | Open in IMG/M |
| 3300005764|Ga0066903_100770578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1713 | Open in IMG/M |
| 3300005921|Ga0070766_10779514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → unclassified Oxalobacteraceae → Oxalobacteraceae bacterium | 650 | Open in IMG/M |
| 3300006032|Ga0066696_10997676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 533 | Open in IMG/M |
| 3300006755|Ga0079222_10073359 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1694 | Open in IMG/M |
| 3300006797|Ga0066659_10391265 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
| 3300006800|Ga0066660_10607507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 913 | Open in IMG/M |
| 3300006903|Ga0075426_10323369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1130 | Open in IMG/M |
| 3300006954|Ga0079219_10294183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1001 | Open in IMG/M |
| 3300007255|Ga0099791_10424576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 641 | Open in IMG/M |
| 3300007788|Ga0099795_10097411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae | 1149 | Open in IMG/M |
| 3300007788|Ga0099795_10259770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 752 | Open in IMG/M |
| 3300007788|Ga0099795_10570128 | Not Available | 536 | Open in IMG/M |
| 3300009012|Ga0066710_100552358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1742 | Open in IMG/M |
| 3300009088|Ga0099830_10854691 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300009093|Ga0105240_11312281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 763 | Open in IMG/M |
| 3300010048|Ga0126373_10234364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1798 | Open in IMG/M |
| 3300010159|Ga0099796_10018045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae | 2112 | Open in IMG/M |
| 3300010366|Ga0126379_10455428 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1342 | Open in IMG/M |
| 3300010366|Ga0126379_12310396 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 638 | Open in IMG/M |
| 3300010373|Ga0134128_10291094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1830 | Open in IMG/M |
| 3300010396|Ga0134126_11451521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 757 | Open in IMG/M |
| 3300010397|Ga0134124_12415802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 567 | Open in IMG/M |
| 3300011269|Ga0137392_10222838 | Not Available | 1548 | Open in IMG/M |
| 3300011269|Ga0137392_10685870 | Not Available | 848 | Open in IMG/M |
| 3300011270|Ga0137391_10068999 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3034 | Open in IMG/M |
| 3300011270|Ga0137391_10427555 | Not Available | 1129 | Open in IMG/M |
| 3300012198|Ga0137364_10428222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 992 | Open in IMG/M |
| 3300012200|Ga0137382_10085606 | Not Available | 2052 | Open in IMG/M |
| 3300012200|Ga0137382_10520771 | Not Available | 846 | Open in IMG/M |
| 3300012202|Ga0137363_10220101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1531 | Open in IMG/M |
| 3300012203|Ga0137399_10600347 | Not Available | 925 | Open in IMG/M |
| 3300012204|Ga0137374_10364295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1161 | Open in IMG/M |
| 3300012208|Ga0137376_10138003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2092 | Open in IMG/M |
| 3300012211|Ga0137377_11868191 | Not Available | 519 | Open in IMG/M |
| 3300012360|Ga0137375_10148196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2297 | Open in IMG/M |
