


| Basic Information | |
|---|---|
| Family ID | F085473 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 111 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MEFEIQFARDGDNPGLDKFHVHIRCFAAWEFERGGS |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 111 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 34.23 % |
| % of genes near scaffold ends (potentially truncated) | 49.55 % |
| % of genes from short scaffolds (< 2000 bps) | 70.27 % |
| Associated GOLD sequencing projects | 80 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.28 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.297 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (32.432 % of family members) |
| Environment Ontology (ENVO) | Unclassified (40.541 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.252 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.00% β-sheet: 0.00% Coil/Unstructured: 75.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 111 Family Scaffolds |
|---|---|---|
| PF13683 | rve_3 | 5.41 |
| PF00072 | Response_reg | 3.60 |
| PF00741 | Gas_vesicle | 2.70 |
| PF04392 | ABC_sub_bind | 2.70 |
| PF13493 | DUF4118 | 2.70 |
| PF00296 | Bac_luciferase | 2.70 |
| PF01380 | SIS | 2.70 |
| PF04199 | Cyclase | 1.80 |
| PF01435 | Peptidase_M48 | 1.80 |
| PF08448 | PAS_4 | 1.80 |
| PF00158 | Sigma54_activat | 1.80 |
| PF10282 | Lactonase | 1.80 |
| PF01663 | Phosphodiest | 1.80 |
| PF02585 | PIG-L | 0.90 |
| PF00496 | SBP_bac_5 | 0.90 |
| PF13426 | PAS_9 | 0.90 |
| PF00127 | Copper-bind | 0.90 |
| PF10609 | ParA | 0.90 |
| PF01546 | Peptidase_M20 | 0.90 |
| PF08369 | PCP_red | 0.90 |
| PF05899 | Cupin_3 | 0.90 |
| PF09084 | NMT1 | 0.90 |
| PF01966 | HD | 0.90 |
| PF00011 | HSP20 | 0.90 |
| PF01339 | CheB_methylest | 0.90 |
| PF00665 | rve | 0.90 |
| PF02826 | 2-Hacid_dh_C | 0.90 |
| PF00211 | Guanylate_cyc | 0.90 |
| PF06537 | DHOR | 0.90 |
| PF02780 | Transketolase_C | 0.90 |
| PF00528 | BPD_transp_1 | 0.90 |
| PF01638 | HxlR | 0.90 |
| PF09650 | PHA_gran_rgn | 0.90 |
| PF13560 | HTH_31 | 0.90 |
| PF00593 | TonB_dep_Rec | 0.90 |
| PF00821 | PEPCK_GTP | 0.90 |
| PF01208 | URO-D | 0.90 |
| PF08402 | TOBE_2 | 0.90 |
| PF13424 | TPR_12 | 0.90 |
| PF02518 | HATPase_c | 0.90 |
| PF13378 | MR_MLE_C | 0.90 |
| PF10518 | TAT_signal | 0.90 |
| PF13185 | GAF_2 | 0.90 |
| COG ID | Name | Functional Category | % Frequency in 111 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 2.70 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 2.70 |
| COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 1.80 |
| COG2201 | Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domains | Signal transduction mechanisms [T] | 1.80 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.90 |
| COG3488 | Uncharacterized conserved protein with two CxxC motifs, DUF1111 family | General function prediction only [R] | 0.90 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.90 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.90 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.90 |
| COG0407 | Uroporphyrinogen-III decarboxylase HemE | Coenzyme transport and metabolism [H] | 0.90 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.90 |
| COG1274 | Phosphoenolpyruvate carboxykinase, GTP-dependent | Energy production and conversion [C] | 0.90 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.90 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.90 |
| COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 0.90 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.90 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.90 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.30 % |
| Unclassified | root | N/A | 2.70 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2228664022|INPgaii200_c0320247 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 511 | Open in IMG/M |
| 3300000550|F24TB_10447861 | All Organisms → cellular organisms → Bacteria | 1472 | Open in IMG/M |
| 3300000559|F14TC_109109824 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 501 | Open in IMG/M |
| 3300000955|JGI1027J12803_101298367 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 715 | Open in IMG/M |
| 3300005171|Ga0066677_10023164 | All Organisms → cellular organisms → Bacteria | 2891 | Open in IMG/M |
| 3300005172|Ga0066683_10034506 | All Organisms → cellular organisms → Bacteria | 2931 | Open in IMG/M |
| 3300005174|Ga0066680_10009284 | All Organisms → cellular organisms → Bacteria | 4968 | Open in IMG/M |
| 3300005451|Ga0066681_10476383 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300005553|Ga0066695_10762573 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 561 | Open in IMG/M |
| 3300005553|Ga0066695_10816601 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300005555|Ga0066692_10075303 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1945 | Open in IMG/M |
| 3300005555|Ga0066692_10312415 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 997 | Open in IMG/M |
| 3300005556|Ga0066707_10010898 | All Organisms → cellular organisms → Bacteria | 4467 | Open in IMG/M |
| 3300005557|Ga0066704_10337456 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1012 | Open in IMG/M |
| 3300005560|Ga0066670_10625766 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 654 | Open in IMG/M |
| 3300005574|Ga0066694_10003744 | All Organisms → cellular organisms → Bacteria | 6078 | Open in IMG/M |
| 3300005586|Ga0066691_10592229 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 660 | Open in IMG/M |
| 3300006031|Ga0066651_10155903 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
| 3300006046|Ga0066652_100106775 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2270 | Open in IMG/M |
| 3300006794|Ga0066658_10124563 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1264 | Open in IMG/M |
| 3300006797|Ga0066659_10866473 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 753 | Open in IMG/M |
| 3300006797|Ga0066659_11494947 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 565 | Open in IMG/M |
| 3300006847|Ga0075431_100153107 | All Organisms → cellular organisms → Bacteria | 2374 | Open in IMG/M |
| 3300006903|Ga0075426_11043538 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300006904|Ga0075424_100062502 | All Organisms → cellular organisms → Bacteria | 3896 | Open in IMG/M |
| 3300006904|Ga0075424_101916812 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 626 | Open in IMG/M |
| 3300007255|Ga0099791_10374338 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 684 | Open in IMG/M |
| 3300007255|Ga0099791_10425061 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 641 | Open in IMG/M |
