


| Basic Information | |
|---|---|
| Family ID | F085522 |
| Family Type | Metagenome |
| Number of Sequences | 111 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MPRLELIPERRADGTIVLRAVERGPLERLKRFVRDLLRG |
| Number of Associated Samples | 63 |
| Number of Associated Scaffolds | 111 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 0.00 % |
| % of genes from short scaffolds (< 2000 bps) | 0.90 % |
| Associated GOLD sequencing projects | 61 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (99.099 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (26.126 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.928 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (43.243 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.88% β-sheet: 20.90% Coil/Unstructured: 55.22% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 111 Family Scaffolds |
|---|---|---|
| PF00393 | 6PGD | 15.32 |
| PF03631 | Virul_fac_BrkB | 14.41 |
| PF10417 | 1-cysPrx_C | 9.91 |
| PF12833 | HTH_18 | 4.50 |
| PF01814 | Hemerythrin | 4.50 |
| PF13191 | AAA_16 | 1.80 |
| PF08940 | DUF1918 | 1.80 |
| PF02129 | Peptidase_S15 | 1.80 |
| PF04909 | Amidohydro_2 | 1.80 |
| PF08241 | Methyltransf_11 | 1.80 |
| PF00390 | malic | 0.90 |
| PF00730 | HhH-GPD | 0.90 |
| PF13376 | OmdA | 0.90 |
| PF00353 | HemolysinCabind | 0.90 |
| PF00903 | Glyoxalase | 0.90 |
| PF04024 | PspC | 0.90 |
| PF01243 | Putative_PNPOx | 0.90 |
| PF00042 | Globin | 0.90 |
| PF08922 | DUF1905 | 0.90 |
| PF13604 | AAA_30 | 0.90 |
| PF08450 | SGL | 0.90 |
| PF16916 | ZT_dimer | 0.90 |
| PF03446 | NAD_binding_2 | 0.90 |
| PF02803 | Thiolase_C | 0.90 |
| PF13185 | GAF_2 | 0.90 |
| PF13520 | AA_permease_2 | 0.90 |
| PF13649 | Methyltransf_25 | 0.90 |
| PF05231 | MASE1 | 0.90 |
| PF14026 | DUF4242 | 0.90 |
| PF03466 | LysR_substrate | 0.90 |
| PF07971 | Glyco_hydro_92 | 0.90 |
| PF03734 | YkuD | 0.90 |
| COG ID | Name | Functional Category | % Frequency in 111 Family Scaffolds |
|---|---|---|---|
| COG0362 | 6-phosphogluconate dehydrogenase | Carbohydrate transport and metabolism [G] | 15.32 |
| COG1023 | 6-phosphogluconate dehydrogenase (decarboxylating) | Carbohydrate transport and metabolism [G] | 15.32 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 14.41 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.90 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.90 |
| COG3447 | Integral membrane sensor domain MASE1 | Signal transduction mechanisms [T] | 0.90 |
| COG3537 | Putative alpha-1,2-mannosidase | Carbohydrate transport and metabolism [G] | 0.90 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.90 |
| COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.90 |
| COG0177 | Endonuclease III | Replication, recombination and repair [L] | 0.90 |
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.90 |
| COG0281 | Malic enzyme | Energy production and conversion [C] | 0.90 |
| COG0642 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.90 |
| COG1017 | Hemoglobin-like flavoprotein | Energy production and conversion [C] | 0.90 |
| COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.90 |
| COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 0.90 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.90 |
| COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 0.90 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.90 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 99.10 % |