| 3300012362|Ga0137361_10182857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1890 | Open in IMG/M |
| 3300012362|Ga0137361_10409912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1245 | Open in IMG/M |
| 3300012362|Ga0137361_11682344 | Not Available | 554 | Open in IMG/M |
| 3300012582|Ga0137358_10105666 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1908 | Open in IMG/M |
| 3300012582|Ga0137358_10202079 | Not Available | 1356 | Open in IMG/M |
| 3300012917|Ga0137395_10225427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1311 | Open in IMG/M |
| 3300012923|Ga0137359_10493518 | Not Available | 1081 | Open in IMG/M |
| 3300012923|Ga0137359_11072468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → unclassified Oxalobacteraceae → Oxalobacteraceae bacterium | 690 | Open in IMG/M |
| 3300012925|Ga0137419_10118212 | All Organisms → cellular organisms → Bacteria | 1866 | Open in IMG/M |
| 3300012960|Ga0164301_10707775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 759 | Open in IMG/M |
| 3300012971|Ga0126369_10312565 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1577 | Open in IMG/M |
| 3300012989|Ga0164305_10944268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 728 | Open in IMG/M |
| 3300013100|Ga0157373_11403579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 531 | Open in IMG/M |
| 3300015054|Ga0137420_1069334 | Not Available | 955 | Open in IMG/M |
| 3300015242|Ga0137412_10460935 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
| 3300018482|Ga0066669_11726247 | Not Available | 576 | Open in IMG/M |
| 3300019888|Ga0193751_1106699 | Not Available | 1068 | Open in IMG/M |
| 3300020583|Ga0210401_10073432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group | 3221 | Open in IMG/M |
| 3300021170|Ga0210400_10001257 | All Organisms → cellular organisms → Bacteria | 25432 | Open in IMG/M |
| 3300021170|Ga0210400_10005586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 10652 | Open in IMG/M |
| 3300021170|Ga0210400_10081148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha4_Bin1 | 2548 | Open in IMG/M |
| 3300021560|Ga0126371_11165931 | Not Available | 908 | Open in IMG/M |
| 3300024347|Ga0179591_1055820 | All Organisms → cellular organisms → Bacteria | 3486 | Open in IMG/M |
| 3300025910|Ga0207684_10281138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1435 | Open in IMG/M |
| 3300025922|Ga0207646_10012877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 8017 | Open in IMG/M |
| 3300025922|Ga0207646_10042088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 4105 | Open in IMG/M |
| 3300025922|Ga0207646_10210623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga | 1755 | Open in IMG/M |
| 3300026078|Ga0207702_10625547 | Not Available | 1058 | Open in IMG/M |
| 3300026078|Ga0207702_11151928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 769 | Open in IMG/M |
| 3300026374|Ga0257146_1040446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 756 | Open in IMG/M |
| 3300026490|Ga0257153_1020069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1365 | Open in IMG/M |
| 3300026490|Ga0257153_1105305 | Not Available | 558 | Open in IMG/M |
| 3300026508|Ga0257161_1075296 | Not Available | 694 | Open in IMG/M |
| 3300026514|Ga0257168_1136778 | Not Available | 546 | Open in IMG/M |
| 3300026538|Ga0209056_10681984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 519 | Open in IMG/M |
| 3300026557|Ga0179587_10117783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1626 | Open in IMG/M |
