


| Basic Information | |
|---|---|
| Family ID | F085349 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 111 |
| Average Sequence Length | 52 residues |
| Representative Sequence | MFKFLSTKEQLLEEKRKNEALRSLVKDLEDAALELAEIVAANEEAIQEVQNG |
| Number of Associated Samples | 69 |
| Number of Associated Scaffolds | 111 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 78.38 % |
| % of genes near scaffold ends (potentially truncated) | 19.82 % |
| % of genes from short scaffolds (< 2000 bps) | 74.77 % |
| Associated GOLD sequencing projects | 57 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.62 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (63.964 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge (38.739 % of family members) |
| Environment Ontology (ENVO) | Unclassified (88.288 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (46.847 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 56.25% β-sheet: 0.00% Coil/Unstructured: 43.75% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.62 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 111 Family Scaffolds |
|---|---|---|
| PF00078 | RVT_1 | 19.82 |
| PF01471 | PG_binding_1 | 4.50 |
| PF06605 | Prophage_tail | 2.70 |
| PF09992 | NAGPA | 2.70 |
| PF00589 | Phage_integrase | 2.70 |
| PF05105 | Phage_holin_4_1 | 1.80 |
| PF13495 | Phage_int_SAM_4 | 0.90 |
| PF07833 | Cu_amine_oxidN1 | 0.90 |
| PF13392 | HNH_3 | 0.90 |
| PF06854 | Phage_Gp15 | 0.90 |
| PF13472 | Lipase_GDSL_2 | 0.90 |
| PF05036 | SPOR | 0.90 |
| PF01510 | Amidase_2 | 0.90 |
| COG ID | Name | Functional Category | % Frequency in 111 Family Scaffolds |
|---|---|---|---|
| COG4824 | Phage-related holin (Lysis protein) | Mobilome: prophages, transposons [X] | 1.80 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 69.37 % |
| Unclassified | root | N/A | 30.63 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2020350001|VrWwTxAD_contig40022 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA104 | 530 | Open in IMG/M |
| 2209111015|2218371378 | Not Available | 520 | Open in IMG/M |
| 3300000558|Draft_11707174 | Not Available | 550 | Open in IMG/M |
| 3300001580|Draft_10461643 | Not Available | 514 | Open in IMG/M |
| 3300001788|BP130528DKS3_1706048 | Not Available | 787 | Open in IMG/M |
| 3300002163|JGI24707J26582_10124944 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300002166|JGI24713J26584_10011081 | All Organisms → cellular organisms → Bacteria | 3983 | Open in IMG/M |
| 3300002166|JGI24713J26584_10041286 | All Organisms → Viruses → Predicted Viral | 1205 | Open in IMG/M |
| 3300002167|JGI24714J26587_10014601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 3336 | Open in IMG/M |
| 3300002167|JGI24714J26587_10023249 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanosarcinales → Methanosarcinaceae → Methanosarcina → unclassified Methanosarcina → Methanosarcina sp. | 2229 | Open in IMG/M |
| 3300002168|JGI24712J26585_10034677 | All Organisms → Viruses → Predicted Viral | 2399 | Open in IMG/M |
| 3300002168|JGI24712J26585_10056922 | All Organisms → cellular organisms → Bacteria | 1602 | Open in IMG/M |
| 3300002168|JGI24712J26585_10164188 | Not Available | 649 | Open in IMG/M |
| 3300002170|JGI24711J26586_10011897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae | 4207 | Open in IMG/M |
| 3300002170|JGI24711J26586_10069232 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
| 3300002173|JGI24709J26583_10094379 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300002173|JGI24709J26583_10095245 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300002378|JGI24502J29692_10067419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 3382 | Open in IMG/M |
| 3300002378|JGI24502J29692_10072532 | All Organisms → cellular organisms → Bacteria | 1259 | Open in IMG/M |
| 3300002391|JGI24501J29690_1063821 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300002391|JGI24501J29690_1121933 | Not Available | 626 | Open in IMG/M |
| 3300002392|JGI24503J29689_10086242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 2409 | Open in IMG/M |
| 3300002392|JGI24503J29689_10188826 | Not Available | 545 | Open in IMG/M |
| 3300002703|draft_10902863 | Not Available | 634 | Open in IMG/M |
| 3300002898|draft_10097849 | All Organisms → cellular organisms → Bacteria | 2098 | Open in IMG/M |
