


| Basic Information | |
|---|---|
| Family ID | F084863 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 112 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MTRTFGAALGVAIVLLFFASLTIEQNRVLTIARAAVGSHR |
| Number of Associated Samples | 86 |
| Number of Associated Scaffolds | 112 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 74.11 % |
| % of genes near scaffold ends (potentially truncated) | 25.00 % |
| % of genes from short scaffolds (< 2000 bps) | 86.61 % |
| Associated GOLD sequencing projects | 78 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.964 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (16.071 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.036 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (51.786 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 55.88% β-sheet: 0.00% Coil/Unstructured: 44.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 112 Family Scaffolds |
|---|---|---|
| PF04074 | DUF386 | 74.11 |
| PF06723 | MreB_Mbl | 5.36 |
| PF08281 | Sigma70_r4_2 | 0.89 |
| PF01740 | STAS | 0.89 |
| PF16864 | Dimerisation2 | 0.89 |
| PF05957 | DUF883 | 0.89 |
| PF03446 | NAD_binding_2 | 0.89 |
| PF13298 | LigD_N | 0.89 |
| COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
|---|---|---|---|
| COG2731 | Beta-galactosidase, beta subunit | Carbohydrate transport and metabolism [G] | 74.11 |
| COG1077 | Cell shape-determining ATPase MreB, actin-like superfamily | Cell cycle control, cell division, chromosome partitioning [D] | 5.36 |
| COG4575 | Membrane-anchored ribosome-binding protein ElaB, inhibits growth in stationary phase, YqjD/DUF883 family | Translation, ribosomal structure and biogenesis [J] | 0.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.96 % |
| Unclassified | root | N/A | 8.04 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2162886011|MRS1b_contig_472085 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 2162886012|MBSR1b_contig_2865279 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 2228664021|ICCgaii200_c0780051 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1268 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101587588 | All Organisms → cellular organisms → Bacteria | 2928 | Open in IMG/M |
| 3300000789|JGI1027J11758_12471337 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300000890|JGI11643J12802_10240036 | All Organisms → cellular organisms → Bacteria | 2295 | Open in IMG/M |
| 3300000955|JGI1027J12803_101371222 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300000956|JGI10216J12902_100328352 | All Organisms → cellular organisms → Bacteria | 2726 | Open in IMG/M |
| 3300000956|JGI10216J12902_104450572 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1130 | Open in IMG/M |
| 3300001431|F14TB_100405290 | All Organisms → cellular organisms → Bacteria | 1622 | Open in IMG/M |
| 3300001431|F14TB_101402675 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Lignipirellula → Lignipirellula cremea | 887 | Open in IMG/M |
| 3300002568|C688J35102_120827446 | All Organisms → cellular organisms → Bacteria | 1715 | Open in IMG/M |
| 3300003163|Ga0006759J45824_1046381 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300003267|soilL1_10116740 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2463 | Open in IMG/M |
