


| Basic Information | |
|---|---|
| Family ID | F085239 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 111 |
| Average Sequence Length | 42 residues |
| Representative Sequence | HPRERVGELPPGVAYMPKPWQPLNVLIAAEQALASGRGN |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 111 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.83 % |
| % of genes near scaffold ends (potentially truncated) | 83.78 % |
| % of genes from short scaffolds (< 2000 bps) | 90.09 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (83.784 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (17.117 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.532 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.649 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.37% β-sheet: 0.00% Coil/Unstructured: 74.63% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 111 Family Scaffolds |
|---|---|---|
| PF03401 | TctC | 9.91 |
| PF12706 | Lactamase_B_2 | 9.01 |
| PF04392 | ABC_sub_bind | 5.41 |
| PF11154 | DUF2934 | 5.41 |
| PF00753 | Lactamase_B | 3.60 |
| PF13545 | HTH_Crp_2 | 2.70 |
| PF00072 | Response_reg | 1.80 |
| PF12847 | Methyltransf_18 | 0.90 |
| PF00343 | Phosphorylase | 0.90 |
| PF13340 | DUF4096 | 0.90 |
| PF00989 | PAS | 0.90 |
| PF05726 | Pirin_C | 0.90 |
| PF13701 | DDE_Tnp_1_4 | 0.90 |
| PF06912 | DUF1275 | 0.90 |
| PF03797 | Autotransporter | 0.90 |
| PF00583 | Acetyltransf_1 | 0.90 |
| PF13358 | DDE_3 | 0.90 |
| PF13185 | GAF_2 | 0.90 |
| COG ID | Name | Functional Category | % Frequency in 111 Family Scaffolds |
|---|---|---|---|
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 9.91 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 5.41 |
| COG0058 | Glucan phosphorylase | Carbohydrate transport and metabolism [G] | 0.90 |
| COG1741 | Redox-sensitive bicupin YhaK, pirin superfamily | General function prediction only [R] | 0.90 |
| COG3619 | Uncharacterized membrane protein YoaK, UPF0700 family | Function unknown [S] | 0.90 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.78 % |
| Unclassified | root | N/A | 16.22 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352025|deepsgr__Contig_73559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1205 | Open in IMG/M |
| 3300000890|JGI11643J12802_12193050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1468 | Open in IMG/M |
| 3300000955|JGI1027J12803_101500061 | Not Available | 501 | Open in IMG/M |
| 3300000955|JGI1027J12803_101952455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae | 557 | Open in IMG/M |
| 3300000956|JGI10216J12902_118243602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae | 1515 | Open in IMG/M |
| 3300002155|JGI24033J26618_1015792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 935 | Open in IMG/M |
| 3300005093|Ga0062594_101903367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 631 | Open in IMG/M |
| 3300005093|Ga0062594_101987528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium YIM 77505 | 621 | Open in IMG/M |
| 3300005172|Ga0066683_10840023 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300005332|Ga0066388_101085568 | Not Available | 1353 | Open in IMG/M |
| 3300005332|Ga0066388_101340771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1237 | Open in IMG/M |
| 3300005332|Ga0066388_102736819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 900 | Open in IMG/M |
| 3300005332|Ga0066388_103274674 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300005436|Ga0070713_100666608 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300005446|Ga0066686_10504533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 824 | Open in IMG/M |