| 3300002898|draft_10238868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium | 991 | Open in IMG/M |
| 3300002898|draft_10244765 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300002898|draft_10258283 | Not Available | 928 | Open in IMG/M |
| 3300002898|draft_10302247 | Not Available | 813 | Open in IMG/M |
| 3300002898|draft_10538558 | Not Available | 504 | Open in IMG/M |
| 3300002898|draft_10541098 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300006805|Ga0075464_10014168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 4000 | Open in IMG/M |
| 3300006805|Ga0075464_10194376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1204 | Open in IMG/M |
| 3300006805|Ga0075464_10826213 | Not Available | 577 | Open in IMG/M |
| 3300006805|Ga0075464_11059451 | Not Available | 510 | Open in IMG/M |
| 3300009647|Ga0123326_1185059 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300009655|Ga0116190_1005893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 8127 | Open in IMG/M |
| 3300009655|Ga0116190_1077761 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA104 | 1314 | Open in IMG/M |
| 3300009655|Ga0116190_1097402 | All Organisms → cellular organisms → Bacteria | 1122 | Open in IMG/M |
| 3300009657|Ga0116179_1119347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 954 | Open in IMG/M |
| 3300009658|Ga0116188_1079280 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA104 | 1364 | Open in IMG/M |
| 3300009664|Ga0116146_1117948 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
| 3300009666|Ga0116182_1124461 | All Organisms → cellular organisms → Bacteria | 1249 | Open in IMG/M |
| 3300009667|Ga0116147_1062434 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA104 | 1715 | Open in IMG/M |
| 3300009667|Ga0116147_1189217 | Not Available | 812 | Open in IMG/M |
| 3300009670|Ga0116183_1059787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 2217 | Open in IMG/M |
| 3300009670|Ga0116183_1060630 | All Organisms → cellular organisms → Bacteria | 2195 | Open in IMG/M |
| 3300009670|Ga0116183_1116284 | All Organisms → Viruses → Predicted Viral | 1377 | Open in IMG/M |
| 3300009671|Ga0123334_1129470 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA104 | 1234 | Open in IMG/M |
| 3300009674|Ga0116173_1354997 | Not Available | 642 | Open in IMG/M |
| 3300009676|Ga0116187_1039832 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA104 | 2644 | Open in IMG/M |
| 3300009680|Ga0123335_1113473 | All Organisms → cellular organisms → Bacteria | 1549 | Open in IMG/M |
| 3300009680|Ga0123335_1382326 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA104 | 654 | Open in IMG/M |
| 3300009681|Ga0116174_10265643 | Not Available | 837 | Open in IMG/M |
| 3300009682|Ga0116172_10063711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae → Phosphitispora → Phosphitispora fastidiosa | 2203 | Open in IMG/M |
| 3300009682|Ga0116172_10414190 | Not Available | 632 | Open in IMG/M |
| 3300009689|Ga0116186_1145326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae → Desulfotomaculum → Desulfotomaculum reducens | 1111 | Open in IMG/M |
| 3300009696|Ga0116177_10654780 | Not Available | 545 | Open in IMG/M |
| 3300009704|Ga0116145_1154565 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA104 | 914 | Open in IMG/M |
| 3300009711|Ga0116166_1073899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 1426 | Open in IMG/M |
| 3300009712|Ga0116165_1128203 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA104 | 912 | Open in IMG/M |
| 3300009714|Ga0116189_1133968 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
| 3300009715|Ga0116160_1044093 | Not Available | 2211 | Open in IMG/M |
| 3300009780|Ga0116156_10354798 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300010265|Ga0134098_1004454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 7040 | Open in IMG/M |
| 3300010268|Ga0134097_1054745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 715 | Open in IMG/M |
| 3300010338|Ga0116245_10178614 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA104 | 1174 | Open in IMG/M |
| 3300010340|Ga0116250_10576214 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300010344|Ga0116243_10575678 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA104 | 677 | Open in IMG/M |