| 3300007265|Ga0099794_10002429 | All Organisms → cellular organisms → Bacteria | 6867 | Open in IMG/M |
| 3300009012|Ga0066710_100000887 | All Organisms → cellular organisms → Bacteria | 20410 | Open in IMG/M |
| 3300009012|Ga0066710_100417781 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2004 | Open in IMG/M |
| 3300009012|Ga0066710_101171574 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1190 | Open in IMG/M |
| 3300009038|Ga0099829_10692817 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 847 | Open in IMG/M |
| 3300009089|Ga0099828_10324806 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1386 | Open in IMG/M |
| 3300009137|Ga0066709_100048950 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4747 | Open in IMG/M |
| 3300009137|Ga0066709_100100553 | All Organisms → cellular organisms → Bacteria | 3540 | Open in IMG/M |
| 3300009137|Ga0066709_100965267 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1246 | Open in IMG/M |
| 3300009147|Ga0114129_10775901 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1225 | Open in IMG/M |
| 3300009147|Ga0114129_10951304 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
| 3300009147|Ga0114129_12142661 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 674 | Open in IMG/M |
| 3300009162|Ga0075423_11581390 | Not Available | 704 | Open in IMG/M |
| 3300010132|Ga0127455_1017795 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 546 | Open in IMG/M |
| 3300010303|Ga0134082_10064479 | All Organisms → cellular organisms → Bacteria | 1419 | Open in IMG/M |
| 3300010320|Ga0134109_10052073 | All Organisms → cellular organisms → Bacteria | 1357 | Open in IMG/M |
| 3300010320|Ga0134109_10412373 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 542 | Open in IMG/M |
| 3300010323|Ga0134086_10010432 | All Organisms → cellular organisms → Bacteria | 2854 | Open in IMG/M |
| 3300010326|Ga0134065_10099882 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 962 | Open in IMG/M |
| 3300010335|Ga0134063_10377542 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 692 | Open in IMG/M |
| 3300010401|Ga0134121_10617556 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1016 | Open in IMG/M |
| 3300011269|Ga0137392_10079436 | All Organisms → cellular organisms → Bacteria | 2543 | Open in IMG/M |
| 3300011269|Ga0137392_10160658 | All Organisms → cellular organisms → Bacteria | 1819 | Open in IMG/M |
| 3300012199|Ga0137383_10279479 | Not Available | 1223 | Open in IMG/M |
| 3300012201|Ga0137365_11157744 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 555 | Open in IMG/M |
| 3300012202|Ga0137363_10172538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1716 | Open in IMG/M |
| 3300012203|Ga0137399_10053989 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2935 | Open in IMG/M |
| 3300012203|Ga0137399_10966153 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 717 | Open in IMG/M |
| 3300012206|Ga0137380_10642381 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 925 | Open in IMG/M |
| 3300012209|Ga0137379_10218328 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1821 | Open in IMG/M |
| 3300012356|Ga0137371_10467155 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300012359|Ga0137385_10205130 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1720 | Open in IMG/M |