| 3300005457|Ga0070662_100992795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 718 | Open in IMG/M |
| 3300005548|Ga0070665_101505379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 681 | Open in IMG/M |
| 3300005764|Ga0066903_100646762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1847 | Open in IMG/M |
| 3300005764|Ga0066903_102044316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1101 | Open in IMG/M |
| 3300005843|Ga0068860_102816134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 504 | Open in IMG/M |
| 3300006914|Ga0075436_101354688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 539 | Open in IMG/M |
| 3300007258|Ga0099793_10537949 | Not Available | 582 | Open in IMG/M |
| 3300009012|Ga0066710_104863154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 502 | Open in IMG/M |
| 3300009137|Ga0066709_100831124 | All Organisms → cellular organisms → Bacteria | 1341 | Open in IMG/M |
| 3300009137|Ga0066709_100877970 | All Organisms → cellular organisms → Bacteria | 1305 | Open in IMG/M |
| 3300009137|Ga0066709_104122615 | Not Available | 529 | Open in IMG/M |
| 3300009143|Ga0099792_10192013 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1156 | Open in IMG/M |
| 3300009143|Ga0099792_10627865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 688 | Open in IMG/M |
| 3300009156|Ga0111538_10624904 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1366 | Open in IMG/M |
| 3300010043|Ga0126380_11884554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 543 | Open in IMG/M |
| 3300010046|Ga0126384_11772380 | Not Available | 585 | Open in IMG/M |
| 3300010048|Ga0126373_11253135 | Not Available | 808 | Open in IMG/M |
| 3300010048|Ga0126373_11953441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 649 | Open in IMG/M |
| 3300010147|Ga0126319_1125370 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1156 | Open in IMG/M |
| 3300010335|Ga0134063_10376080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 693 | Open in IMG/M |
| 3300011270|Ga0137391_11429083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 537 | Open in IMG/M |
| 3300012096|Ga0137389_10158318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1860 | Open in IMG/M |
| 3300012096|Ga0137389_11011797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 712 | Open in IMG/M |
| 3300012198|Ga0137364_11125811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 590 | Open in IMG/M |
| 3300012201|Ga0137365_10553618 | Not Available | 844 | Open in IMG/M |
| 3300012201|Ga0137365_10844439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 669 | Open in IMG/M |
| 3300012206|Ga0137380_11274871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 620 | Open in IMG/M |
| 3300012208|Ga0137376_10930267 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300012210|Ga0137378_11385204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 617 | Open in IMG/M |
| 3300012211|Ga0137377_11439066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 617 | Open in IMG/M |
| 3300012212|Ga0150985_103486002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1000 | Open in IMG/M |
| 3300012349|Ga0137387_11140788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 553 | Open in IMG/M |
| 3300012361|Ga0137360_11036709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 708 | Open in IMG/M |
| 3300012362|Ga0137361_11786531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → unclassified Microvirga → Microvirga sp. HBU65207 | 533 | Open in IMG/M |