| 3300010347|Ga0116238_10702305 | Not Available | 623 | Open in IMG/M |
| 3300010351|Ga0116248_11003330 | Not Available | 566 | Open in IMG/M |
| 3300010351|Ga0116248_11083582 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300010357|Ga0116249_10296483 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA104 | 1494 | Open in IMG/M |
| 3300012949|Ga0153798_10236482 | Not Available | 626 | Open in IMG/M |
| 3300014203|Ga0172378_10052535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 3500 | Open in IMG/M |
| 3300014203|Ga0172378_10205240 | Not Available | 1561 | Open in IMG/M |
| 3300014203|Ga0172378_11171538 | Not Available | 544 | Open in IMG/M |
| 3300014204|Ga0172381_10536194 | Not Available | 901 | Open in IMG/M |
| 3300014204|Ga0172381_10577582 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300014204|Ga0172381_11078223 | Not Available | 590 | Open in IMG/M |
| 3300014205|Ga0172380_11323059 | Not Available | 503 | Open in IMG/M |
| 3300014206|Ga0172377_10081447 | All Organisms → Viruses → Predicted Viral | 2984 | Open in IMG/M |
| 3300014206|Ga0172377_10169804 | All Organisms → cellular organisms → Bacteria | 1927 | Open in IMG/M |
| 3300014206|Ga0172377_10599989 | Not Available | 885 | Open in IMG/M |
| 3300015214|Ga0172382_10006208 | All Organisms → cellular organisms → Bacteria | 17466 | Open in IMG/M |
| 3300019203|Ga0179955_1075092 | Not Available | 586 | Open in IMG/M |
| 3300019222|Ga0179957_1102626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 1235 | Open in IMG/M |
| 3300019227|Ga0179956_1081031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 838 | Open in IMG/M |
| 3300019227|Ga0179956_1197679 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA104 | 1435 | Open in IMG/M |
| 3300025613|Ga0208461_1017799 | All Organisms → cellular organisms → Bacteria | 3193 | Open in IMG/M |
| 3300025638|Ga0208198_1032907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 2044 | Open in IMG/M |
| 3300025686|Ga0209506_1087460 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300025713|Ga0208195_1011160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 5393 | Open in IMG/M |
| 3300025737|Ga0208694_1119269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → unclassified Oscillospiraceae → Oscillospiraceae bacterium | 963 | Open in IMG/M |
| 3300025762|Ga0208040_1018496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 3930 | Open in IMG/M |
| 3300025762|Ga0208040_1228334 | Not Available | 633 | Open in IMG/M |
| 3300026311|Ga0209723_1030491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae → Desulfotomaculum → unclassified Desulfotomaculum → Desulfotomaculum sp. | 3035 | Open in IMG/M |
| 3300026311|Ga0209723_1032104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 2904 | Open in IMG/M |
| 3300026311|Ga0209723_1281057 | Not Available | 563 | Open in IMG/M |
| 3300027510|Ga0209537_1012857 | All Organisms → cellular organisms → Bacteria | 4741 | Open in IMG/M |
| 3300027510|Ga0209537_1056780 | All Organisms → Viruses → Predicted Viral | 1153 | Open in IMG/M |
| (restricted) 3300028561|Ga0255343_1036293 | All Organisms → cellular organisms → Bacteria | 2693 | Open in IMG/M |
| (restricted) 3300028570|Ga0255341_1204893 | Not Available | 792 | Open in IMG/M |
| (restricted) 3300028576|Ga0255340_1272120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 656 | Open in IMG/M |
| (restricted) 3300028593|Ga0255347_1394765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Mesobacillus → Mesobacillus subterraneus | 539 | Open in IMG/M |
| 3300028602|Ga0265294_10048344 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA104 | 3830 | Open in IMG/M |
| 3300028602|Ga0265294_10130439 | All Organisms → cellular organisms → Bacteria | 1938 | Open in IMG/M |
| 3300028602|Ga0265294_10150888 | All Organisms → cellular organisms → Bacteria | 1752 | Open in IMG/M |
| 3300028602|Ga0265294_10253939 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
| 3300028602|Ga0265294_10404212 | Not Available | 863 | Open in IMG/M |
| 3300028602|Ga0265294_10852508 | Not Available | 500 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 38.74% |
| Biogas Fermentantion | Engineered → Biotransformation → Mixed Alcohol Bioreactor → Unclassified → Unclassified → Biogas Fermentantion | 18.02% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 8.11% |