| 3300004114|Ga0062593_100007077 | All Organisms → cellular organisms → Bacteria | 4877 | Open in IMG/M |
| 3300004114|Ga0062593_100071213 | All Organisms → cellular organisms → Bacteria | 2300 | Open in IMG/M |
| 3300004114|Ga0062593_100222536 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1528 | Open in IMG/M |
| 3300004114|Ga0062593_100262432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1438 | Open in IMG/M |
| 3300004114|Ga0062593_100283582 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1397 | Open in IMG/M |
| 3300004114|Ga0062593_100367108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1268 | Open in IMG/M |
| 3300004114|Ga0062593_101061845 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300004156|Ga0062589_101855557 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300004156|Ga0062589_102669150 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300004157|Ga0062590_100084706 | All Organisms → cellular organisms → Bacteria | 1938 | Open in IMG/M |
| 3300004479|Ga0062595_100183001 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Candidatus Laterigemmans → Candidatus Laterigemmans baculatus | 1271 | Open in IMG/M |
| 3300005093|Ga0062594_100082658 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Lignipirellula → Lignipirellula cremea | 1830 | Open in IMG/M |
| 3300005093|Ga0062594_100192848 | All Organisms → cellular organisms → Bacteria | 1408 | Open in IMG/M |
| 3300005289|Ga0065704_10602976 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300005290|Ga0065712_10365477 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Candidatus Laterigemmans → Candidatus Laterigemmans baculatus | 769 | Open in IMG/M |
| 3300005293|Ga0065715_10217466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1286 | Open in IMG/M |
| 3300005293|Ga0065715_10242073 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1196 | Open in IMG/M |
| 3300005293|Ga0065715_10319479 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| 3300005293|Ga0065715_10871568 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Candidatus Laterigemmans → Candidatus Laterigemmans baculatus | 584 | Open in IMG/M |
| 3300005336|Ga0070680_100413114 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1151 | Open in IMG/M |
| 3300005347|Ga0070668_101055483 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 732 | Open in IMG/M |
| 3300005451|Ga0066681_10039789 | All Organisms → cellular organisms → Bacteria | 2526 | Open in IMG/M |
| 3300005456|Ga0070678_101878703 | Not Available | 565 | Open in IMG/M |
| 3300005456|Ga0070678_102339630 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300005457|Ga0070662_100822399 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Lignipirellula → Lignipirellula cremea | 790 | Open in IMG/M |
| 3300005471|Ga0070698_102024394 | Not Available | 529 | Open in IMG/M |
| 3300005615|Ga0070702_100156991 | All Organisms → cellular organisms → Bacteria | 1466 | Open in IMG/M |
| 3300005713|Ga0066905_102023262 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300005764|Ga0066903_108156534 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 536 | Open in IMG/M |
| 3300005840|Ga0068870_11108472 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300005841|Ga0068863_100796648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 942 | Open in IMG/M |