| 3300012363|Ga0137390_10515653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1168 | Open in IMG/M |
| 3300012532|Ga0137373_10640109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 798 | Open in IMG/M |
| 3300012911|Ga0157301_10180334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 696 | Open in IMG/M |
| 3300012957|Ga0164303_10272219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 983 | Open in IMG/M |
| 3300012961|Ga0164302_10510892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 850 | Open in IMG/M |
| 3300012984|Ga0164309_11863520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 516 | Open in IMG/M |
| 3300012985|Ga0164308_12271668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 505 | Open in IMG/M |
| 3300012987|Ga0164307_11582651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 555 | Open in IMG/M |
| 3300013297|Ga0157378_11651153 | Not Available | 687 | Open in IMG/M |
| 3300013297|Ga0157378_12927137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 529 | Open in IMG/M |
| 3300013308|Ga0157375_13473695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 524 | Open in IMG/M |
| 3300015371|Ga0132258_10068146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 8239 | Open in IMG/M |
| 3300015371|Ga0132258_12543580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1280 | Open in IMG/M |
| 3300015372|Ga0132256_100090872 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2949 | Open in IMG/M |
| 3300015373|Ga0132257_101414393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 885 | Open in IMG/M |
| 3300015374|Ga0132255_100213001 | Not Available | 2739 | Open in IMG/M |
| 3300016357|Ga0182032_10298852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1270 | Open in IMG/M |
| 3300016357|Ga0182032_10387420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 1127 | Open in IMG/M |
| 3300016357|Ga0182032_11582850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 570 | Open in IMG/M |
| 3300016371|Ga0182034_10539457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 978 | Open in IMG/M |
| 3300016387|Ga0182040_10356223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1136 | Open in IMG/M |
| 3300017792|Ga0163161_11353481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 620 | Open in IMG/M |
| 3300017997|Ga0184610_1035576 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1419 | Open in IMG/M |
| 3300018083|Ga0184628_10378127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 741 | Open in IMG/M |
| 3300018431|Ga0066655_10327434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1002 | Open in IMG/M |
| 3300018468|Ga0066662_12946557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 506 | Open in IMG/M |
| 3300019883|Ga0193725_1137228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 540 | Open in IMG/M |
| 3300020001|Ga0193731_1084397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 826 | Open in IMG/M |
| 3300021344|Ga0193719_10401678 | Not Available | 564 | Open in IMG/M |
| 3300025899|Ga0207642_10032297 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2202 | Open in IMG/M |
| 3300026023|Ga0207677_10490458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1060 | Open in IMG/M |
| 3300026547|Ga0209156_10049778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2232 | Open in IMG/M |
| 3300027654|Ga0209799_1037003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → Reyranella soli | 1086 | Open in IMG/M |
| 3300027903|Ga0209488_10316197 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1164 | Open in IMG/M |
| 3300028719|Ga0307301_10048330 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1306 | Open in IMG/M |