| 3300012360|Ga0137375_10885274 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 710 | Open in IMG/M |
| 3300012363|Ga0137390_10276888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1662 | Open in IMG/M |
| 3300012685|Ga0137397_10038363 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 3427 | Open in IMG/M |
| 3300012918|Ga0137396_10729545 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 730 | Open in IMG/M |
| 3300012922|Ga0137394_11266801 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 600 | Open in IMG/M |
| 3300012923|Ga0137359_10287164 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1466 | Open in IMG/M |
| 3300012923|Ga0137359_11590522 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 541 | Open in IMG/M |
| 3300012927|Ga0137416_10044208 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 3076 | Open in IMG/M |
| 3300012927|Ga0137416_11800244 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 560 | Open in IMG/M |
| 3300012929|Ga0137404_10419960 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1182 | Open in IMG/M |
| 3300012929|Ga0137404_10638158 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 960 | Open in IMG/M |
| 3300012976|Ga0134076_10100569 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1146 | Open in IMG/M |
| 3300015245|Ga0137409_10209711 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1749 | Open in IMG/M |
| 3300015264|Ga0137403_10074321 | All Organisms → cellular organisms → Bacteria | 3444 | Open in IMG/M |
| 3300015358|Ga0134089_10019445 | All Organisms → cellular organisms → Bacteria | 2303 | Open in IMG/M |
| 3300015371|Ga0132258_13343993 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1103 | Open in IMG/M |
| 3300017656|Ga0134112_10277407 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 670 | Open in IMG/M |
| 3300017936|Ga0187821_10266786 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300018422|Ga0190265_10105151 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2658 | Open in IMG/M |
| 3300018422|Ga0190265_13268382 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 541 | Open in IMG/M |
| 3300018431|Ga0066655_10004780 | All Organisms → cellular organisms → Bacteria | 5440 | Open in IMG/M |
| 3300018433|Ga0066667_10434517 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300018482|Ga0066669_10000098 | All Organisms → cellular organisms → Bacteria | 19748 | Open in IMG/M |
| 3300019789|Ga0137408_1067563 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 3095 | Open in IMG/M |
| 3300020012|Ga0193732_1058089 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300021088|Ga0210404_10779855 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 546 | Open in IMG/M |
| 3300021432|Ga0210384_10625101 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 966 | Open in IMG/M |
| 3300024330|Ga0137417_1439054 | All Organisms → cellular organisms → Bacteria | 6095 | Open in IMG/M |
| 3300024330|Ga0137417_1452151 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1722 | Open in IMG/M |
| 3300025922|Ga0207646_11062035 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300026298|Ga0209236_1000107 | All Organisms → cellular organisms → Bacteria | 41069 | Open in IMG/M |
| 3300026310|Ga0209239_1085777 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1354 | Open in IMG/M |