| 3300027181|Ga0208997_1050290 | Not Available | 620 | Open in IMG/M |
| 3300027381|Ga0208983_1022908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga | 1219 | Open in IMG/M |
| 3300027383|Ga0209213_1008998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga | 1791 | Open in IMG/M |
| 3300027480|Ga0208993_1074057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 620 | Open in IMG/M |
| 3300027546|Ga0208984_1014606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1541 | Open in IMG/M |
| 3300027583|Ga0209527_1091623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 682 | Open in IMG/M |
| 3300027605|Ga0209329_1009162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1850 | Open in IMG/M |
| 3300027616|Ga0209106_1108263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 624 | Open in IMG/M |
| 3300027633|Ga0208988_1048515 | Not Available | 1084 | Open in IMG/M |
| 3300027669|Ga0208981_1022209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga | 1616 | Open in IMG/M |
| 3300027681|Ga0208991_1054839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1204 | Open in IMG/M |
| 3300027738|Ga0208989_10112700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga | 924 | Open in IMG/M |
| 3300027903|Ga0209488_10040282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3422 | Open in IMG/M |
| 3300027903|Ga0209488_10070973 | All Organisms → cellular organisms → Bacteria | 2582 | Open in IMG/M |
| 3300028047|Ga0209526_10118841 | Not Available | 1857 | Open in IMG/M |
| 3300028536|Ga0137415_11366911 | Not Available | 529 | Open in IMG/M |
| 3300028536|Ga0137415_11483833 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 503 | Open in IMG/M |
| 3300030839|Ga0073999_10058375 | Not Available | 623 | Open in IMG/M |
| 3300030991|Ga0073994_12119553 | Not Available | 522 | Open in IMG/M |
| 3300031047|Ga0073995_10095414 | Not Available | 662 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 32.43% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 15.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.01% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.11% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.50% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.70% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.70% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.80% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.80% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.90% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.90% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.90% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.90% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.90% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026374 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-A | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027181 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027381 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027383 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027480 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027669 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300030839 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil TCEFB (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031047 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1B (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1017147053 | 3300000364 | Soil | MSKLWFVLLFIAGLALSGCPGPNYAPYDNMTGGYG* |