| All Organisms | root | All Organisms | 0.90 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300010038|Ga0126315_10126490 | All Organisms → cellular organisms → Bacteria | 1494 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 26.13% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 22.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 7.21% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 7.21% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 4.50% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 4.50% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 2.70% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.70% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.70% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.80% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.80% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.80% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.80% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.80% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.90% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.90% |
| Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust | 0.90% |
| Rock | Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock | 0.90% |
| Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Rock | 0.90% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.90% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.90% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.90% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003998 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300012093 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06) | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
| 3300012939 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015 | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013011 | Gypsum crust endolithic microbial communities from the Atacama Desert, Chile - KM37 | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300017787 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2) | Environmental | Open in IMG/M |
| 3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031450 | Rock endolithic microbial communities from Victoria Land, Antarctica - University Valley sud | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032080 | Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300034006 | Biocrust microbial communities from Mojave Desert, California, United States - 30SMC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 4MG_04139850 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | MPRLELIPERRSDGTIVLRAVERGPLERLKRFVRDLLRR |
| C688J35102_1188074571 | 3300002568 | Soil | MTHTELIPERTADGRIVLRVVEVRPIERLRRLLRRMARGG* |
| Ga0055472_101031222 | 3300003998 | Natural And Restored Wetlands | VRNADQDVRMPRLELIPERRADGTIVLRAVEHGPLERLKRFVRDLIRS* |
| Ga0063454_1018493372 | 3300004081 | Soil | MAHIELIPERTPDGRIVLRAVELRPLERLRRLVRRMARGG* |
| Ga0063455_1007489652 | 3300004153 | Soil | MPRLQLVPEPRADGTIVLRVVERGPLERLKRFMRDLLRR* |
| Ga0063455_1008321752 | 3300004153 | Soil | MPRLELIPERRSDGTIVLRAVERGPLERLKRFVRDLLRR* |
| Ga0063455_1010946782 | 3300004153 | Soil | MNRLELIPERRADGTVVLRAIVVGPLERLRRFLRQRSRV* |
| Ga0070683_1004035081 | 3300005329 | Corn Rhizosphere | ADQDVHMPRLELIPERRSDGTIVLRAVERGPLERLKRFVRDLLRR* |