| 3300028720|Ga0307317_10027517 | All Organisms → cellular organisms → Bacteria | 1762 | Open in IMG/M |
| 3300028787|Ga0307323_10072690 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1223 | Open in IMG/M |
| 3300028790|Ga0307283_10101194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 753 | Open in IMG/M |
| 3300028802|Ga0307503_10301945 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 803 | Open in IMG/M |
| 3300028810|Ga0307294_10010363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2305 | Open in IMG/M |
| 3300031093|Ga0308197_10035099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1206 | Open in IMG/M |
| 3300031231|Ga0170824_108023199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 923 | Open in IMG/M |
| 3300031545|Ga0318541_10336761 | Not Available | 842 | Open in IMG/M |
| 3300031561|Ga0318528_10457686 | Not Available | 685 | Open in IMG/M |
| 3300031572|Ga0318515_10213604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1034 | Open in IMG/M |
| 3300031572|Ga0318515_10723858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 526 | Open in IMG/M |
| 3300031668|Ga0318542_10715254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 524 | Open in IMG/M |
| 3300031668|Ga0318542_10717958 | Not Available | 523 | Open in IMG/M |
| 3300031719|Ga0306917_10235777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 1397 | Open in IMG/M |
| 3300031764|Ga0318535_10370295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 640 | Open in IMG/M |
| 3300031768|Ga0318509_10399756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 768 | Open in IMG/M |
| 3300031794|Ga0318503_10021456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1824 | Open in IMG/M |
| 3300031912|Ga0306921_10675875 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1188 | Open in IMG/M |
| 3300031941|Ga0310912_11080672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 613 | Open in IMG/M |
| 3300032065|Ga0318513_10589284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 544 | Open in IMG/M |
| 3300032076|Ga0306924_10430778 | All Organisms → cellular organisms → Bacteria | 1508 | Open in IMG/M |
| 3300032076|Ga0306924_10855962 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 16.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.01% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.31% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.31% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.41% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.60% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.60% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.70% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.80% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.80% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.90% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.90% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.90% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.90% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.90% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.90% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.90% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.90% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.90% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Host-Associated | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028790 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deepsgr_01014640 | 2199352025 | Soil | SLPLGLPRERVRDLPLGVDYIAKPWQPLNVLIAAEQALASELIR |