| 3300026314|Ga0209268_1002115 | All Organisms → cellular organisms → Bacteria | 9586 | Open in IMG/M |
| 3300026323|Ga0209472_1054203 | All Organisms → cellular organisms → Bacteria | 1711 | Open in IMG/M |
| 3300026325|Ga0209152_10426296 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 527 | Open in IMG/M |
| 3300026326|Ga0209801_1075556 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1485 | Open in IMG/M |
| 3300026327|Ga0209266_1056534 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1898 | Open in IMG/M |
| 3300026343|Ga0209159_1011915 | All Organisms → cellular organisms → Bacteria | 5174 | Open in IMG/M |
| 3300026494|Ga0257159_1003915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2144 | Open in IMG/M |
| 3300026529|Ga0209806_1007903 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5868 | Open in IMG/M |
| 3300026557|Ga0179587_10846071 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 603 | Open in IMG/M |
| 3300027846|Ga0209180_10781177 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 513 | Open in IMG/M |
| 3300028047|Ga0209526_10315430 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1055 | Open in IMG/M |
| 3300028536|Ga0137415_10019475 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6730 | Open in IMG/M |
| 3300028536|Ga0137415_10082156 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 3081 | Open in IMG/M |
| 3300028878|Ga0307278_10069290 | All Organisms → cellular organisms → Bacteria | 1591 | Open in IMG/M |
| 3300028878|Ga0307278_10527184 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 515 | Open in IMG/M |
| 3300031229|Ga0299913_10097649 | Not Available | 2865 | Open in IMG/M |
| 3300031820|Ga0307473_10497811 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300032174|Ga0307470_11344259 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 587 | Open in IMG/M |
| 3300032205|Ga0307472_101195593 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 726 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 32.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 23.42% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 9.91% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 9.01% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.70% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.70% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.70% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.90% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.90% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.90% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.90% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.90% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010132 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020012 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s1 | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026494 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-A | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPgaii200_03202471 | 2228664022 | Soil | LGLVASGSDQLEIAIEFARNGLVPGLDKYHVHLRCFAAWEFER |
| F24TB_104478613 | 3300000550 | Soil | LEFEIQFARDGDNPGLDKFHVHVRCFAAWEFERGKR* |
| F14TC_1091098241 | 3300000559 | Soil | EFKRDGESPGLEQYHLHHRCYAAWEFERTKVPGHSL* |
| JGI1027J12803_1012983673 | 3300000955 | Soil | EIQFARDGDNPGLDKFHVHVRCFAAWEFERMKQY* |
| Ga0066677_100231641 | 3300005171 | Soil | STEMEFEIQFARDGGTPQAGLDKYHVHIRCFAAWEFERQSA* |