| 3300006046|Ga0066652_100085127 | All Organisms → cellular organisms → Bacteria | 2507 | Open in IMG/M |
| 3300006844|Ga0075428_100002577 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 19701 | Open in IMG/M |
| 3300006844|Ga0075428_100545045 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1240 | Open in IMG/M |
| 3300006854|Ga0075425_100026146 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6443 | Open in IMG/M |
| 3300006854|Ga0075425_102552452 | Not Available | 565 | Open in IMG/M |
| 3300006871|Ga0075434_100797790 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
| 3300006918|Ga0079216_10516775 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300009012|Ga0066710_101219478 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1166 | Open in IMG/M |
| 3300009094|Ga0111539_10036885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 5907 | Open in IMG/M |
| 3300009098|Ga0105245_11026683 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 869 | Open in IMG/M |
| 3300009162|Ga0075423_11712317 | Not Available | 677 | Open in IMG/M |
| 3300009166|Ga0105100_10189342 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1225 | Open in IMG/M |
| 3300011119|Ga0105246_10610226 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
| 3300012201|Ga0137365_10276865 | All Organisms → cellular organisms → Bacteria | 1245 | Open in IMG/M |
| 3300012208|Ga0137376_10038191 | All Organisms → cellular organisms → Bacteria | 3861 | Open in IMG/M |
| 3300012212|Ga0150985_105128096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1933 | Open in IMG/M |
| 3300012212|Ga0150985_110987346 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300012212|Ga0150985_112364134 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300012469|Ga0150984_113705502 | Not Available | 500 | Open in IMG/M |
| 3300012469|Ga0150984_116892137 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300012469|Ga0150984_117178452 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 595 | Open in IMG/M |
| 3300012469|Ga0150984_121424933 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300012944|Ga0137410_10471908 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1022 | Open in IMG/M |
| 3300012951|Ga0164300_10308577 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 831 | Open in IMG/M |
| 3300012961|Ga0164302_10409068 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Candidatus Laterigemmans → Candidatus Laterigemmans baculatus | 928 | Open in IMG/M |
| 3300012989|Ga0164305_11375765 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Lignipirellula → Lignipirellula cremea | 620 | Open in IMG/M |
| 3300012989|Ga0164305_11519668 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Lignipirellula → Lignipirellula cremea | 594 | Open in IMG/M |
| 3300014745|Ga0157377_10815389 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300015371|Ga0132258_13424101 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Lignipirellula → Lignipirellula cremea | 1088 | Open in IMG/M |
| 3300015372|Ga0132256_102455749 | Not Available | 623 | Open in IMG/M |
| 3300015373|Ga0132257_101185045 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
| 3300018066|Ga0184617_1114043 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300018084|Ga0184629_10015341 | All Organisms → cellular organisms → Bacteria | 3068 | Open in IMG/M |