| Ga0070683_1005761251 | 3300005329 | Corn Rhizosphere | MPRLELIPERRSDGTIVLRAVERGPLERLKRLVRDLLRR* |
| Ga0068869_1018427282 | 3300005334 | Miscanthus Rhizosphere | MERMELIPERRPDGTIVLRAVVPARGERLRRLLRSLLGRS* |
| Ga0070659_1021020832 | 3300005366 | Corn Rhizosphere | VTNADQDVHMPRLELIPERRSDGTIVLRAVERGPLERLKRFVRDLLRR* |
| Ga0070701_112813361 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRLELIPERRSDGTIVLRAVERGPLERLKRFVRDLLRR* |
| Ga0070700_1002754502 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MVQMPRLELIPERRSDGTIVLRVVERGPLERLKRFVRDLLRR* |
| Ga0070663_1005623382 | 3300005455 | Corn Rhizosphere | MPRLELIPERRSDGTIVLRVVERGPLERLKRFVRDLLRR* |
| Ga0070672_1013931731 | 3300005543 | Miscanthus Rhizosphere | RLELIPERRSDGTIVLRAVERGPLERLKRFVRDLLRR* |
| Ga0068860_1023726051 | 3300005843 | Switchgrass Rhizosphere | MVQMPRLELIPERRSDGTIVLRVVERGPLERLKRFVRDMLRR* |
| Ga0079222_108039672 | 3300006755 | Agricultural Soil | MTRVELVPEPTADGRIVLRAVERGPLERLRRLLRRMARGG* |
| Ga0075420_1017616382 | 3300006853 | Populus Rhizosphere | MTRIELIPERRSDGSIVLRAVSVGPAEQLRRLVRRLMRGR* |
| Ga0068865_1013794491 | 3300006881 | Miscanthus Rhizosphere | MERIDLVPERTADGTIVLRAVVRSPIERLRRFLRRLAAQ* |
| Ga0079219_112608882 | 3300006954 | Agricultural Soil | MTRVELVPERTADGRIVLRAVERGPLERLRRLLRRMARGG* |
| Ga0075418_125649962 | 3300009100 | Populus Rhizosphere | MPRIELIPERRADGTIVLRAVERGPLERFKRFVRDLLRA* |
| Ga0105247_115341381 | 3300009101 | Switchgrass Rhizosphere | DQDVHMTRLELIPERRSDGTIVLRAVERGPLERLKRFVRDLLRR* |
| Ga0111538_128431582 | 3300009156 | Populus Rhizosphere | MPRIELIPERRSDGTIVLRAVERGPLERLKRFVRDLLRG* |
| Ga0126307_100081622 | 3300009789 | Serpentine Soil | MPRLELIPERRADGTIVLRAVERGPLERLKRFVRDLLRG* |
| Ga0126307_100186424 | 3300009789 | Serpentine Soil | MTRIDLVPEPTADGTIVLRAVVRSPIERLRRFLRRLAAQ* |
| Ga0126307_102582262 | 3300009789 | Serpentine Soil | MTRVELIHERTPDGTIVLRPVVLGPIERLRRFVRRLAAGGPGAAPT* |
| Ga0126307_107304562 | 3300009789 | Serpentine Soil | MPRLELIPERRPDGTIVLRARQIGRLEWLRRLLRR* |
| Ga0126307_107754322 | 3300009789 | Serpentine Soil | MTDQDVHMPRLELIPERRADGTIVLRAVERGPLERLKRLLRDLLRG* |
| Ga0126313_102931532 | 3300009840 | Serpentine Soil | MAQMELIPERTADGRIILRAVELRPVERLRRLLRRMARGG* |
| Ga0126313_105301742 | 3300009840 | Serpentine Soil | MPRIELVPEPRADGTIVLRAVELRPLERLRRLIRRLASGR* |
| Ga0126313_105336912 | 3300009840 | Serpentine Soil | MERLELIPERRPDGTIVLRAAVRSPGHRLRRILRALFGRD* |
| Ga0126313_114253091 | 3300009840 | Serpentine Soil | MPRIELIPETTPDGRIVLRAVELRPLERLRRLLRRMARGG* |
| Ga0126305_108680032 | 3300010036 | Serpentine Soil | MTRVELIRERTADGTIVLRAVALGPVERLRRFIRRLAPAA* |
| Ga0126315_101264903 | 3300010038 | Serpentine Soil | MTRLELIPERRPDGTIVLRARALRPLERLRRAIQRLVRGA* |
| Ga0126309_101189763 | 3300010039 | Serpentine Soil | MPRVQLIPERRADGTIVLRAVELGPVERLRRALRRLIASD* |
| Ga0126309_102305101 | 3300010039 | Serpentine Soil | MELIPERTADGRIVLRAVELQPLERLRRFLRRLTRGG* |
| Ga0126309_104079202 | 3300010039 | Serpentine Soil | MPRVELVPERRADGTIVLRVAELGALERLRRLVRRLARGL* |
| Ga0126309_109299022 | 3300010039 | Serpentine Soil | MPRLELIQERTPDGTIVLRPVVLGPIERLRRLVRRLAAAGGPYAART* |
| Ga0126308_100226413 | 3300010040 | Serpentine Soil | MTRVELIRERTADGTIVLRAVALGPVERLRRFIRRLVPAA* |
| Ga0126308_111720172 | 3300010040 | Serpentine Soil | VRNADQDEHMPRLELIPERRADGTIVLRAVERGPLERLK |