| JGI11643J12802_121930503 | 3300000890 | Soil | TSGHPRERYRDLPAGVAYMPKPWQPLNILMFAERALASG* |
| JGI1027J12803_1015000611 | 3300000955 | Soil | RVRELPPGVAYMSKPWPPLSVLMAAERALASPPGR* |
| JGI1027J12803_1019524552 | 3300000955 | Soil | RIRELPPGVAYMPKPWQPLNVLIAAEQASAPARHG* |
| JGI10216J12902_1182436021 | 3300000956 | Soil | KMRWPLLPVILTSGHPRERVGELPPDVAYMPKPCMPKPWQPLNVLIAAEEALATRV* |
| JGI24033J26618_10157922 | 3300002155 | Corn, Switchgrass And Miscanthus Rhizosphere | NIGHPLLSGHPREHGGELPPLVGYMPKPWQPLNVLIAAERALASARSG* |
| Ga0062594_1019033671 | 3300005093 | Soil | LPMVLTSGHPCERAGDLPLGVGFMPKPWQPINVLIAAEKALASAR* |
| Ga0062594_1019875281 | 3300005093 | Soil | MILTSGHPREHGGELPPLVGYMPKPWQPLNVLIAAERALASARSG* |
| Ga0066683_108400231 | 3300005172 | Soil | LPVILTSGHPRERVGELPPGVAYMSKPWQPLNVLIAAEQALASGRGN* |
| Ga0066388_1010855681 | 3300005332 | Tropical Forest Soil | VVLTSGCPRECVRELPAGVVYISKPWQPLDVLVTAEQALAYARGAYARG* |
| Ga0066388_1013407711 | 3300005332 | Tropical Forest Soil | SGYPRESGGELPPGVAYMPKPWQPLNVLMAAEQALASRV* |
| Ga0066388_1027368191 | 3300005332 | Tropical Forest Soil | ILTSGLPRARVGDLPLGVGYMAKPWQPLDVLIAAKQALASRL* |
| Ga0066388_1032746741 | 3300005332 | Tropical Forest Soil | LITNSRLSSRERVGELAPGVVYMPKPWQPLNVLIAAEQALASRL* |
| Ga0070713_1006666082 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | ERFGDLPPGVVYMPKPWQPLNVIMIAEQALSCNRGYRSA* |
| Ga0066686_105045331 | 3300005446 | Soil | PLLPVILTSGHPCERVGKLPPGVAYMRKPWQPLNVLIAAEQALASGRAN* |
| Ga0070662_1009927951 | 3300005457 | Corn Rhizosphere | SGHPCERAGDLPLGVGFMPKPWQPINVLIAAEKALASAR* |
| Ga0070665_1015053792 | 3300005548 | Switchgrass Rhizosphere | VILTSRLPRERVRDLPLGGDYIAKPWQPLNVLIAAEQALASGLIR* |
| Ga0066903_1006467623 | 3300005764 | Tropical Forest Soil | DRIGELPPGVAYMRKPWQPLNMLIVAEQALASRV* |
| Ga0066903_1020443161 | 3300005764 | Tropical Forest Soil | LPVILTSGYPRESGGELPPGVAYMPKPWQPLNVLMAAEQALASRG* |
| Ga0068860_1028161342 | 3300005843 | Switchgrass Rhizosphere | GHPLEHIRELPPGVAYMPKPWQPLNVLIAAEQASAPARHG* |
| Ga0075436_1013546881 | 3300006914 | Populus Rhizosphere | PRERYRDLPAGVAYMPKPWQPLNILMFAERALASG* |
| Ga0099793_105379491 | 3300007258 | Vadose Zone Soil | IRELPPGVAYVPKPWQPLNVLIAAEQALAFGRGN* |
| Ga0066710_1048631541 | 3300009012 | Grasslands Soil | LPMMLTSGHPLERIRELPPGVAYMPKPWQPLNVLIATEQALASGQGN |
| Ga0066709_1008311243 | 3300009137 | Grasslands Soil | ERGGELPPGVGYMPKPWQPLNVLIAAEEALAFGRSN* |
| Ga0066709_1008779701 | 3300009137 | Grasslands Soil | CERVGGLPAGVGYMPKPWQPLNVLIAAEQALASARRG* |
| Ga0066709_1041226152 | 3300009137 | Grasslands Soil | VILTSGHPCERVGKLPPGVAYMRKPWQPLNVLIAAEQALASSGRAN* |
| Ga0099792_101920131 | 3300009143 | Vadose Zone Soil | REHGGELPPLVGYMPKPWQPLNVLIAAERALASGRSG* |
| Ga0099792_106278652 | 3300009143 | Vadose Zone Soil | SGHPRERVGELPPGVAYMPKPWQPLNVLIATEQALASGRGN* |
| Ga0111538_106249042 | 3300009156 | Populus Rhizosphere | LPMILTSGHPREHGGELPPLVGYMPKPWQPLNVLIAAERALASARSG* |
| Ga0126380_118845542 | 3300010043 | Tropical Forest Soil | PVILTSGHPRERVGELAPGVVYMPKPWKPLNVLIAAEQALASRL* |
| Ga0126384_117723801 | 3300010046 | Tropical Forest Soil | HVRDLPRGVDYMPKPWQPLNVLIAAEQALASGRS* |
| Ga0126373_112531351 | 3300010048 | Tropical Forest Soil | ESGGELPPGVAYMPKPWQPLNALMAAEQALASRV* |
| Ga0126373_119534411 | 3300010048 | Tropical Forest Soil | RFFPWILTSGLPRERVGQLPPGVGPWQPLNVLIAAGEAIERRS* |
| Ga0126319_11253702 | 3300010147 | Soil | MILTSGHPREHGGELPPLVGYMPKPWQPLNVLIAAERALASGRSG* |
| Ga0134063_103760801 | 3300010335 | Grasslands Soil | TSGHSRERVGGLPAGVGYMAKPWQPLNVLIAAEQALASARRG* |
| Ga0134121_108031081 | 3300010401 | Terrestrial Soil | RDRVGHLPLGVGYMAKPWQPLDVLIAAKQALASERR* |