| 3300018422|Ga0190265_10571487 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1248 | Open in IMG/M |
| 3300018429|Ga0190272_11786947 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Lignipirellula → Lignipirellula cremea | 641 | Open in IMG/M |
| 3300018433|Ga0066667_11308402 | Not Available | 633 | Open in IMG/M |
| 3300018476|Ga0190274_10097474 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2325 | Open in IMG/M |
| 3300018476|Ga0190274_10955674 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300019377|Ga0190264_11513665 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300020006|Ga0193735_1045671 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1312 | Open in IMG/M |
| 3300021339|Ga0193706_1196432 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 545 | Open in IMG/M |
| 3300021972|Ga0193737_1057966 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Lignipirellula → Lignipirellula cremea | 550 | Open in IMG/M |
| 3300022534|Ga0224452_1070838 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Lignipirellula → Lignipirellula cremea | 1051 | Open in IMG/M |
| 3300022756|Ga0222622_10060483 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2183 | Open in IMG/M |
| 3300022756|Ga0222622_10115590 | All Organisms → cellular organisms → Bacteria | 1677 | Open in IMG/M |
| 3300022756|Ga0222622_10318947 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Lignipirellula → Lignipirellula cremea | 1075 | Open in IMG/M |
| 3300022880|Ga0247792_1090929 | Not Available | 617 | Open in IMG/M |
| 3300025908|Ga0207643_11031761 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300025917|Ga0207660_11106006 | Not Available | 646 | Open in IMG/M |
| 3300025923|Ga0207681_11266530 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300025926|Ga0207659_10528754 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Lignipirellula → Lignipirellula cremea | 1001 | Open in IMG/M |
| 3300025937|Ga0207669_11458200 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300025938|Ga0207704_11232848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 638 | Open in IMG/M |
| 3300025940|Ga0207691_10319977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1330 | Open in IMG/M |
| 3300025961|Ga0207712_11117955 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300027552|Ga0209982_1041163 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 737 | Open in IMG/M |
| 3300027907|Ga0207428_10156887 | All Organisms → cellular organisms → Bacteria | 1730 | Open in IMG/M |
| 3300028380|Ga0268265_10242955 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1590 | Open in IMG/M |
| 3300028381|Ga0268264_10697832 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1008 | Open in IMG/M |
| 3300028784|Ga0307282_10071200 | All Organisms → cellular organisms → Bacteria | 1581 | Open in IMG/M |
| 3300028802|Ga0307503_10402409 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300028828|Ga0307312_10950522 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 569 | Open in IMG/M |
| 3300031716|Ga0310813_10583185 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Lignipirellula → Lignipirellula cremea | 987 | Open in IMG/M |
| 3300031716|Ga0310813_11051511 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300031858|Ga0310892_10406752 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Lignipirellula → Lignipirellula cremea | 887 | Open in IMG/M |