| Ga0066683_100345066 | 3300005172 | Soil | MEFEIQFARDGDNPGLDKFHVHIRCCAAWEFERESRDQR* |
| Ga0066680_100092846 | 3300005174 | Soil | MEFEIQFARDGDNPGLDKFHVHIRCFAAWEFERGASDPR* |
| Ga0066681_104763831 | 3300005451 | Soil | EMEFEIQFARDGGTPQAGLDKYHVHIRCFAAWEFERPAA* |
| Ga0066695_107625732 | 3300005553 | Soil | QMELEIEFARDSDYPGIDNYHVHVKCFAAWELEREAV* |
| Ga0066695_108166012 | 3300005553 | Soil | EFEIQFARDGDNPGLDKYHVHVKCFAAWEFERGSA* |
| Ga0066692_100753033 | 3300005555 | Soil | EFEIQFAHDGDNPGLDKFHVHIRCFAAWELERAKIS* |
| Ga0066692_103124152 | 3300005555 | Soil | EFEIEFARDGSNPGLDKFHVHLQCFAAWEFERGSA* |
| Ga0066707_100108983 | 3300005556 | Soil | VQATEMEFEIEFARDGSNPGLDKFHVHLQCFAAWEFERGSA* |
| Ga0066704_103374564 | 3300005557 | Soil | TEMEFEIQFQRNGDNPGLDKYHVHIRCFAAWEFERHAV* |
| Ga0066670_106257662 | 3300005560 | Soil | STEMEFEIQFARDGGTPAAGLDKYHVHIRCFAAWEFERQSA* |
| Ga0066694_100037448 | 3300005574 | Soil | MEFEIQFTRDGDNPGLDKFHVHIRCFAAWEFERSSDK* |
| Ga0066691_105922292 | 3300005586 | Soil | VPVARDQMEFEIQFTRDGDNPGLDKFHVHIRCFAAWEFERESRGQR* |
| Ga0066651_101559034 | 3300006031 | Soil | MEFEIQFTRDGDNPGLDKFHVHIRCCAAWEFERESQDQR* |
| Ga0066652_1001067754 | 3300006046 | Soil | MEFEIEFARDGDNPGLDKFHVHIRCCAAWEFERESQDQR* |
| Ga0066658_101245632 | 3300006794 | Soil | LEIEFARDSDYPGIDNYHVHVKCFAAWELERESV* |
| Ga0066659_108664732 | 3300006797 | Soil | MEFEIEFARDGDNPGLDKFHVHIRCFAAWEFEREANGRR* |
| Ga0066659_114949471 | 3300006797 | Soil | EMEFEIEFARDGSNPGLDKFHVHLQCFAAWEFERGSA* |
| Ga0075431_1001531071 | 3300006847 | Populus Rhizosphere | EIQFARDGSNPGLDKFHVHLQCFAAWEFERGSLLDES* |
| Ga0075426_110435382 | 3300006903 | Populus Rhizosphere | RAEMEFEIQFARDGENPGLDKFHVHLDCFAAWQLERGEP* |
| Ga0075424_10006250211 | 3300006904 | Populus Rhizosphere | KRAEMEFEIQFARDGENPGLDKFHVHLDCFAAWQLERGEP* |
| Ga0075424_1019168121 | 3300006904 | Populus Rhizosphere | EFEIQFAHDGDNPGLDKYHVHIRCFAAWEFERSTA* |
| Ga0099791_103743382 | 3300007255 | Vadose Zone Soil | MEFEIEFARDGGNPGLDRFHIHLRCFTAWEFERQS* |
| Ga0099791_104250611 | 3300007255 | Vadose Zone Soil | MEFEIQFARDGDDPGLDKFHVHIRCFAAWEFERGGS* |
| Ga0099794_100024294 | 3300007265 | Vadose Zone Soil | MEFEMEFAHGGSNPGRDKFHVHLKCYAAWEFERQAQ* |
| Ga0066710_1000008873 | 3300009012 | Grasslands Soil | MEFEIQFAHDGDNPGLDKFHVHIRCFAAWEFERGGS |
| Ga0066710_1004177813 | 3300009012 | Grasslands Soil | KDQLEFEIQLARDGDNPGLDKYHVHVKCFAAWEFERGSA |
| Ga0066710_1011715741 | 3300009012 | Grasslands Soil | MEFEIQFAHDGSNPGLDKYHVHIRCFAAWELERGSA |
| Ga0099829_106928171 | 3300009038 | Vadose Zone Soil | FEIQFPRDGDNPGLDKFHVHIRCYAAWEFERNKVPPSQ* |
| Ga0099828_103248061 | 3300009089 | Vadose Zone Soil | LEFAIQFAHDGAVPGLDKVHLHVRCFAVWELERVVGPAKL* |
| Ga0066709_1000489507 | 3300009137 | Grasslands Soil | MEFEIQFAHDGDNPGLDKFHVHIRCFAAWEFERGGS* |
| Ga0066709_1001005535 | 3300009137 | Grasslands Soil | MEFEIQFARDGDNPGLDKYHIHIKCFAAWEFERGSA* |
| Ga0066709_1009652672 | 3300009137 | Grasslands Soil | MEFEIQFTRDGDNPGLDKFHVHIRCFAAWEFERESRGQR* |
| Ga0114129_107759012 | 3300009147 | Populus Rhizosphere | MEFEIQFARDGDNPGLDKFHVHIRCFAAWEFERARA* |
| Ga0114129_109513041 | 3300009147 | Populus Rhizosphere | MEFEIQFARDGDSPGLDKFHVHIRCFAAWEFERDRDGRPHS* |
| Ga0114129_121426613 | 3300009147 | Populus Rhizosphere | KNELEFEIQFARDGDNPGLDKFHVHIRCFAAWEFERNKK* |
| Ga0075423_115813901 | 3300009162 | Populus Rhizosphere | QMEFEIQFARDGDNPGLDKFHVHTRCFAAWELERVASGP* |