| Landfill Leachate | Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate | 7.21% |
| Biogas Fermenter | Engineered → Unclassified → Unclassified → Unclassified → Unclassified → Biogas Fermenter | 6.31% |
| Anaerobic Biogas Reactor | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor | 6.31% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.60% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 3.60% |
| Wastewater | Engineered → Built Environment → Water Treatment Plant → Unclassified → Unclassified → Wastewater | 3.60% |
| Switchgrass Degrading | Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Switchgrass Degrading | 2.70% |
| Biogas Reactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Biogas Reactor | 0.90% |
| Wastewater | Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Anaerobic) → Unclassified → Wastewater | 0.90% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2020350001 | Viral communities in wastewater treatment process (AD) | Engineered | Open in IMG/M |
| 2209111015 | Tailings pond microbial communities from Northern Alberta -TP6_2008_2010: | Engineered | Open in IMG/M |
| 3300000558 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011 | Engineered | Open in IMG/M |
| 3300001580 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Suncor taillings pond 6 2012TP6_6 | Engineered | Open in IMG/M |
| 3300001788 | BioPara_130528DK_S3 | Engineered | Open in IMG/M |
| 3300002163 | Biogas fermentation microbial communities from Germany - Plant 1 DNA1 | Engineered | Open in IMG/M |
| 3300002166 | Biogas fermentation microbial communities from Germany - Plant 4 DNA1 | Engineered | Open in IMG/M |
| 3300002167 | Biogas fermentation microbial communities from Germany - Plant 4 DNA2 | Engineered | Open in IMG/M |
| 3300002168 | Biogas fermentation microbial communities from Germany - Plant 3 DNA2 | Engineered | Open in IMG/M |
| 3300002170 | Biogas fermentation microbial communities from Germany - Plant 3 DNA1 | Engineered | Open in IMG/M |
| 3300002173 | Biogas fermentation microbial communities from Germany - Plant 2 DNA1 | Engineered | Open in IMG/M |
| 3300002378 | Biogas fermentation microbial communities from Germany - Plant 3 RNA1 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300002391 | Biogas fermentation microbial communities from Germany - Plant 2 RNA2 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300002392 | Biogas fermentation microbial communities from Germany - Plant 3 RNA2 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300002703 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Oil sands tailings Tailings Pond 5 - 2012TP5 | Engineered | Open in IMG/M |
| 3300002898 | Metagenome Biopara biogasfermenter May 2013 pooled | Engineered | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009647 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_A C13 SIP DNA | Engineered | Open in IMG/M |
| 3300009655 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR4_MetaG | Engineered | Open in IMG/M |
| 3300009657 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC071_MetaG | Engineered | Open in IMG/M |
| 3300009658 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR2_MetaG | Engineered | Open in IMG/M |
| 3300009664 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG2_MetaG | Engineered | Open in IMG/M |
| 3300009666 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC077_MetaG | Engineered | Open in IMG/M |
| 3300009667 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG3_MetaG | Engineered | Open in IMG/M |
| 3300009670 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC078_MetaG | Engineered | Open in IMG/M |
| 3300009671 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1 time_0 SIP DNA | Engineered | Open in IMG/M |
| 3300009674 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC085_MetaG | Engineered | Open in IMG/M |
| 3300009676 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA6_MetaG | Engineered | Open in IMG/M |
| 3300009680 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2 time_0 SIP DNA | Engineered | Open in IMG/M |
| 3300009681 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC087_MetaG | Engineered | Open in IMG/M |