| 3300034644|Ga0370548_092774 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Lignipirellula → Lignipirellula cremea | 601 | Open in IMG/M |
| 3300034661|Ga0314782_149217 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Candidatus Laterigemmans → Candidatus Laterigemmans baculatus | 572 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 16.07% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 11.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.04% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.14% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 6.25% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 4.46% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.57% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.68% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.68% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 2.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.68% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.79% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.79% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.79% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.79% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.79% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.79% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.89% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.89% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
| 3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300021339 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c1 | Environmental | Open in IMG/M |
| 3300021972 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2m2 | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300022880 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S106-311C-6 | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300034644 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_123 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034661 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| MRS1b_0766.00000050 | 2162886011 | Miscanthus Rhizosphere | MTRTFGRTFGAALGVLFVLLFFASLTLEQNRVLSLARATVGSHR |
| MBSR1b_0187.00007870 | 2162886012 | Miscanthus Rhizosphere | MTRTFGRTFGAALGVLFVLLFFASLTIEQNRVLSIARASVGSHR |
| ICCgaii200_07800512 | 2228664021 | Soil | MTRTLGAAIGVAVILLFFASLTFEQNRVLTMARAAVGSHR |
| INPhiseqgaiiFebDRAFT_1015875884 | 3300000364 | Soil | MNRTFGRTFGAALGVVIVLLFFASLTIEQNRVVSIARATVGSHR* |
| JGI1027J11758_124713373 | 3300000789 | Soil | AALGVVIVLLFFASLTIEQNRVVSIARATVGSHR* |
| JGI11643J12802_102400363 | 3300000890 | Soil | MTRTLGAAIGVAVILLFFASLTFEQNRVLTMARAAVGSHR* |
| JGI1027J12803_1013712222 | 3300000955 | Soil | PRGGVITMNRTFGRTFGAALGVVIVLLFFASLTIEQNRVVSIARATVGSHR* |
| JGI10216J12902_1003283523 | 3300000956 | Soil | MTRTLGAALGIVIVVLFFASLNTEQNRVVAVARAAAASHK* |
| JGI10216J12902_1044505721 | 3300000956 | Soil | MTRTLGAALGVVIIILFFASLNTEQNRVVAFARASAASQK* |
| F14TB_1004052904 | 3300001431 | Soil | MSRTFGRTFGAALGVLFVLLFFASLTLEQNRVLSIARAAVGSHR* |
| F14TB_1014026753 | 3300001431 | Soil | MTRTLGAAIGVAIILLFFASLTFEQNRVLTIARATAGSHR* |
| C688J35102_1208274462 | 3300002568 | Soil | MTRTLGAALGVAIVLLFFASLTFEQHRVLTIAHATVGSHR* |
| Ga0006759J45824_10463811 | 3300003163 | Avena Fatua Rhizosphere | GVCMTRTLGAALGVAIVLLFFASLTIEQNRVLTIARAAVGSHR* |