| Ga0127455_10177952 | 3300010132 | Grasslands Soil | VKDGEVEFEIEFARDGNNRCLDKYHVHIHCFAAWEVERHRPVVDK* |
| Ga0134082_100644791 | 3300010303 | Grasslands Soil | EIQFARDGDNPGLDKFHVHIRCCAAWEFERESRDQR* |
| Ga0134109_100520731 | 3300010320 | Grasslands Soil | QFARDGDNPGLDKFHVHIRCCAAWEFERESRDQR* |
| Ga0134109_104123732 | 3300010320 | Grasslands Soil | ELEIEFARDSDYPGIDNYHVHIKCFAAWELEREAV* |
| Ga0134086_100104324 | 3300010323 | Grasslands Soil | MEFEIEFARDGSNPGLDKFHVHLQCFAAWEFERGSA* |
| Ga0134065_100998821 | 3300010326 | Grasslands Soil | MEFEIQFARDGDNPGLDKFHVHIRCCAAWEFERESQDQR* |
| Ga0134063_103775422 | 3300010335 | Grasslands Soil | MEFEIQFTRDGDNPGLDKFPVHIRCFAAWEFERSSDK* |
| Ga0134121_106175562 | 3300010401 | Terrestrial Soil | MEFEIQFTRDGSNPGLDKFHVHIRCFAAWEFERRHAQP* |
| Ga0137392_100794366 | 3300011269 | Vadose Zone Soil | EIQFARDGDNPGLDKFHVHVRCFAAWEFERNKPPQ* |
| Ga0137392_101606582 | 3300011269 | Vadose Zone Soil | FEIQFARDGDNPGLDKFHVHVRCFAAWEFERNKPPQ* |
| Ga0137383_102794791 | 3300012199 | Vadose Zone Soil | LEFEIQFAHDGDSPGLDKFHVHIRCFAAWELERGQV* |
| Ga0137365_111577441 | 3300012201 | Vadose Zone Soil | EIEFAREADYPELDEFHVHVRCFAAWEFERTAESV* |
| Ga0137363_101725385 | 3300012202 | Vadose Zone Soil | EFEIQFARDGDNPGLDKFHVHIRWFAAWEFERSKPPR* |
| Ga0137399_100539895 | 3300012203 | Vadose Zone Soil | MEFEIQFARDGSNPGLDKFHIHIRCFAAWEFERHNG* |
| Ga0137399_109661532 | 3300012203 | Vadose Zone Soil | MEFEIQFARDGDNPGLDKFHVHVRCFAAWEFERTKV* |
| Ga0137380_106423812 | 3300012206 | Vadose Zone Soil | MEFEIQFARDGYNPGLDKFHVHIRCFAAWEFEREASGPRWSP* |
| Ga0137379_102183285 | 3300012209 | Vadose Zone Soil | VTKAELEFEIQFAHDGDNPGLDKFHVHIRCFAAWEF |
| Ga0137371_104671551 | 3300012356 | Vadose Zone Soil | EFARDGDNPGLDKFHVHIRCFAAWEFEREANGRR* |
| Ga0137385_102051301 | 3300012359 | Vadose Zone Soil | MEFEIQFTRDGDNPGLDKFHVHIRCFAAWEFERRSDK* |
| Ga0137375_108852741 | 3300012360 | Vadose Zone Soil | LEFEIQFAHDGANPGIDKYHVHVRCFAAWEFERRRDQH* |
| Ga0137390_102768883 | 3300012363 | Vadose Zone Soil | MEFEIQFAHDGGNPGLDKFHVHIRCFAAWEFERDSR* |
| Ga0137397_100383635 | 3300012685 | Vadose Zone Soil | MEFEIQFARDGSNPGLDKVHIHIRCFAAWEFERHNG* |
| Ga0137396_107295452 | 3300012918 | Vadose Zone Soil | MEFEIEFARDGDNPGLDKYHVHIRCFAAREFERHSA* |
| Ga0137394_112668011 | 3300012922 | Vadose Zone Soil | ELAFEIQFAHDETMPGLDKFDVHVRCFAAWEFERDKPPQ* |
| Ga0137359_102871642 | 3300012923 | Vadose Zone Soil | MEFEIEFARGGDYPGLDDYHVHMRCFAAWEFERGRDAD* |
| Ga0137359_115905221 | 3300012923 | Vadose Zone Soil | IQLARDGDNPGLDKFHVHIRCYAAWEFERNKVPPSQ* |
| Ga0137416_100442083 | 3300012927 | Vadose Zone Soil | MEFEIQFARDGSNPGLDKFHIHIRCFAAWEFERRNG* |
| Ga0137416_118002441 | 3300012927 | Vadose Zone Soil | MEFEIEFALDGDNPGLDKCHVHVRCFAAWELERHSA* |
| Ga0137404_104199602 | 3300012929 | Vadose Zone Soil | MEFEIEFARDGGNPGLDRFHIHLRCCTAWEFERQS* |
| Ga0137404_106381582 | 3300012929 | Vadose Zone Soil | MEFEIQFARDGDNPGLDKFHVHIRCFAAWEFERGGS* |
| Ga0134076_101005693 | 3300012976 | Grasslands Soil | MEFEIQFARDGDNPGLDKFHVHIRCCAAWEFQRESRDQR* |
| Ga0137409_102097113 | 3300015245 | Vadose Zone Soil | MEFEIQFARDRDDPGLDKFHVHIRCFAAWEFERGGS* |
| Ga0137403_100743216 | 3300015264 | Vadose Zone Soil | MEFEIQFTRDGVDVELVQAGIVIRCFAAWEFERSSDK* |
| Ga0134089_100194451 | 3300015358 | Grasslands Soil | EFEIEFARDGDNPGLDKFPVHIRCFAAWEFERSSDK* |