| 3300009682 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC083_MetaG | Engineered | Open in IMG/M |
| 3300009689 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA4_MetaG | Engineered | Open in IMG/M |
| 3300009696 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC10_MetaG | Engineered | Open in IMG/M |
| 3300009704 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG1_MetaG | Engineered | Open in IMG/M |
| 3300009711 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNMR2_MetaG | Engineered | Open in IMG/M |
| 3300009712 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNMR1_MetaG | Engineered | Open in IMG/M |
| 3300009714 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR3_MetaG | Engineered | Open in IMG/M |
| 3300009715 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS2_MetaG | Engineered | Open in IMG/M |
| 3300009780 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC045_MetaG | Engineered | Open in IMG/M |
| 3300010265 | Switchgrass degrading microbial communities from high solid loading bioreactors in New Hampshire, USA - 9_31_10_142_A3 metaG | Engineered | Open in IMG/M |
| 3300010268 | Switchgrass degrading microbial communities from high solid loading bioreactors in New Hampshire, USA - 8_30_10_142_A2 metaG | Engineered | Open in IMG/M |
| 3300010338 | AD_JPMRca | Engineered | Open in IMG/M |
| 3300010340 | AD_USOAca | Engineered | Open in IMG/M |
| 3300010344 | AD_JPASca | Engineered | Open in IMG/M |
| 3300010347 | AD_JPHGca | Engineered | Open in IMG/M |
| 3300010351 | AD_USPNca | Engineered | Open in IMG/M |
| 3300010357 | AD_USSTca | Engineered | Open in IMG/M |
| 3300012949 | Switchgrass enrichment cultures co-assembly | Engineered | Open in IMG/M |
| 3300014203 | Groundwater microbial communities from an aquifer near a municipal landfill in Southern Ontario, Canada - Pumphouse #3_1 metaG | Environmental | Open in IMG/M |
| 3300014204 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 64-88 metaG | Engineered | Open in IMG/M |
| 3300014205 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 162 metaG | Engineered | Open in IMG/M |
| 3300014206 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #3 metaG | Engineered | Open in IMG/M |
| 3300015214 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 138R metaG | Engineered | Open in IMG/M |
| 3300019203 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNTR2_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300019222 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNTR4_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300019227 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNTR3_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300025613 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR4_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025638 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR2_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025686 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG2_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025713 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC077_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025737 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC078_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025762 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC083_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300026311 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2 time_0 SIP DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300027510 | Biogas fermentation microbial communities from Germany - Plant 4 DNA1 (SPAdes) | Engineered | Open in IMG/M |
| 3300028561 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant16 | Engineered | Open in IMG/M |
| 3300028570 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant12 | Engineered | Open in IMG/M |
| 3300028576 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant10 | Engineered | Open in IMG/M |
| 3300028593 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant24 | Engineered | Open in IMG/M |
| 3300028602 | Groundwater microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #3 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AD_40390 | 2020350001 | Wastewater | MFKILSIREQLMEEKRKNEALRALNIDLENALLELAEIVAMNEATLQEVTNG |