| soilL1_101167404 | 3300003267 | Sugarcane Root And Bulk Soil | MTRTLGAALGVAIVLLFFASLTFEQNRVTSLIARATQSARR* |
| Ga0062593_1000070775 | 3300004114 | Soil | MTRTFGRTFGAALGVLFVLLFFASLTLEQNRVLSLARATVGSHR* |
| Ga0062593_1000712133 | 3300004114 | Soil | MTRTLGAAIGVAVVLLFFASLTFEQNRVLTIARAAVGSHR* |
| Ga0062593_1002225362 | 3300004114 | Soil | MTRTFGAALGVVVVLLFFASLTVEQNRVVSMARATVGWHK* |
| Ga0062593_1002624323 | 3300004114 | Soil | PNKTLWRCNAMTRTLGAAIGVAVVLLFFASLTFEQNRVLTIARSAVGSHR* |
| Ga0062593_1002835822 | 3300004114 | Soil | MTRTFGAALGVVVVLLFFASLTFEQNRVVSYARAAAMARK* |
| Ga0062593_1003671083 | 3300004114 | Soil | GRTFGAALGVLFVLLFFASLTIEQNRVLSIARASVGSHR* |
| Ga0062593_1010618451 | 3300004114 | Soil | GRTFGAALGVLFVLLFFASLTIEQNRVLSIARATVGSHR* |
| Ga0062589_1018555572 | 3300004156 | Soil | RTFGRTFGAALGVLFVLLFFASLTIEQNRVLSIARASVGSHR* |
| Ga0062589_1026691501 | 3300004156 | Soil | MTRTLGAAIGVAVVLLFFASLTFEQNRVLTIARSAVGSHR* |
| Ga0062590_1000847062 | 3300004157 | Soil | MTRTFGRTFGAALGVLFVLLFFASLTIEQNRVLSIARATVGSHR* |
| Ga0062595_1001830012 | 3300004479 | Soil | MTRTLGAALGVAIVLLFFASLTFEQNRVLTIARATASSHR* |
| Ga0062594_1000826583 | 3300005093 | Soil | LLDYFPNKTLWRCNAMTRTLGAAIGVAVVLLFFASLTFEQNRVLTIARSAVGSHR* |
| Ga0062594_1001928483 | 3300005093 | Soil | MNRTFGRTFGAALGVLFVLLFFASLTLEQNRVLSIARATVGSHR* |
| Ga0065704_106029762 | 3300005289 | Switchgrass Rhizosphere | MTRTLGAALGVAIVLLFFASLTFEQNRAVTLARSVATSHR* |
| Ga0065712_103654772 | 3300005290 | Miscanthus Rhizosphere | MTRTLGAALGVVIVLLFFASLNVEQNRVVAMARAVVGSQK* |
| Ga0065715_102174662 | 3300005293 | Miscanthus Rhizosphere | MTRTLGAALGVAIVLLFFASLTFEQNRVLTIARTAVGSHR* |
| Ga0065715_102420732 | 3300005293 | Miscanthus Rhizosphere | MTRTLGAALGVAIVLLFFASLTFEQNRVLTIARATVGSHR* |
| Ga0065715_103194792 | 3300005293 | Miscanthus Rhizosphere | MTRTFGRTFGAALGVLFVLLFFASLTIEQNRVLSIARASVGSHR* |
| Ga0065715_108715682 | 3300005293 | Miscanthus Rhizosphere | MTRTLGAALGVVIIILFFASLNTEQNRVVAFARSSVASQK* |
| Ga0070680_1004131142 | 3300005336 | Corn Rhizosphere | MTRTLGAALGVAIVLLFFASLTFEQNRVLTIARTAVGSRR* |
| Ga0070668_1010554831 | 3300005347 | Switchgrass Rhizosphere | MTRTFGRTFGAALGVLFVLLFFASLTLEQNRVLSIARAAVGSHR* |
| Ga0066681_100397892 | 3300005451 | Soil | MTRTVGAAIGVVVIVLFFASLTIEQNRALTLARAPIASHR* |
| Ga0070678_1018787032 | 3300005456 | Miscanthus Rhizosphere | MTRTLGAALGVVVVLLFFASLTIEQNRVLSMARATVGWQK* |
| Ga0070678_1023396301 | 3300005456 | Miscanthus Rhizosphere | PIGKSLWRCNSMTRTFGRTFGAALGVLFVLLFFASLTIEQNRVLSIARASVGSHR* |
| Ga0070662_1008223992 | 3300005457 | Corn Rhizosphere | MTRTLGAALGVAIVLLFFASLTFEQNRVLTIARATVSSHR* |
| Ga0070698_1020243942 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRTFGAALGVVVVLLFFASLTFEQNRVVSFARAAAIPHK* |
| Ga0070702_1001569911 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | PIGKSLWRCNSMTRTFGRTFGAALGVLFVLLFFASLTIEQNRVLSIARATVGSHR* |
| Ga0066905_1020232622 | 3300005713 | Tropical Forest Soil | RTFGRTFGAALGVLFVLLFFASLTIEQNRVLSIARATVGSHR* |
| Ga0066903_1081565342 | 3300005764 | Tropical Forest Soil | MTRTFGAALGVVIVLLFFASLTIEQNRVVTMARTTVGAHR* |
| Ga0068870_111084722 | 3300005840 | Miscanthus Rhizosphere | MSRTFGRTFGAALGVLFVLLFFASLTIEQNRVLSIARASVGSHR* |
| Ga0068863_1007966482 | 3300005841 | Switchgrass Rhizosphere | MTRTFGRTFGAALGVLFVLLFFASLTLEQNRVLSLARATVGSH |
| Ga0066652_1000851273 | 3300006046 | Soil | MTRTLGAALGVAIVLLFFASLTIEQNRVLTIARAAVGSHR* |