| INPhiseqgaiiFebDRAFT_1057237572 | 3300000364 | Soil | MSALRLVLLFVATVALSGALMGVLTGCPGPNYAPYDNMNNNSPG* |
| JGI12053J15887_100165975 | 3300001661 | Forest Soil | ALRFVLLFVVTLALMGCPGPNYAPYDNMNNNSPG* |
| JGI12053J15887_100409944 | 3300001661 | Forest Soil | MMSALRHVLLFVVALMLTGCPGRNYAPYDHMTNSYG* |
| JGI12053J15887_100833062 | 3300001661 | Forest Soil | MNDRLTAALRFVLLFVVTLALMGCPGPNYAPYDNMNNNSPG* |
| JGI12053J15887_101385042 | 3300001661 | Forest Soil | MSTLRLVLLFVVSLALIGALTGCPGPNYAPYDNMNNNSPG* |
| Ga0070714_1008585022 | 3300005435 | Agricultural Soil | MRRASMLIGLRFVLLLLAVLMLAGCPGPNYAPYDNMTNSPGVG* |
| Ga0066681_109815151 | 3300005451 | Soil | MDAGKGAADGRAETILLLVVTLTLTGCPGPHYAPYDNMNNNSPG* |
| Ga0066687_103276492 | 3300005454 | Soil | AKLAMLIAARFALLLVSVLALTGCPGPNYAPYDNMTNSPGVG* |
| Ga0070706_1002431412 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MSALRLVLLFVATVALAGALMGTLTGCPGPDYAPYDNMNNNSPG* |
| Ga0070706_1007529282 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MSALRLVLLFVATVALSGALTGCPGPDYAPYDNMNNNSPG* |
| Ga0070707_1016136871 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MSALRLVLLFVATVALAGALMGVLTGCPGPDYAPYDNMNNNSPG* |
| Ga0070698_1012167012 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MSALRLVLLFVATVALAGALMGTLTGCPGPDYAPYDNMNNNSP |
| Ga0070697_1021416852 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MSALRLVLLFVATVALSGALMGTLTGCPGPDYARYDNMNNNSPN* |
| Ga0066699_106198582 | 3300005561 | Soil | MAAFRLVLLFVAALALTGCAGPNYAPYDNMRNSYG* |
| Ga0070664_1010410131 | 3300005564 | Corn Rhizosphere | MGAYLPMSLRFVLLLIAVLALTGCPGPNYAPDDNMRNSYG* |
| Ga0070664_1017543761 | 3300005564 | Corn Rhizosphere | MLIALRFALLFVAVLMLAGCPGPNYAPYDNMTNSPGVG* |
| Ga0066706_106701802 | 3300005598 | Soil | MLTGLRLVFLLTAMLTLTGCPGPNYAPYNNMRNSSE* |
| Ga0068856_1008061822 | 3300005614 | Corn Rhizosphere | MLIALRFVLLLLAVLMLAGCPGPNYAPYDNMTNSPGVG* |
| Ga0068856_1008891753 | 3300005614 | Corn Rhizosphere | MSLRFVLLLIAVLALTGCPGPNYAPYDNMRNSYG* |
| Ga0066903_1007705783 | 3300005764 | Tropical Forest Soil | MICALRLVLLFVAMLAVTGCPGPNYAPYNNMKNSYG* |
| Ga0070766_107795141 | 3300005921 | Soil | MAALRLVLLFVAVLALTGCAGPNYAPYDNMTNSYG* |
| Ga0066696_109976762 | 3300006032 | Soil | AMALRFVLLLVAMVALAGCPGANYAPYDNMRNSSA* |
| Ga0079222_100733593 | 3300006755 | Agricultural Soil | MDEVADKPPMLTALRFVLLFVAVLMLAGCPGPNYAPYDNMTNSPGVG* |
| Ga0066659_103912653 | 3300006797 | Soil | MAALRLVVLFVAALALTGCPGPNYAPYDNMRNSYG* |
| Ga0066660_106075072 | 3300006800 | Soil | MAALRLVLLFVAALALTGCPGPNYAPYDNMRNSYG* |
| Ga0075426_103233693 | 3300006903 | Populus Rhizosphere | MLALRFVLLFVAVLMLAACPGPNYAPYDNMTNSPGVG* |
| Ga0079219_102941832 | 3300006954 | Agricultural Soil | MSLRFVLLLIAMLALTGCPGPNYAPYDNMRNSYG* |
| Ga0099791_104245762 | 3300007255 | Vadose Zone Soil | MAALRLVVLFVAALALTGCAGPNYAPYDNMRNSYG* |
| Ga0099795_100974111 | 3300007788 | Vadose Zone Soil | MMSALRHVLLFVVALTLTGCPGPNYAPYDNMNNNSPG* |
| Ga0099795_102597702 | 3300007788 | Vadose Zone Soil | MMSALRHVLLFVVALMLTGCPGPNYAPYDHMTNSYG* |
| Ga0099795_105701282 | 3300007788 | Vadose Zone Soil | MTLRLVLLFVVTLSLTGCPGPNYAPYDNMTGGYG* |
| Ga0066710_1005523582 | 3300009012 | Grasslands Soil | MAALRLVLLFVATLALTGCPGPNYAPYDNMRNSYG |
| Ga0099830_108546911 | 3300009088 | Vadose Zone Soil | MMAALRLVLLFVVALALTGCPGPQYAPYDNMKNSYG* |
| Ga0105240_113122813 | 3300009093 | Corn Rhizosphere | MLIGLRFVLLLLAVLMLAGCPGPNYAPYDNMTNSPGVG* |
| Ga0126373_102343643 | 3300010048 | Tropical Forest Soil | MIWGLRFVLLFVALLALTGCPGRNYAPYDNMTNSYG* |
| Ga0099796_100180454 | 3300010159 | Vadose Zone Soil | MMSALRHVLLFVVALMLTGCPGPNYAPYDNMNNNSPG* |