| Ga0126312_100277162 | 3300010041 | Serpentine Soil | MAQMELIPERTADGRIILRAVDLRPVERLRRLLRRMARGG* |
| Ga0126312_103477142 | 3300010041 | Serpentine Soil | MHRLEFIPERRADGTIVLRAAVVGPLERLRRILRRLTRA* |
| Ga0126312_105311472 | 3300010041 | Serpentine Soil | MARVELIPERTADGRIVLRAVGLGPVERLGRLLRRLARGG* |
| Ga0126312_114835152 | 3300010041 | Serpentine Soil | MELIPERTADGRIVLRAVELRPLERLRRLVRRMARGG* |
| Ga0126311_108469301 | 3300010045 | Serpentine Soil | MAPIEMVPERTADGRVVLRAVELRPLERLRRYLRRVARGG* |
| Ga0126311_112620643 | 3300010045 | Serpentine Soil | MERLELIPERRPDGTIVLRAAVQPPGGRLRRILRALFGRA* |
| Ga0126311_115081682 | 3300010045 | Serpentine Soil | MPRLELIPERRSDGTIVLRAVERGPLERLRRFVRDLLRR* |
| Ga0126306_100743041 | 3300010166 | Serpentine Soil | TDQDVHMPRIELIPERRADGTIVLRAVQRGPLERLKRFVRDLLRG* |
| Ga0136632_105522781 | 3300012093 | Polar Desert Sand | MPRVELVPERRADGTIVFRAVEVALAERLRRLFRRLLAPA* |
| Ga0150985_1035688051 | 3300012212 | Avena Fatua Rhizosphere | LELIPERRSDGTIVLRAVERGPLERLKRFVRDLLRR* |
| Ga0150985_1156611632 | 3300012212 | Avena Fatua Rhizosphere | VLFRSPERTPDGRIVLRAVELRPLERLRRLLRRMARGG* |
| Ga0150985_1175628661 | 3300012212 | Avena Fatua Rhizosphere | RIELIEEHTADGTVVLRAVVRGPVERLRRFLRDLRPD* |
| Ga0150985_1195142822 | 3300012212 | Avena Fatua Rhizosphere | MNRLELIPERRADGTIVLRAVVLGPLERLRRLLRRRTRA* |
| Ga0150985_1212165681 | 3300012212 | Avena Fatua Rhizosphere | LVPERRADGTVVLHAVERGPLERLKRFARRLLAA* |
| Ga0150984_1010420881 | 3300012469 | Avena Fatua Rhizosphere | LVPERTADGRIVLRAVERGPLERLRRLLRRMARGG* |
| Ga0150984_1029152892 | 3300012469 | Avena Fatua Rhizosphere | ADQDVHMTRLELIPEPRSDGTIVLRVIERGPLERLKRFVWRLLGA* |
| Ga0150984_1077039552 | 3300012469 | Avena Fatua Rhizosphere | FRSELIPETTPDGRIVLRAVELRPLERLRRLLRRMARGG* |
| Ga0150984_1097236491 | 3300012469 | Avena Fatua Rhizosphere | RNSGNSVDMARMELIPERTPDGRIVLHAVELRPLERLRRLLRQMARGG* |
| Ga0150984_1131263372 | 3300012469 | Avena Fatua Rhizosphere | VELIEERSADGTIVLRAVVRGPVERIRRFLRDVLG* |
| Ga0150984_1168193521 | 3300012469 | Avena Fatua Rhizosphere | DMTRLELIPERRADGTVVLHAVERGPLERLKRFARRLLAA* |
| Ga0150984_1206591501 | 3300012469 | Avena Fatua Rhizosphere | IPERTPDGRIVLRAVELRPLERLRRLLRRMARGG* |
| Ga0150984_1236798442 | 3300012469 | Avena Fatua Rhizosphere | HTELIPERTADGRIVLRVVEVRPIERLRRLLRRMARGG* |
| Ga0157289_104082332 | 3300012903 | Soil | MTRLELIPERRSDGTIVLRAVERGPLERLKRLVRDLLRR* |
| Ga0162650_1000128252 | 3300012939 | Soil | MTRLELIPERRSDGTIVLRAVAHGPLERLKRFVRDLLRR* |
| Ga0164299_113005372 | 3300012958 | Soil | MSRLELIPERRSDGTIVLRAVERGPLERLKRFVRDLL |
| Ga0164305_104814202 | 3300012989 | Soil | LTDHHDHMTRLELIPERRSDGTIVLRAVERGPLERLKRFVRDLLRR* |
| Ga0169967_10132123 | 3300013011 | Rock | MSKFELIPERRPDGTIVLRAVAVGPLERLRRFLRRLVGQ* |
| Ga0157377_108757723 | 3300014745 | Miscanthus Rhizosphere | MERMELIPERRPDGTIVLRGVVIPRGERLRRFVRSLFGR* |
| Ga0183260_101221893 | 3300017787 | Polar Desert Sand | MTHIELIPERRADGTVVLRAVAVPPLERLRRFLRRIAIRP |
| Ga0136617_101039522 | 3300017789 | Polar Desert Sand | MSRIELIPERRADGTIVLRAVLLGRAERLRRLLRRLTS |
| Ga0190265_105480962 | 3300018422 | Soil | MTHIEYIPIRNADGTISLRAVVIGPLERLRRLVGRLTRG |
| Ga0190265_114280192 | 3300018422 | Soil | MTRLELIPERTPDGTIVLRAVERGALERLRRLVRRLLRAA |
| Ga0190265_114744222 | 3300018422 | Soil | MNRIELVPERTTNGTIVLRAVERGPLERLRRAVRRLLQRA |
| Ga0190265_131977491 | 3300018422 | Soil | MTRLELIPERTADGRIVLRAVELGPLERLRRLVRRLLQSA |