| Ga0075428_10000257712 | 3300006844 | Populus Rhizosphere | MTRTLGAAIGVAVILLFFASLTFEQNRVLTIARAAVGSHR* |
| Ga0075428_1005450452 | 3300006844 | Populus Rhizosphere | MTRTLGAALGVAIVLLFFASLTFEQNRAVTLARSVVTSHR* |
| Ga0075425_1000261466 | 3300006854 | Populus Rhizosphere | MTRTVGAAIGVVVVLLFFASLTIEQNRALTLARAPIASHR* |
| Ga0075425_1025524521 | 3300006854 | Populus Rhizosphere | MTRTFGAALGVVIVLLFFASLTIEQNRVVTVARATVGAHR* |
| Ga0075434_1007977901 | 3300006871 | Populus Rhizosphere | MTRTFGRTFGAALGVLFVLLFFASLTLEQNRVLSIARANVGSHR* |
| Ga0079216_105167752 | 3300006918 | Agricultural Soil | MTRTVGAAIGAVVMLLFFASLSNEHNRVLSMARATIGWQK* |
| Ga0066710_1012194782 | 3300009012 | Grasslands Soil | MTRTFGAALGVVVVLLFFASLTVEQNRVVGFARAAAVSRK |
| Ga0111539_100368856 | 3300009094 | Populus Rhizosphere | MTRTLGAALGVAIVLLFFASLTFEQNRAVTLARSVVSSHR* |
| Ga0105245_110266831 | 3300009098 | Miscanthus Rhizosphere | MTRTFGRTFGAALGVLFVLLFFASLTLEQNRVLSLARATVGS |
| Ga0075423_117123171 | 3300009162 | Populus Rhizosphere | MTRTVGAAIGVVVVLLFFASLTIEQNRVVSLARTTVTSHK* |
| Ga0105100_101893422 | 3300009166 | Freshwater Sediment | MTRTLGAAIGAVLMLLFFATLNNEHNRVLSMARASMGWQK* |
| Ga0105246_106102261 | 3300011119 | Miscanthus Rhizosphere | IGKSLWRCNPMSRTFGRTFGAALGVLFVLLFFASLTIEQNRVLSIARASVGSHR* |
| Ga0137365_102768653 | 3300012201 | Vadose Zone Soil | MTRTFGAALGVVVVLLFFASLTVEQNRVVSLDARAAAVARK* |
| Ga0137376_100381914 | 3300012208 | Vadose Zone Soil | MTRTFGAALGVVVVLLFFASLTVEQNRVVSLDARAAAVVRK* |
| Ga0150985_1051280964 | 3300012212 | Avena Fatua Rhizosphere | WRWIAMTRTLGAALGVAIVLLFFASLTFEQNRVLTIARTTVGSHR* |
| Ga0150985_1109873463 | 3300012212 | Avena Fatua Rhizosphere | MTRTLGAALGVAIVLLFFASLTFEQNRVLTIARAAVGSHR* |
| Ga0150985_1123641342 | 3300012212 | Avena Fatua Rhizosphere | FISMTRTFGAALGVVVVLLFFASLTIEQNRVVSVARATIGSHK* |
| Ga0150984_1137055022 | 3300012469 | Avena Fatua Rhizosphere | MTRTLGAALGVLVVLLFFASLTTEQNRVLSMARATIGWQK* |
| Ga0150984_1168921372 | 3300012469 | Avena Fatua Rhizosphere | RWIAMTRTLGAALGVAIVLLFFASLTFEQNRVLTIARTTVGSHR* |
| Ga0150984_1171784522 | 3300012469 | Avena Fatua Rhizosphere | MTRTVGAALGVVVVLLFFASLTMEQNRVVSIARATIGSHK* |
| Ga0150984_1214249332 | 3300012469 | Avena Fatua Rhizosphere | GVCMTRTLGAALGVAIVLLFFASLTIEQNRVLTIARTAVGSHR* |
| Ga0137410_104719081 | 3300012944 | Vadose Zone Soil | MNRTFGRTFGAALGVVIILLFFASLTIEQNRVLSIARATVGSHR* |
| Ga0164300_103085773 | 3300012951 | Soil | MTRTFGRTFGAALGVLFVLLFFASLTLEQNRVLSIARATVGSHR* |
| Ga0164302_104090682 | 3300012961 | Soil | VTRTFGRTFGAALGVLFVLLFFASLTLEQNRVLSIARATVGSHR* |
| Ga0164305_113757651 | 3300012989 | Soil | GAALGVVVVLLFFASLTFEQNRVVSFARAAAMARK* |
| Ga0164305_115196682 | 3300012989 | Soil | MTRTFGAALGVAIVLLFFASLTIEQNRVLTIARAAVGSHR* |
| Ga0157377_108153892 | 3300014745 | Miscanthus Rhizosphere | RTFGRTFGAALGVLFVLLFFASLTLEQNRVLSLARATVGSHR* |
| Ga0132258_134241013 | 3300015371 | Arabidopsis Rhizosphere | WRCIAMTRTLGAALGVAIVLLFFASLTFEQNRVLTIARATVGSHR* |
| Ga0132256_1024557492 | 3300015372 | Arabidopsis Rhizosphere | MTRTFGAALGVVIVLLFFASLTIEQNRVVTVARATVGAH |
| Ga0132257_1011850451 | 3300015373 | Arabidopsis Rhizosphere | TFGAALGVLFVLLFFASLTIEQNRVLSIARASVGSHR* |
| Ga0184617_11140432 | 3300018066 | Groundwater Sediment | MTRTFGAALGVVVVLLFFASLTFEQNRIVSLDNRAAAVARK |
| Ga0184629_100153414 | 3300018084 | Groundwater Sediment | MTRTFGAALGAVIVLLFFASLSFEQNRVVSMARATVGWHK |