| Ga0126379_104554282 | 3300010366 | Tropical Forest Soil | MIWGLRFVLLFIALLALMGCPGPNYAPYDNMTNSYG* |
| Ga0126379_123103961 | 3300010366 | Tropical Forest Soil | SLSDFGVMSVLRFVFLLLATLMLTGCPGPTYAPYDNMTNSYG* |
| Ga0134128_102910943 | 3300010373 | Terrestrial Soil | MSALRLVVLFLAVRALTGCPGPKYAPKDNMTNSYG* |
| Ga0134126_114515211 | 3300010396 | Terrestrial Soil | PMLALRCILLFLAMLMLAGCPGPNYAPYDNMTNSPGVG* |
| Ga0134124_124158021 | 3300010397 | Terrestrial Soil | MLALRFVLLFVAVLMLAACPGPNYAPYDNMTNSAGVG* |
| Ga0137392_102228382 | 3300011269 | Vadose Zone Soil | MMAALRVVLLFVVALALTGCPGPNYAPYDNMTNSPG* |
| Ga0137392_106858702 | 3300011269 | Vadose Zone Soil | TELNGRSMMAALRLVLLFVVALALTGCPGPQYAPYDNMKNSYG* |
| Ga0137391_100689991 | 3300011270 | Vadose Zone Soil | KRGISLQAEVMMAALRLVVLFVMALALTGCPGPNYAPYDNMTNSPG* |
| Ga0137391_104275551 | 3300011270 | Vadose Zone Soil | MMAALRLDLLFVVALALTGCPGPQYAPYDNMKNSYG* |
| Ga0137364_104282222 | 3300012198 | Vadose Zone Soil | MAALRLILLFVVMLALTGCPGPHYAPYDNMNNNSPG* |
| Ga0137382_100856063 | 3300012200 | Vadose Zone Soil | MAALRLVLLFVAALALTGCAGPNYAPYDNMRNSYG* |
| Ga0137382_105207712 | 3300012200 | Vadose Zone Soil | LMAALRLILLFVVTLTLTGCPGPHYAPYDNMNNNSPG* |
| Ga0137363_102201012 | 3300012202 | Vadose Zone Soil | MAALRLILLFVVTLMLTGCPGPHYAPYDNMNNNSPG* |
| Ga0137399_106003472 | 3300012203 | Vadose Zone Soil | MAALRLILLFVVTLTLTGCPGPHYAPYDNMNNNSPG* |
| Ga0137374_103642953 | 3300012204 | Vadose Zone Soil | MTTALKLVVLLVVALTLTGCAGPGYAPYDNLKNSYG* |
| Ga0137376_101380031 | 3300012208 | Vadose Zone Soil | CPAEAMMSALRHVLLFVVALMLTGCPGRNYAPYDHMTNSYG* |
| Ga0137377_118681912 | 3300012211 | Vadose Zone Soil | RRWTPAREALMAALRLILLFVVMLALTGCPGPHYAPYDNMNNNSPG* |
| Ga0137375_101481963 | 3300012360 | Vadose Zone Soil | MTTALKLVVLFVVALTLTGCAGPGYAPYDNLKNSYG* |
| Ga0137361_101828572 | 3300012362 | Vadose Zone Soil | MTALRLVLLLVVALALTGCAGPNYAPYDNMRNSYG* |
| Ga0137361_104099121 | 3300012362 | Vadose Zone Soil | RRAGEEEAEATMSTLRLVLLFVVSLALIGALTGCPGPNYAPYDNMNNNSPG* |
| Ga0137361_116823441 | 3300012362 | Vadose Zone Soil | MMSALRLVLLFIVTLALTGCPGPDYAPYDNMNNNSPG* |
| Ga0137358_101056662 | 3300012582 | Vadose Zone Soil | MAALRLMLLFIVALGLMGCPGPQYAPYNNMTNSKG* |
| Ga0137358_102020793 | 3300012582 | Vadose Zone Soil | MMSALRHVLLFLVALMLTGCPGPNYAPYDHMTNSYG* |
| Ga0137395_102254272 | 3300012917 | Vadose Zone Soil | MMSALRHVLLFVVTLMLTGCPGPNYAPYDHMTNSYG* |
| Ga0137359_104935182 | 3300012923 | Vadose Zone Soil | MKVLRLVLLFVVTLALTGCPGPNYAPYDNMTNGYG* |
| Ga0137359_110724681 | 3300012923 | Vadose Zone Soil | MAALRLVLLLVVALALTGCAGPNYAPYDNMNNNSPG* |
| Ga0137419_101182122 | 3300012925 | Vadose Zone Soil | MIPKLCLVLLFVATLALMGCPGPNYAPYDNMNNNSPG* |
| Ga0164301_107077751 | 3300012960 | Soil | MDKLAAKLAMLIAVRFALLLVSVLALTRCPGPNYAPYDNMTNSPGVG* |
| Ga0126369_103125652 | 3300012971 | Tropical Forest Soil | MIWGLRFVLLFVALLALTGCPGRNYAPYDNMTNSYE* |
| Ga0164305_109442682 | 3300012989 | Soil | MDKVAAKAAMLTALRFVFLLTAMLTLTGCPGPNYAPYDNMTNSPGVG* |
| Ga0157373_114035792 | 3300013100 | Corn Rhizosphere | MSALRLVVLFVAVLALTGCPGPNYAPYNNMTNSYG* |
| Ga0137420_10693341 | 3300015054 | Vadose Zone Soil | MMSALRHVLLFLVALMLTGCPGPNYAPYDNMNNNSPG* |
| Ga0137412_104609352 | 3300015242 | Vadose Zone Soil | MIPKLCLVLLFVVTLALMGCPGPNYAPYDNMNNNSPG* |
| Ga0066669_117262471 | 3300018482 | Grasslands Soil | MAALRLILLLVVTLTLTGCPGPHYAPYDNMNNNSPG |
| Ga0193751_11066991 | 3300019888 | Soil | MMPALRLVLLFVVTLALTGCPGPQYAPYDNMTNSYG |
| Ga0210401_100734323 | 3300020583 | Soil | MAALRLVLLLVAVLTLTGCAGPNYAPYDNMTNSYG |