| 2218323991 | 2209111015 | Hydrocarbon Resource Environments | MVSDMFKYMDLREQLQEEKHKNKALQSLVKNLEDATLELAEIVAANEEALREVQNG |
| Draft_117071742 | 3300000558 | Hydrocarbon Resource Environments | MVSDMFKYMDLREQLQEEKHKNKALQSLVKNLEDATLELAEIVAANEEALREVQNG* |
| Draft_104616433 | 3300001580 | Hydrocarbon Resource Environments | CFTITYGRMVSDMFKYMDLREQLQEEKHKNKALQSLVKNLEDATLELAEIVAANEEALREVQNG* |
| BP130528DKS3_17060482 | 3300001788 | Biogas Reactor | MSMFKFLSTAEQLLEERRKNEALRSLVKDLEDAALELAEIVAANEEAIQEVQNG* |
| JGI24707J26582_101249444 | 3300002163 | Biogas Fermentantion | MFRFLGIREQLLEEKRKNEALQSLVNDLEDALVEIAEIAAENTEVEDDG* |
| JGI24713J26584_100110813 | 3300002166 | Biogas Fermentantion | MRIYGKVVISVFKFLSTKEQLLEEKRKNEALRSLVKDLEDAALELAEIVAANEEAIQEVQNG* |
| JGI24713J26584_100412863 | 3300002166 | Biogas Fermentantion | MFRFLGIREQLLEEXRKNEVLQSLVNDLEDALVEIAEIAAENTEVEDDG* |
| JGI24714J26587_100146012 | 3300002167 | Biogas Fermentantion | MFRFLGIREQLLEEKRKNEVLQSLVNDLEDALVEIAEIAAENTEVEDDG* |
| JGI24714J26587_100232492 | 3300002167 | Biogas Fermentantion | VFKFLSTKEQLLEEKRKNEALRSLVKDLEDAALELAEIVAANEEAIQEVQNG* |
| JGI24712J26585_100346772 | 3300002168 | Biogas Fermentantion | MFKFLDLKERLLIEQQKNAALQAQNIDLEDALLELAEIVAQNETAIQEVQNG* |
| JGI24712J26585_100569222 | 3300002168 | Biogas Fermentantion | MFRFLGIREQLLEERRKNEVLQSLVNDLEDALVEIAEIAAENTEVEDDG* |
| JGI24712J26585_101641882 | 3300002168 | Biogas Fermentantion | MKTYGRKVSSMFKYLSMREQLLEEKRKNEALQSLVKDLEDAVIELAEIVAANEETLQEVQNG* |
| JGI24711J26586_100118977 | 3300002170 | Biogas Fermentantion | MFKFLDLREQLLEEKRKNEALQSLVNDLEDALVEIAEIAAENTEVEDDG* |
| JGI24711J26586_100692323 | 3300002170 | Biogas Fermentantion | MSMFKFLSTAEQLLEERRKNEAXRSLVKDLEDAALELAEIVAANEEAIQEVQNG* |
| JGI24709J26583_100943791 | 3300002173 | Biogas Fermentantion | MFRFLGIREQLLEEKRKNEALQSLVNDLENALVEIAEIAAENTEVEDDG* |
| JGI24709J26583_100952451 | 3300002173 | Biogas Fermentantion | MFKFLDLREQLLEERRKNEALQSLVNDLEDALVEIAEIAAENTEVDDDG* |
| JGI24502J29692_100674193 | 3300002378 | Biogas Fermentantion | MFKFLDLRDRLLLEQQKNAELQARNTDLENALLELAEIVVQNETAIQEVQNG* |
| JGI24502J29692_100725322 | 3300002378 | Biogas Fermentantion | MFKFLDLREQLLEERRKNEALQSLVNDLEDALVEIAEIVAENTEEVEDDG* |
| JGI24501J29690_10638211 | 3300002391 | Biogas Fermentantion | FIKIYGRKAVTMFKFLDLREQLLEERRKNEALQSLVNDLEDALVEIAEIAAENTEVDDDG |
| JGI24501J29690_11219331 | 3300002391 | Biogas Fermentantion | LDLKERLLIEQQKNAALQARNTDLEDALLELAEIVVQNETAIQEVQNG* |
| JGI24503J29689_100862422 | 3300002392 | Biogas Fermentantion | MFKFLDLREQLLEEKRKNEALQSLVNDLEDALVEIAEIAAENTEVDDDG* |
| JGI24503J29689_101888262 | 3300002392 | Biogas Fermentantion | MNMFKFLDLKERLLIEQQKNAALQAQNIDLEDALLELAEIVAQNETAIQEVQNG* |
| draft_109028632 | 3300002703 | Hydrocarbon Resource Environments | MFKYMDLREQLQEEKHKNKALQSLVKNLEDATLELAEIVAANEEALREVQNG* |
| draft_100978492 | 3300002898 | Biogas Fermenter | MFKFMNLREQLLEERRKNESLRSQVKEIEDATVELAEIVATNEEAINNG* |
| draft_102388683 | 3300002898 | Biogas Fermenter | VFKYLSTKEQLLEERRKNEMLRSLVRDLEDATLELAEIVASNEAAIQQTQQEVQNG* |
| draft_102447652 | 3300002898 | Biogas Fermenter | MFKYLGIREQLAEEKRKNEALRSLAKDLEDALIEVAEIVAENAEVVNNG* |
| draft_102582832 | 3300002898 | Biogas Fermenter | MFKFLSTKDQLLEEKRKNEALQAQIKEQEDALIELAEIIAANEEVIDNG* |
| draft_103022472 | 3300002898 | Biogas Fermenter | MKIYGRMVNDMFKRLGTREQLQAEKIKNEALQALCKDLEDAVIELAEIAAANEEAIKEASING* |
| draft_105385582 | 3300002898 | Biogas Fermenter | MVSDMFKYMDLREQLQAEKRKNEALQSLVKDLEDAVIELAEIVAANEEKLQEVQNG* |
| draft_105410982 | 3300002898 | Biogas Fermenter | MFKFLGLREQLAEERRKNEALQELVKDLENATIELAEIVATNEEAINNG* |
| Ga0075464_100141683 | 3300006805 | Aqueous | MFKFLSTKEQLLEEKRKNEALRSLVKDLEDAALELAEIVAANDEVIQEVQNG* |
| Ga0075464_101943762 | 3300006805 | Aqueous | MFSYKSIKEQLQEERRKNEALRALCKDLEDAAIELAEIVAANEEAIKAIKEE* |
| Ga0075464_108262132 | 3300006805 | Aqueous | MFKFMSLREQLLEEKRKNEALQAQVKEQEDALIELAEIVAANEEAITNG* |
| Ga0075464_110594513 | 3300006805 | Aqueous | MFKFLSTKEQLLEEKRKNEALRSLVKDLEDAALELAEIVAANEEAIQEVQNG* |
| Ga0123326_11850592 | 3300009647 | Anaerobic Biogas Reactor | MFKFLSTKEQLLEEKRKNEAFRSLVKDLEDAALELAEIVAANEEAIQEVQNG* |
| Ga0116190_10058937 | 3300009655 | Anaerobic Digestor Sludge | MFRFLDLREQLLEERRKNEELRALCKDLEDAAIELAEIVAANEEAIQEVQSNG* |