| Ga0190272_101737813 | 3300018429 | Soil | MPRLDLIPERRADGTIVLRAVEHGPLERLKRFVRDLLRG |
| Ga0190272_102921472 | 3300018429 | Soil | MTRIELVPERTANGTIVLRAVERGPLERLRRAVRRWLQRA |
| Ga0190275_101575632 | 3300018432 | Soil | MTRVELIHERTPDGTIVLRPVVLGPIERLRRLIRRLVPAT |
| Ga0190275_105586331 | 3300018432 | Soil | MPRLELIPERRADGTIVLRAVEHGPLERLKRFVRDLLRG |
| Ga0190275_110449322 | 3300018432 | Soil | MAHIDLIPERRSDGTIVLRAVVLGPMERLRRLMRRLAGVPAT |
| Ga0190275_112591461 | 3300018432 | Soil | MPRVELVPERRPDGTIVLRAIELGIAERLRRALRK |
| Ga0190275_112932621 | 3300018432 | Soil | MPRVELVPEQRANGTIVLRAVEVGAVERLRRLLRRLSSGR |
| Ga0066667_107298682 | 3300018433 | Grasslands Soil | MAQMELIPERTADGRIILRAVEVGPMERLRRLLRRMARGV |
| Ga0190268_105364832 | 3300018466 | Soil | MERIDLVPERTADGTIVLRAVVRSPIERLRRFLRRLVAQ |
| Ga0190270_101113632 | 3300018469 | Soil | MSRLELIPERRADGTIVLRAVEHGPLERLKRFVRDLLRS |
| Ga0190270_101536652 | 3300018469 | Soil | MPRIELIPERRSDGTIVLRAVERGPLERLKRFVRDLLRG |
| Ga0190270_101874562 | 3300018469 | Soil | MARIDLVPEPTADGTIIFRAVVRSPVERLRRFLRRLVASS |
| Ga0190270_102126682 | 3300018469 | Soil | MPRLELIPERRADGTIVLRAVERSPLERLKRFVRDLLRG |
| Ga0190274_127171462 | 3300018476 | Soil | MTRLELIPERRSDGTIVLRAVERGPLERLKRFVRDLLRR |
| Ga0190271_110382133 | 3300018481 | Soil | MTRIELVPERTANGTIVLRVVERGPLERLRRAVRRWLQRA |
| Ga0190267_110456061 | 3300019767 | Soil | MERIDLVPERTADGRIVLRAVVRSPIERLRRFLRRLVAQ |
| Ga0207704_110381961 | 3300025938 | Miscanthus Rhizosphere | DVHMTRLELIPERRSDGTIVLRAVERGPLERLKRFVRDLLRR |
| Ga0247828_103824292 | 3300028587 | Soil | MARIDLVPERTADGTIVLRAVVRSPIERLRRFLRRLAAQ |
| Ga0247828_109606542 | 3300028587 | Soil | MAYIELIPERRSDGTIVLRAAVLGPAERLRRAARRLLGA |
| Ga0247818_113573001 | 3300028589 | Soil | MERMELVPERTADGTIVLRAVVRSPIERLRRFLRRFVASS |
| Ga0307318_102736102 | 3300028744 | Soil | VTRLELIPERRPDGTIVLHARELGPLERLRRAVQRAARGE |
| Ga0307284_100417572 | 3300028799 | Soil | MTRLELIPERRSDGTIVLRAVERGPLERLKRFVKRLLAA |
| Ga0299907_101399563 | 3300030006 | Soil | MPRLELVPERRPDGTIVLRAIELGLAERLRRAWRRLTHR |
| Ga0247826_100998353 | 3300030336 | Soil | MERMELIPERRPDGTIVLRAVVPARGERLRRLLRSLLGRS |
| Ga0247826_104321712 | 3300030336 | Soil | MERMDLVPERTADGTIVLRAVVRSPIERLRRFLRRLAASS |
| Ga0247826_105358672 | 3300030336 | Soil | MERLELIPERRPDGTVVLRAAVRSTGDRLRRILRALLRRS |
| Ga0247826_106509612 | 3300030336 | Soil | MERIDLVPERTADGTIVLRAVVRSPIERLRRFLRRLVAS |
| Ga0247826_109000672 | 3300030336 | Soil | MARIDLVPERTADGTIVFRAVVRSPLERLRRFLRRFAASS |
| Ga0307498_102525772 | 3300031170 | Soil | LTDHHDHMTRLELIPERRSDGTIVLRAVERGPLERLKRFVRELLRR |
| Ga0272433_100521082 | 3300031450 | Rock | VNRVELIPERRADGTIVLRAVVLGPVERFRRLLRRLTQP |
| Ga0307468_1014213651 | 3300031740 | Hardwood Forest Soil | MPRLELIPERRSDGTIVLRVVERGPLERLKRFVRDLLRR |
| Ga0307409_1014171991 | 3300031995 | Rhizosphere | MHRLELIPERRADGTIVLRAAVLGPLERLRRILRRLTRA |
| Ga0326721_102274032 | 3300032080 | Soil | MSQVELIHERTADGTIVLRPVVLGPIERLRRLIRRLAPAA |
| Ga0326721_104303432 | 3300032080 | Soil | VRNADQDVRMPRLELIPERRADGTIVLRAVEHGPLERLKRFVRDLLRG |
| Ga0326721_105302212 | 3300032080 | Soil | MTRLELIPERRSDGTIVLRAVERGPLERLKRLVRDLLRR |
| Ga0307470_115589702 | 3300032174 | Hardwood Forest Soil | MTRIEFIPERRSDGTIVLRAVERGPLERLKRFVRDLLRG |
| Ga0334934_000399_4242_4370 | 3300034006 | Biocrust | MTSYDLIPERRPNGTIVLRAEPVTALERLRRLVRRLLAGPRA |
| ⦗Top⦘ |