| Ga0137391_114290831 | 3300011270 | Vadose Zone Soil | HPRERVGELPPGVAYMPKPWQPLNVLIAAEQALASGRGN* |
| Ga0137389_101583183 | 3300012096 | Vadose Zone Soil | MILTSGHPLERIRELPPGVAYMPKPWQPLNVLIAAEQAADR* |
| Ga0137389_110117973 | 3300012096 | Vadose Zone Soil | KLRWPLLPMILTSGHPLERIRELPPGVAYMPKPWQPLAAEQALASRV* |
| Ga0137364_111258111 | 3300012198 | Vadose Zone Soil | HPLERIRELPPGVAYMPKPWQPLNVLIAAERALPSRGDGPR* |
| Ga0137365_105536181 | 3300012201 | Vadose Zone Soil | HVGELPPGVAYLPKPWQPLSVLIAAEQALGSLRHS* |
| Ga0137365_108444392 | 3300012201 | Vadose Zone Soil | SGFPCERVGDLPLGVAYMPKPWQPLNVLIAAEQALASARPG* |
| Ga0137380_112748711 | 3300012206 | Vadose Zone Soil | ILTSGHPLERIRELPPGVAYMPKPWQPLNVLIATEQALAFRV* |
| Ga0137376_109302672 | 3300012208 | Vadose Zone Soil | LPMILTSGHPLKRIRELPPGVAFMPKPWKPLNVLIAAEQALASGRGN* |
| Ga0137378_113852043 | 3300012210 | Vadose Zone Soil | ILTSGHPLERIRELPPGVAYMPKPWQPLNVLIAAERALPSRGDAPR* |
| Ga0137377_114390662 | 3300012211 | Vadose Zone Soil | PMILTSGHPLERIRELPPGVAYMPKPWQPLNVLIATEQALAFRV* |
| Ga0150985_1034860021 | 3300012212 | Avena Fatua Rhizosphere | LTSGHSCERAGDLPPGVVYMPKPWQPLNVLMIAEQALSSSRGYRSP* |
| Ga0137387_111407881 | 3300012349 | Vadose Zone Soil | ERVGELPPGVAYMPKPWQPLNVLIAAEQALASARVG* |
| Ga0137360_110367092 | 3300012361 | Vadose Zone Soil | PIILTSGHPLKRIRELPPGVAYMPKPWKPLNVLIAAEQALASRRGN* |
| Ga0137361_117865312 | 3300012362 | Vadose Zone Soil | SGHPLERIRELPPGVAYMPKPWQPLNVLIATEQALHFGCDVRH* |
| Ga0137390_105156532 | 3300012363 | Vadose Zone Soil | ERVGELPPGVAYMPKPWQPLNVLIVAEQVLASGRY* |
| Ga0137373_106401091 | 3300012532 | Vadose Zone Soil | ILTSGHPLERIRELPPGVAYMPKPWQPLNVLIAAEQASAPARHG* |
| Ga0157301_101803342 | 3300012911 | Soil | MILTSGHPREHEGELPPLVGYMPKPWQPLNVLIAAERALASARSG* |
| Ga0164303_102722191 | 3300012957 | Soil | IRELPPGVAYMPKPWQPLNVLIAAEQASAPARHG* |
| Ga0164302_105108921 | 3300012961 | Soil | GHPRERFGDLPPGVVYMPKPWQPLNVIMIAEQALSCNRGYRSA* |
| Ga0164309_118635201 | 3300012984 | Soil | ERIRELPPGVAYMPKPWQPLNVLIATEQALAFRV* |
| Ga0164308_122716681 | 3300012985 | Soil | MILTSGHPLERIRELPPGVAYMPKPWQPLNVLIAAEQVLASRV* |
| Ga0164307_115826511 | 3300012987 | Soil | LPRERFRDLPLGVDYIAKPWHPFNVLITAEQALAPELSR* |
| Ga0157378_116511531 | 3300013297 | Miscanthus Rhizosphere | SELPRERVRDLPLGGDCIAKPWQPLNVLIAAEQALASGLIR* |
| Ga0157378_129271371 | 3300013297 | Miscanthus Rhizosphere | RAGDLPPGVVYMPKPWQPLNVLIIAEQALSSSCGYRSA* |
| Ga0157375_134736952 | 3300013308 | Miscanthus Rhizosphere | PLEHIRELPPGVAYMPKPWQPLNVLIAAEQASAPARHG* |
| Ga0132258_100681469 | 3300015371 | Arabidopsis Rhizosphere | SGHPRKRGRELPPGVAYISKPWQPLNVLMAAERALASPPGR* |
| Ga0132258_125435802 | 3300015371 | Arabidopsis Rhizosphere | MILTSGLPRERVRDLPVGVDYIAKPWHPLNVLITVEQALAPELIR* |
| Ga0132256_1000908721 | 3300015372 | Arabidopsis Rhizosphere | ILTSGLPRDRLRDLPFGVDYIAKPWQPLSLLIAAEQALASRPIR* |
| Ga0132257_1014143932 | 3300015373 | Arabidopsis Rhizosphere | SGHPREHGGGLPPLVGYMPKPWQPLNVLIAAERALASARSG* |
| Ga0132255_1002130011 | 3300015374 | Arabidopsis Rhizosphere | GRELPPGVAYISKPWQPLNVLMAAERALASPPGR* |
| Ga0182041_106597701 | 3300016294 | Soil | PRARVGDLPLGVGYMAKPWQPLDVLIAAKQALSSERR |
| Ga0182032_102988521 | 3300016357 | Soil | TSGHPLEHIRELPPGVAYMPKPWQPLNVLIAAEQALASRA |
| Ga0182032_103874203 | 3300016357 | Soil | MFGSASGHPRERIGELPPGVAYMPNPLQPLKALIAAEQTLASRV |
| Ga0182032_115828501 | 3300016357 | Soil | SGHPRERVGELPPGVAYMPKPWQPLQVLIAAEQALASRM |
| Ga0182034_105394573 | 3300016371 | Soil | PLEHIRELPPGVAYMPKPWQPLNVLIAAEQALASGQGN |
| Ga0182040_103562231 | 3300016387 | Soil | MFGSASGHPRERIGELPPGVAYMPKPWQPLTVLIAAEQALASRL |