| Ga0116190_10777612 | 3300009655 | Anaerobic Digestor Sludge | MFRFLGIREQLLEEKRKNEELRALCKDLEDAAIELAEIVAANEEAIQEVQSNG* |
| Ga0116190_10974022 | 3300009655 | Anaerobic Digestor Sludge | MFKFMSTKEQLLEEKRKNEALQSLVKDLEDAVIELAEIVAANEEKLQEVQ* |
| Ga0116179_11193472 | 3300009657 | Anaerobic Digestor Sludge | MFKFLDIREQLLEERRKNEELRALCKDLEDAVIELAEIVAANEEAIQEVQSNG* |
| Ga0116188_10792802 | 3300009658 | Anaerobic Digestor Sludge | MFRFLGIREQLLEEKRKNEELRALCKDLEDAAIELAEIVAANEEAIREVEYDG* |
| Ga0116146_11179481 | 3300009664 | Anaerobic Digestor Sludge | MFKFLDIKEQLLEEKRKNEALRAIVKEQEDALIELAEIVASNEEAIANG* |
| Ga0116182_11244613 | 3300009666 | Anaerobic Digestor Sludge | MFKFFDLREQLLEERRKNKELRALCKDLEDAAIELAEIVAANEEAIQEVQING* |
| Ga0116147_10624342 | 3300009667 | Anaerobic Digestor Sludge | MFKFLSIREQLMEEKRKNEALIALNIDLENALLELAEIVAINEATLQEVTNG* |
| Ga0116147_11892171 | 3300009667 | Anaerobic Digestor Sludge | MFKFMSTKEQLLEEKRKNEALQSLVKDLEDAVIELAEIVAANEETLQEVQNG* |
| Ga0116183_10597872 | 3300009670 | Anaerobic Digestor Sludge | MFKFLSTKDQLLEEKRKNEALQAQIKEQEEALIELAEIIAANEEAIANG* |
| Ga0116183_10606306 | 3300009670 | Anaerobic Digestor Sludge | MFKFLSTKEQLLEEKRKNEALRSLVKDLEDAALELAEIVAAN |
| Ga0116183_11162842 | 3300009670 | Anaerobic Digestor Sludge | MFKYLGLREQLMEEKRKNEALQSLAKDLEDALIEVAEIVAENAEVVNNG* |
| Ga0123334_11294702 | 3300009671 | Anaerobic Biogas Reactor | MFKFLSIREQLLEEKRKNEALTALNIDLENALLELAEIVAMNEVIIQEVV* |
| Ga0116173_13549972 | 3300009674 | Anaerobic Digestor Sludge | MKIYGKVVNRMFKFLSTKEQLLEEKRKNEALRSLVKDLEDAALELAEIVAANDEVIQEVQNG* |
| Ga0116187_10398325 | 3300009676 | Anaerobic Digestor Sludge | MFKYLSDKEQLLEEKRKNEVLQSLVKDLEDAVIELAEIVAAN |
| Ga0123335_11134732 | 3300009680 | Anaerobic Biogas Reactor | MGGRISMFKFLSIREQLLEERRRNEALKALNIDLENALLELAEIVAMNEVIIQEVTNG* |
| Ga0123335_13823262 | 3300009680 | Anaerobic Biogas Reactor | MFKFLSIREQLLEEKRKNEALTALNIDLENALLELAEIVAMNEVIIQEVT |
| Ga0116174_102656432 | 3300009681 | Anaerobic Digestor Sludge | MFKFLSTAEQLLEERRKNEALRSLVKDLEDAAIELAEIVAANEEAIQEVQNG* |
| Ga0116172_100637115 | 3300009682 | Anaerobic Digestor Sludge | KFLSTKEQLLEEKRKNEALRSLVKDLEDAALELAEIVAANDEVIQEVQNG* |
| Ga0116172_104141901 | 3300009682 | Anaerobic Digestor Sludge | IGFMKIYGKVVNRMFKFLSTKEQLLEEKRKNEALRSLVKDLEDAAIELAEIVAANEEAIQEVQNG* |
| Ga0116186_11453264 | 3300009689 | Anaerobic Digestor Sludge | MFKFLSTAEQLLEERRKNEALRSLVKDLENAAIELAEIVAANEEAIQEVQNG* |
| Ga0116177_106547801 | 3300009696 | Anaerobic Digestor Sludge | MFKYLGIREQLAEEKRKNEALQSITKDLEDALIEVAEIVAENAEVVNNG* |
| Ga0116145_11545653 | 3300009704 | Anaerobic Digestor Sludge | MFRFLRIREQLLEEKRKNEALQSLVNDLEDALIEIAEIAAENTEVDDDG* |
| Ga0116166_10738992 | 3300009711 | Anaerobic Digestor Sludge | MFKFLNLREQLHEERRKNEELRALCKDLEDAIIELAEIVAANEEAIQEVQSNG* |
| Ga0116165_11282033 | 3300009712 | Anaerobic Digestor Sludge | MFKFLNLREQLREERRKNEELRALCKDLEDAVIELAEIVAANEE |
| Ga0116189_11339682 | 3300009714 | Anaerobic Digestor Sludge | MFKFMSTKEQLLEEKRKNEALQSLVKDLEDAVIEL |
| Ga0116160_10440936 | 3300009715 | Anaerobic Digestor Sludge | MFKYLSNKEQLLEEKRKNEALQALLKEQEDALIELAEIVASKEAIANG* |
| Ga0116156_103547982 | 3300009780 | Anaerobic Digestor Sludge | MGGRISMFKFLSVREQLMEEKRKNEALQAVNIDLENALLELAEIVAMNEVAPQEVTNG* |
| Ga0134098_10044547 | 3300010265 | Switchgrass Degrading | MFKFLDIREQLREERRKNEELRALCKDLEDAAIELAEIVAANEKAIREVQDDG* |
| Ga0134097_10547451 | 3300010268 | Switchgrass Degrading | IREQLREERRKNEELRALCKDLEDAAIELAEIVAANEKAIREVQDDG* |
| Ga0116245_101786142 | 3300010338 | Anaerobic Digestor Sludge | MFKFLNLREQLREERRKNEELRALCKDLEDAVIELAEIVAANEEAIQEVQSNG* |
| Ga0116250_105762142 | 3300010340 | Anaerobic Digestor Sludge | MFKFLDLREQLLEERRKNEALQSLVNDLEDALVEIAEIAAENTEVDDNG* |
| Ga0116243_105756781 | 3300010344 | Anaerobic Digestor Sludge | MFKYLSDKEQLLEEKRKNEVLQSLVKDLEDAVIELAEIVAANEETLQEVQNG* |
| Ga0116238_107023053 | 3300010347 | Anaerobic Digestor Sludge | MKIYGKVAPRMFKFLSTKEQLLEEKRKNEALRSLVKDLEDAALELAEIVAANEEAIQEVQNG* |
| Ga0116248_110033303 | 3300010351 | Anaerobic Digestor Sludge | QLLEERRKNEALRSLVKDLEDAAIELAEIVAANEEAIQEVQNG* |
| Ga0116248_110835822 | 3300010351 | Anaerobic Digestor Sludge | MFKFLDLREQLLEERRKNKELRALCKDLEDAAIELAEIVAANEEAMREVEDDG* |
| Ga0116249_102964832 | 3300010357 | Anaerobic Digestor Sludge | MKIYGKVVNRMFKFLSTKEQLLEEKRKNEALRSLVKDLEDAALELAEIVAANEEAIQEVQNG* |