| Ga0132258_133439932 | 3300015371 | Arabidopsis Rhizosphere | VTKDEMEFEIEFARDGDNPGLDKFHTHVRCFAAWELKRARA* |
| Ga0134112_102774071 | 3300017656 | Grasslands Soil | EMEFEIEFTRDGDNPGLDTFHVHIRCFAAWEFERDSRGKPAERRS |
| Ga0187821_102667863 | 3300017936 | Freshwater Sediment | IQFAHDGDNPGLDRFHVHIRCFAAWEFERNKPLRV |
| Ga0190265_101051512 | 3300018422 | Soil | MEFEIEFEHDGAVPGLNKFHIHIRCFAAWEFERKHAGA |
| Ga0190265_132683822 | 3300018422 | Soil | EIEFSHDGSSPGLDKFHVHIRCFAAWELERGKAGQS |
| Ga0066655_100047806 | 3300018431 | Grasslands Soil | MEFEIQFTRDGVDVELVQAGIVIRCFAAWEFERSSDK |
| Ga0066667_104345172 | 3300018433 | Grasslands Soil | DELEFEIQFAHDGDNPGLDKFHVHIRCFAAWEFERDKTP |
| Ga0066669_1000009812 | 3300018482 | Grasslands Soil | MEFEIQFTRDGDNPGLDKFHVHIRCFAAWEFERSSDK |
| Ga0137408_10675637 | 3300019789 | Vadose Zone Soil | MEFEIEFARDGGNPGLDRFHIHLRCCTAWEFERQS |
| Ga0193732_10580891 | 3300020012 | Soil | LECEIEFARAADFPGLDNFHVHVRCLAAWEFERTKAPQ |
| Ga0210404_107798552 | 3300021088 | Soil | ELEFEIQFEHDGSNPGLDKFHVHIRCFAAWEFERNKPPH |
| Ga0210384_106251011 | 3300021432 | Soil | FEIQFARDGDNPGLDKFHVHIRCYAAWEFERNKPPQ |
| Ga0137417_14390547 | 3300024330 | Vadose Zone Soil | MEFEIQFARDGDNPGLDKYHVHIRCFAAWEFERQSG |
| Ga0137417_14521512 | 3300024330 | Vadose Zone Soil | MEFEIEFARDGDNPGLDKYHVHIRCFAAREFERHSA |
| Ga0207646_110620353 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | DEMEFEIQFARDGDNPGLDKFHVHLRCFAAWEFERGRDA |
| Ga0209236_10001072 | 3300026298 | Grasslands Soil | MEFEIQFARDGDNPGLDKFHVHIRCFAAWEFERGASDPR |
| Ga0209239_10857771 | 3300026310 | Grasslands Soil | DQMEFEIQFTRDGDNPGLDKFHVHIRCFAAWEFERSSDK |
| Ga0209268_100211513 | 3300026314 | Soil | MEFEIQFARDGDNPGLDKFHVHIRCCAAWEFERESRDQR |
| Ga0209472_10542031 | 3300026323 | Soil | EFEIQFARDGDNPGLDKFHVHIRCCAAWEFERESRDQR |
| Ga0209152_104262962 | 3300026325 | Soil | MEFEIQFARDGDNPGLDKYHVHIRCFAAWEFERRGK |
| Ga0209801_10755561 | 3300026326 | Soil | EFEIQFTRDGDNPGLDKFHVHIRCFAAWEFERESRGQR |
| Ga0209266_10565341 | 3300026327 | Soil | MEFEIEFARDGSNPGLDKFHVHLQCFAAWEFERGSA |
| Ga0209159_10119152 | 3300026343 | Soil | VQATEMEFEIEFARDGSNPGLDKFHVHLQCFAAWEFERGSA |
| Ga0257159_10039153 | 3300026494 | Soil | FEIQFARDGRDPGLDKYHVHIRCFAAWEFERNEPPA |
| Ga0209806_10079038 | 3300026529 | Soil | TEMEFEIQFQRNGENPGLDKYHIHIRCFAAWEFERQSF |
| Ga0179587_108460713 | 3300026557 | Vadose Zone Soil | EEMEFEIQFARDGDNPGLDKYHVHIRCYAAWEFERTKAQSP |
| Ga0209180_107811771 | 3300027846 | Vadose Zone Soil | FEIQFPRDGDNPGLDKFHVHIRCYAAWEFERNKVPPSQ |
| Ga0209526_103154302 | 3300028047 | Forest Soil | EEMEFEIEFARDGDNPGLDKYHVHIRCYAAWEFERNKPRP |
| Ga0137415_100194758 | 3300028536 | Vadose Zone Soil | ELEFEIQFAHDGDNPGLDKFHVHIRCFAAWELERGKA |
| Ga0137415_100821564 | 3300028536 | Vadose Zone Soil | MEFEIQFARDGSNPGLDKFHIHIRCFAAWEFERRNG |
| Ga0307278_100692901 | 3300028878 | Soil | MEFEIEFAHDGSNPGLDKFHVHIRCFAAWEFERRSVLGTG |
| Ga0307278_105271841 | 3300028878 | Soil | MEFAIQFARDGDNPGLDKFHVHLRCFAAWEFERRTALGIG |
| Ga0299913_100976493 | 3300031229 | Soil | MEFEVEFAHDGESPGLDRFHIHIRCFAAWEFERNKPT |
| Ga0307473_104978112 | 3300031820 | Hardwood Forest Soil | VSADELEFEIQFARDGNNPGLDKFHVHIRCFAAWELERHGG |
| Ga0307470_113442591 | 3300032174 | Hardwood Forest Soil | IQFARDGDNPGLDKFHVHIRCFAAWEFERNKQPSP |
| Ga0307472_1011955931 | 3300032205 | Hardwood Forest Soil | MEQLEFEIEFARDGDNPGLDQFHVHLRCFAAWELERNKPPRV |
| ⦗Top⦘ |