| Ga0210400_1000125713 | 3300021170 | Soil | MSALRLVLLFVVSLALTGCPGPNYAPYDNMNNNSPG |
| Ga0210400_100055868 | 3300021170 | Soil | MSALRHVLLFVVALALTGCPGPNYAPYDNMTGGYG |
| Ga0210400_100811484 | 3300021170 | Soil | MISALRLVLLFIVTLALTGCPGPDYAPYDNMNNNSPG |
| Ga0126371_111659312 | 3300021560 | Tropical Forest Soil | MIWGLRFVLLFVALLALTGCPGRNYAPYDNMTNSYG |
| Ga0179591_10558201 | 3300024347 | Vadose Zone Soil | MIPKLCLVLLFVVTLALTGCPGPNYAPYDNMNNNSPG |
| Ga0207684_102811382 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MSALRLVLLFVATVALAGALMGTLTGCPGPDYAPYDNMNNNSPG |
| Ga0207646_1001287711 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MSALRLVLLFVATVALSGALMGTLTGCPGPDYAPYDNMNNNSPN |
| Ga0207646_100420882 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MPRLWLVLLFIAGLALSGCPGPNYAPYDNMTGGYG |
| Ga0207646_102106233 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MSALRHVLLFVVVLSLTGCPGPNYAPYDNMNNNSPG |
| Ga0207702_106255472 | 3300026078 | Corn Rhizosphere | MSSLRIVMLFVVILALTGCPGPNYAPYNNMGNSYG |
| Ga0207702_111519281 | 3300026078 | Corn Rhizosphere | MSALRLVVLFLAVRALTGCPGPKYAPKDNITNNYK |
| Ga0257146_10404463 | 3300026374 | Soil | MMSALRHVLLFVVALTLTGCPGPNYAPYDHMTNSYG |
| Ga0257153_10200692 | 3300026490 | Soil | MSALRFALLFVVTLALTGALIGALTGCPGPNYAPYDNMNNNSPG |
| Ga0257153_11053052 | 3300026490 | Soil | MMTGLRLVMLFVMALALTGCPGPNYAPYDHMTNSYG |
| Ga0257161_10752962 | 3300026508 | Soil | MSTLRLVLLFVVSLALIGALTGCPGPNYAPYDNMNNNSPG |
| Ga0257168_11367781 | 3300026514 | Soil | MMSALRHVLLFVVTLTLTGCPGPNYAPYDNMNNNSPG |
| Ga0209056_106819842 | 3300026538 | Soil | MAALRLVVLFVAALALTGCPGPNYAPYDNMRNSYG |
| Ga0179587_101177834 | 3300026557 | Vadose Zone Soil | MMSALRHVLLFVVALMLTGCPGRNYAPYDHMTNSYG |
| Ga0208997_10502901 | 3300027181 | Forest Soil | MMSTLRHVLLFVVALMLTGCPGPNYAPYDHMTNSYG |
| Ga0208983_10229082 | 3300027381 | Forest Soil | MNDRLIAALRFVLLLVVTLALTGCPGPNYAPYDNMNNNSPG |
| Ga0209213_10089983 | 3300027383 | Forest Soil | MSALRHVLLFLVALMLTGCPGPNYAPYDNMNNNSPG |
| Ga0208993_10740571 | 3300027480 | Forest Soil | MNDRLIAALRFVLLLVVTLALTGCPGPNYAPYDNMK |
| Ga0208984_10146062 | 3300027546 | Forest Soil | MMSALRHVLLFLVALMLTGCPGPNYAPYDNMNNNSPG |
| Ga0209527_10916232 | 3300027583 | Forest Soil | MAMVPALRLVLLFVVTLALTGCPGPQYAPYDNMTNSYG |
| Ga0209329_10091621 | 3300027605 | Forest Soil | MMSALRHVLLFVVALMLTGCPGPNYAPYDNMTNSYG |
| Ga0209106_11082633 | 3300027616 | Forest Soil | MMSALRHVLLFLVALMLTGCPGPNYAPYDHMTNSYG |
| Ga0208988_10485152 | 3300027633 | Forest Soil | MIPKLCLVLLFVVTLALMGCPGPNYAPYDNMNNNSPG |
| Ga0208981_10222093 | 3300027669 | Forest Soil | MSALRHVLLFVVALMLTGCPGPNYAPYDNMNNNSPG |
| Ga0208991_10548393 | 3300027681 | Forest Soil | MNDRLTAALRFVLLFVVTLALMGCPGPNYAPYDNMNNNSPG |
| Ga0208989_101127002 | 3300027738 | Forest Soil | MMSALRHVLLFVVALMLTGCPGPNYAPYDNMNNNSPG |
| Ga0209488_100402822 | 3300027903 | Vadose Zone Soil | MSALRHVLLFVVALMLTGCPGRNYAPYDHMTNSYG |
| Ga0209488_100709736 | 3300027903 | Vadose Zone Soil | MKVLRLVLLFVVTLALTGCPGPNYAPYDNMTNGYG |
| Ga0209526_101188412 | 3300028047 | Forest Soil | MAALRLVLLFVAALALAGCPGPGYAPYDNMTNSYG |
| Ga0137415_113669112 | 3300028536 | Vadose Zone Soil | MAALRLILLFVVTLTLTGCPGPHYAPYDNMNNNSPG |
| Ga0137415_114838332 | 3300028536 | Vadose Zone Soil | MAALRLVLLLVVALALTGCAGPNYAPYDNMRNSYG |
| Ga0073999_100583753 | 3300030839 | Soil | MMSALRHVLLFVVTLMLTGCPGPNYAPYDHMTNSYA |
| Ga0073994_121195531 | 3300030991 | Soil | MSTLRLVLLFVVSLALIGALTGCPGPNYAPYDNMNNNS |
| Ga0073995_100954141 | 3300031047 | Soil | MMSALRHVLLFVVALTLTGCPGPNYAPYDNMNNNSPG |
| ⦗Top⦘ |