| Ga0153798_102364822 | 3300012949 | Switchgrass Degrading | MFKYLSDKEQLLEEKRKNEVLQSLVKDLEDALIELAAIVAANEEALREVQNG* |
| Ga0172378_100525354 | 3300014203 | Groundwater | MEGEIKMFKFMNTREQLQEERRKNEALQARCIDLENATLELAEIVAMNEQTIEEVVNNG* |
| Ga0172378_102052404 | 3300014203 | Groundwater | MVQTMFKFLDVREQLRAERQKNEALQSQNKDLENAVLELAEIVSVNEDLIQEVLNE* |
| Ga0172378_111715381 | 3300014203 | Groundwater | MEGVTSMFKFLDQREQLLEEKRKNEALQVQNKDLENALLELAEIVATNEATLMEVQNG* |
| Ga0172381_105361944 | 3300014204 | Landfill Leachate | MFKFMSLREQLMEEKRKNEALRAIVKDLEDAAIELAEIVAANEEAITNG* |
| Ga0172381_105775824 | 3300014204 | Landfill Leachate | QLQAEKIKNEALQALCKDLEDAVIELAEIAAATEEAIKEASING* |
| Ga0172381_110782232 | 3300014204 | Landfill Leachate | MFKYLGIREQLAEEKRKNEALQSITKDLEDALVEVAEIVAENAEVVNNG* |
| Ga0172380_113230591 | 3300014205 | Landfill Leachate | MFKYLGIREQLAEEKRKNEALQSLAKDLEDALIEVAEIVAENAEVVNNG* |
| Ga0172377_100814473 | 3300014206 | Landfill Leachate | MEGVTSMFKFLDQREQLLEEKRKNEALQAQNKDLENALLELAEIVATNEAVLQEVQNG* |
| Ga0172377_101698043 | 3300014206 | Landfill Leachate | MFKFLSTKEQLLEEKRKNEALRSLVKDFEDAALELAEIVATNEEAIQEVQNG* |
| Ga0172377_105999893 | 3300014206 | Landfill Leachate | MFKFLSIREQLMEEKRKNEALKALNIDLENALLELAEIVAMNEEAIDG* |
| Ga0172382_100062082 | 3300015214 | Landfill Leachate | MFKLLKLREQLQEERRKNEALQSLVKDLEDAAIELAEIVAANEEALQNG* |
| Ga0179955_10750922 | 3300019203 | Anaerobic Digestor Sludge | MFKFLDLREQLLEEKRKNEELRALCKDLEDAAIELAEIVAANEEAIQEVQSNG |
| Ga0179957_11026263 | 3300019222 | Anaerobic Digestor Sludge | VNRMFKFLSTKEQLLEEKRKNEALRSLVKDLEDAALELAEIVAANEEAIQEVQNG |
| Ga0179956_10810312 | 3300019227 | Anaerobic Digestor Sludge | MFKFLSTKEQLLEEKRKNEALRSLVKDLEDAALELAEIVAANEEAIQEVQNG |
| Ga0179956_11976793 | 3300019227 | Anaerobic Digestor Sludge | MFRFLDLREQLLEERRKNEELRALCKDLEDAAIELAEIVAANEEAIQEVQSNG |
| Ga0208461_10177994 | 3300025613 | Anaerobic Digestor Sludge | MFKFMSTKEQLLEEKRKNEALQSLVKDLEDAVIELAEIVAANEEKLQEVQ |
| Ga0208198_10329073 | 3300025638 | Anaerobic Digestor Sludge | MFRFLDLREQLLEERRKNEELRALCKDLEDAAIELAEIVAA |
| Ga0209506_10874601 | 3300025686 | Anaerobic Digestor Sludge | MFKFLDIKEQLLEEKRKNEALRAIVKEQEDALIELAEIVASNEEAIANG |
| Ga0208195_10111602 | 3300025713 | Anaerobic Digestor Sludge | MFKFLSTKEQLLEEKRKNEALRSLVKDLEDAALELAEIVAANDEVIQEVQNG |
| Ga0208694_11192693 | 3300025737 | Anaerobic Digestor Sludge | MFKYLGLREQLMEEKRKNEALQSLAKDLEDALIEVAEIVAENAEVVNNG |
| Ga0208040_101849611 | 3300025762 | Anaerobic Digestor Sludge | MSVVKSKHGRKVSSMFKYLSDKEQLLEEKRKNEALRSLVKDLEDAALELAEIVAANEEAIQEVQNG |
| Ga0208040_12283341 | 3300025762 | Anaerobic Digestor Sludge | IGFMKIYGKVVNRMFKFLSTKEQLLEEKRKNEALRSLVKDLEDAAIELAEIVAANEEAIQEVQNG |
| Ga0209723_10304911 | 3300026311 | Anaerobic Biogas Reactor | ELKMFKFLSTKDQLLEEKRKNEALQAQIKEQEDALIELAEIIAANEEVIDNG |
| Ga0209723_10321044 | 3300026311 | Anaerobic Biogas Reactor | MFKFLSTKDQLLEEKRKNEALQAQIKEQEDALIELAEIIAANEEAIVNG |
| Ga0209723_12810573 | 3300026311 | Anaerobic Biogas Reactor | MFKFLSTKEQLLEEKRKNEAFRSLVKDLEDAALELAEIVAANEEAIQEVQNG |
| Ga0209537_10128575 | 3300027510 | Biogas Fermentantion | VFKFLSTKEQLLEEKRKNEALRSLVKDLEDAALELAEIVAANEEAIQEVQNG |
| Ga0209537_10567803 | 3300027510 | Biogas Fermentantion | MFRFLGIREQLLEERRKNEVLQSLVNDLEDALVEIAEIAAENTEVEDDG |
| (restricted) Ga0255343_10362932 | 3300028561 | Wastewater | MFKFMSTKEQLLEEKRKNEALRSLVKDLEDAVLELAEIVAANEEAIQEVQNG |
| (restricted) Ga0255341_12048931 | 3300028570 | Wastewater | LSIREQLMEEKRKNEALRALNIDLENALLELAEIVAMNEVIIQEVTNG |
| (restricted) Ga0255340_12721201 | 3300028576 | Wastewater | MFKFLSIREQLMEEKRKNEALRALNIDLENALLELAEIVAMNEVIIQE |
| (restricted) Ga0255347_13947652 | 3300028593 | Wastewater | MFKFLSIREQLMEEKRKNEALRALNIDLENALLELAEIVAMNEVIIQEVTNG |
| Ga0265294_100483443 | 3300028602 | Groundwater | MEGVTSMFKFLDQREQLLEEKRKNEALQAQNKDLENALLELAEIVATNEAVLQEVQNG |
| Ga0265294_101304393 | 3300028602 | Groundwater | MFKFLPTREQLLEEKRKNEALRSLVKDLEDAVIEIAGIVAANEEAVNNG |
| Ga0265294_101508882 | 3300028602 | Groundwater | MFKFLSTKEQILEEKRKNEVLRSLVKDLEDAALELAEIVAANEEAIQEVQNG |
| Ga0265294_102539393 | 3300028602 | Groundwater | MFKFLSIREQLLEERRRNEALKALNIDLENALLELAEIVAMNEVIIQEVTNG |
| Ga0265294_104042123 | 3300028602 | Groundwater | MFSYKGIKEQLQDERRKNEALQAQVKEQEDAIIELAAIVAANEEAINDG |
| Ga0265294_108525081 | 3300028602 | Groundwater | DMFKRLGTREQLQAEKIKNEALQALCKDLEDAVIELAEIAAANEEAIKEASING |
| ⦗Top⦘ |