| Ga0190265_105714873 | 3300018422 | Soil | MSRTIGAAIGAVLMLLFFATLNNEHNRVLSMARASMGWQK |
| Ga0190272_117869471 | 3300018429 | Soil | RKAIWGGCEMTRTFGAALGVVIVLLFFASLNTEQNRVVAVARAAAASHK |
| Ga0066667_113084021 | 3300018433 | Grasslands Soil | MTRTLGAALGVAIVLLFFASLTIEQNRVLTIARAAVGSHR |
| Ga0190274_100974743 | 3300018476 | Soil | MTRTLGAALGVVVVLLFFASLTIEQNRVMSMARATVGWQK |
| Ga0190274_109556742 | 3300018476 | Soil | MTRTLGAAIGVVIVILFFASLNTEQNRVVAVARAAASSHK |
| Ga0190264_115136652 | 3300019377 | Soil | MTRTIGAAIGAVVMLLFFATLTNEHNRVLSMARATIGWQK |
| Ga0193735_10456712 | 3300020006 | Soil | MTRTFGAALGVVVVLLFFASLTFEQNRVASFARTAPVARK |
| Ga0193706_11964321 | 3300021339 | Soil | MTRTLGAALGVVIIILFFASLNTEQNRVVAFARASAASQK |
| Ga0193737_10579662 | 3300021972 | Soil | MTRTLGAALGVVIVVLFFASLNTEQNRVVAVARAAAASHK |
| Ga0224452_10708383 | 3300022534 | Groundwater Sediment | MTRTFGAALGVVIVLLFFASLTVEQNRVVAVARAAAVPQK |
| Ga0222622_100604833 | 3300022756 | Groundwater Sediment | MTRTLGAALGVVVVLLFFASLTIEQNRVLSMARATVGWQK |
| Ga0222622_101155904 | 3300022756 | Groundwater Sediment | MTRTLGAALGVVIIILFFASLNTEQNRVVAFARSSAASQK |
| Ga0222622_103189472 | 3300022756 | Groundwater Sediment | MTRTFGAALGVVVVLLFFASLNFEQNRAVSLDARAAAVARK |
| Ga0247792_10909292 | 3300022880 | Soil | MTRTLGAAIGVAVVLLFFASLTFEQNRVLTIARAAVGSHR |
| Ga0207643_110317612 | 3300025908 | Miscanthus Rhizosphere | MSRTFGRTFGAALGVLFVLLFFASLTIEQNRVLSIARASVGSHR |
| Ga0207660_111060062 | 3300025917 | Corn Rhizosphere | MTRTLGAAIGFAFVLLFFASLTFEQNRVLTMARAAHMTNRLTFFA |
| Ga0207681_112665302 | 3300025923 | Switchgrass Rhizosphere | MNAGRTFGAALGVLFVLLFFASLTLEQNRVLSIARATVGSHR |
| Ga0207659_105287542 | 3300025926 | Miscanthus Rhizosphere | MTRTFGRTFGAALGVLFVLLFFASLTIEQNRVLSIARATVGSHR |
| Ga0207669_114582001 | 3300025937 | Miscanthus Rhizosphere | MNRTFGRTFGAALGVLFVLLFFASLTIEQNRVLSMARATVGSHR |
| Ga0207704_112328481 | 3300025938 | Miscanthus Rhizosphere | KSLWRCNSMNRTFGRTFGAALGVLFVLLFFASLTLEQNRVLSIARATVGSHR |
| Ga0207691_103199771 | 3300025940 | Miscanthus Rhizosphere | SFPSNRKSLWRCNPMTRTFGRTFGAALGVLFVLLFFASLTIEQNRVLSIARASVGSHR |
| Ga0207712_111179551 | 3300025961 | Switchgrass Rhizosphere | MSRTFGRTFGAALGVLFVLLFFASLTLEQNRVLSIARATVGSHR |
| Ga0209982_10411632 | 3300027552 | Arabidopsis Thaliana Rhizosphere | MTRTLGAALGIVIVVLFFASLNTEQKRVVAVARAAAASHK |
| Ga0207428_101568873 | 3300027907 | Populus Rhizosphere | MTRTLGAAIGVAVILLFFASLTFEQNRVLTIARAAVGSHR |
| Ga0268265_102429553 | 3300028380 | Switchgrass Rhizosphere | MTRTLGAALGVAIVLLFFASLTFEQNRVLTIARTAVGSHR |
| Ga0268264_106978322 | 3300028381 | Switchgrass Rhizosphere | MTRTFGRTFGAALGVLFVLLFFASLTLEQNRVLSLAR |
| Ga0307282_100712002 | 3300028784 | Soil | MTRTFGAAIGVVVVLLFFASLTFEQNRVVSFARTAAVARK |
| Ga0307503_104024092 | 3300028802 | Soil | MTRTFGAALGVVIVLLFFASLTIEQNRVVSVARATVSHR |
| Ga0307312_109505222 | 3300028828 | Soil | MTRTFGAALGVVVVLLFFASLTFEQNRVVSLDARAAAVARK |
| Ga0310813_105831852 | 3300031716 | Soil | MTRTLGAAIGAAVVLLFFASLTFEQNRVLTIARAAVGSHR |
| Ga0310813_110515112 | 3300031716 | Soil | IGKSLWRCNSMTRTFGRTFGAALGVLFVLLFFASLTIEQNRVLSIARASVGSHR |
| Ga0310892_104067521 | 3300031858 | Soil | MTRTLGAAIGVAVVLLFFASLTFEQNRVLTIARSAVGSHR |
| Ga0370548_092774_27_149 | 3300034644 | Soil | MTRTFGAALGVVVVLLFFASLTFEQNRVQSFARAAAVAHK |
| Ga0314782_149217_465_572 | 3300034661 | Soil | GAAIGVAVVLLFFASLTFEQNRVLTIARAAVGSHR |
| ⦗Top⦘ |