| Ga0163161_113534811 | 3300017792 | Switchgrass Rhizosphere | SGLPRERVCDLPFGVDYIAKPWQPLNVLIAAEQALASGLIR |
| Ga0184610_10355761 | 3300017997 | Groundwater Sediment | TSGHPREHGGELPPLVGYMPKPWQPLNVLIAAERALASGRSG |
| Ga0184611_11000201 | 3300018067 | Groundwater Sediment | SGHPLDEHMRQFPPGVAYIPKPWQPLNLLVSAEEALALLH |
| Ga0184628_103781272 | 3300018083 | Groundwater Sediment | PLLPMILTSGHPREHGGELPPLVGYMPKPWQPLNVLIAAERALASARSG |
| Ga0066655_103274342 | 3300018431 | Grasslands Soil | ILTSGHPCERVGKLPPGVAYMRKPWQPLNVLIAAEQALASGRAN |
| Ga0066662_129465571 | 3300018468 | Grasslands Soil | VILTSGHPREHVGKLPPGVAYMPKPWQPLNVLIAAEQALASA |
| Ga0193725_11372282 | 3300019883 | Soil | TSGHPLERIRELPPGVAYMPKPWQPLNVLIAAEQASAPARHG |
| Ga0193731_10843971 | 3300020001 | Soil | ARERFGELPPGVVYLPKPWQPLNVLMIAEQALSSSRGYRSA |
| Ga0193719_104016781 | 3300021344 | Soil | HGGELPPLVGYMPKPWLPLNVLIAAERALASGRSG |
| Ga0207642_100322973 | 3300025899 | Miscanthus Rhizosphere | EHGGELPPLVGYMPKPWQPLNVLIAAERALASARSG |
| Ga0207677_104904582 | 3300026023 | Miscanthus Rhizosphere | VILTSRLPRERVRDLPLGVDYIAKPWQPLNVLIAAEQALASGLIR |
| Ga0209156_100497786 | 3300026547 | Soil | PVILTSGHPCERVGKLPPGVAYMRKPWQPLNVLIAAEQALASGRAN |
| Ga0209799_10370031 | 3300027654 | Tropical Forest Soil | GYPRESGGELPPGVAYMPKPWQPLNVLMAAEQALTSRV |
| Ga0209488_103161971 | 3300027903 | Vadose Zone Soil | REHGGELPPLVGYMPKPWQPLNVLIAAERALASGRSG |
| Ga0307301_100483301 | 3300028719 | Soil | LTSGHPREHGGELPPLVGYMPKPWQPLNVLIAAERALASARSG |
| Ga0307317_100275172 | 3300028720 | Soil | LTSGYPRERVRELPPGVAYMPKPWQPLNVLIAAEQARASAH |
| Ga0307318_101743531 | 3300028744 | Soil | TSGHPLDEHLRQFPPGVAYIPKPWQPLNLLVAAEEALASLH |
| Ga0307323_100726902 | 3300028787 | Soil | MILTSGHPREHGGELPPLVGYMPKPWQPLNVLIAAERALASGRSG |
| Ga0307283_101011942 | 3300028790 | Soil | LTSGHPRERFGELPPGVAYMPKPWQPLNVLMIAERALSSSRGYRSA |
| Ga0307287_102394932 | 3300028796 | Soil | HPLDEHLRQFPPGVAYIPKPWQPLNLLVAAEEALASLH |
| Ga0307503_103019451 | 3300028802 | Soil | REHGGELPPLVGYMPKPWQPLNVLIAAERALASARSG |
| Ga0307294_100103633 | 3300028810 | Soil | VLTSGHPRERFGELPPGVVYMPKPWQPLNVLMIAEQALSSSRGYRSA |
| Ga0308197_100350992 | 3300031093 | Soil | GELPPGVAYMPKPWQPLNVLMIAEQALSSSRGYRSA |
| Ga0170824_1080231992 | 3300031231 | Forest Soil | MILTSGLPRERVRDLPVGVDYIAKPWHPLNVLITVEQALAPE |
| Ga0318541_103367611 | 3300031545 | Soil | MFGSASGHPRERIGELPPGVAYMPKPLQPLKALIAAEQ |
| Ga0318528_104576863 | 3300031561 | Soil | MFGSASGHPRERIGELPPGVAYMPKPLQPLKALIAAEQTLA |
| Ga0318515_102136042 | 3300031572 | Soil | MFGSASGHPRERIGELPPGVAYMPKPLQPLKALIAAEQTLASRV |
| Ga0318515_107238582 | 3300031572 | Soil | LPMILTSGHPLEHIRELPPGVAYMPKPWQPLNVLIAAEQALASGQGN |
| Ga0318542_107152541 | 3300031668 | Soil | HPLEHIRELPPGVAYMPKPWQPLNVLIAAEQALASGQGN |
| Ga0318542_107179581 | 3300031668 | Soil | MFGSASGYPRERIGELPPGVAYMPNPLQPLKALIAAEQTLASRV |
| Ga0306917_102357772 | 3300031719 | Soil | MFGSASGYPRERIGELPPGVAYMPKPLQPLKALIAAEQTLASRV |
| Ga0318535_103702951 | 3300031764 | Soil | LPMILTSGHPLEHIRELPPGVAYMPKPWQPLNVLIAAEQALASRA |
| Ga0318509_103997562 | 3300031768 | Soil | GHPLEHIRELPPGVAYMPKPWQPLNVLIAAEQALASGQGN |
| Ga0318503_100214562 | 3300031794 | Soil | PRERVAELPPGVAYMRKPWHPFNVLIAAEQALASQV |
| Ga0306921_106758751 | 3300031912 | Soil | RERVGKLPPGVAYMPKPWQPLEVLIAAEQALASRV |
| Ga0310912_110806722 | 3300031941 | Soil | SGHPCERVGELPPNVAYMPKSWQPLKVLIAAEQALTSLCDAPALA |
| Ga0318513_105892841 | 3300032065 | Soil | LLPMILTSGHPLEHIRELPPGVAYMPKPWQPLNVLIAAEQALASGQGN |
| Ga0306924_104307782 | 3300032076 | Soil | LLPVILTSGLPRDRVGVLPLGVGYMAKPWQPLDVLIAAKQALSSERR |
| Ga0306924_108559623 | 3300032076 | Soil | ILTSGVPRDRVRDLPLGVGYMAKPWQPLDVLIAAKQALLSERR |
| ⦗Top⦘ |