


| Basic Information | |
|---|---|
| Family ID | F084854 |
| Family Type | Metagenome |
| Number of Sequences | 112 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MLYTLKVVATMIVAFAAGIVINRYLYKFFDWFLDKIESYDDGEY |
| Number of Associated Samples | 75 |
| Number of Associated Scaffolds | 112 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 62.50 % |
| % of genes near scaffold ends (potentially truncated) | 29.46 % |
| % of genes from short scaffolds (< 2000 bps) | 78.57 % |
| Associated GOLD sequencing projects | 69 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (64.286 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater (41.964 % of family members) |
| Environment Ontology (ENVO) | Unclassified (91.071 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (96.429 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.17% β-sheet: 0.00% Coil/Unstructured: 45.83% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 112 Family Scaffolds |
|---|---|---|
| PF07728 | AAA_5 | 13.39 |
| PF00254 | FKBP_C | 6.25 |
| PF13203 | DUF2201_N | 5.36 |
| PF07432 | Hc1 | 1.79 |
| PF04293 | SpoVR | 0.89 |
| PF01050 | MannoseP_isomer | 0.89 |
| PF00692 | dUTPase | 0.89 |
| PF13578 | Methyltransf_24 | 0.89 |
| PF01464 | SLT | 0.89 |
| COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
|---|---|---|---|
| COG0717 | dCTP deaminase | Nucleotide transport and metabolism [F] | 0.89 |
| COG0756 | dUTP pyrophosphatase (dUTPase) | Defense mechanisms [V] | 0.89 |
| COG2719 | Stage V sporulation protein SpoVR/YcgB, involved in spore cortex formation (function unknown) | Cell cycle control, cell division, chromosome partitioning [D] | 0.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 64.29 % |
| All Organisms | root | All Organisms | 35.71 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001450|JGI24006J15134_10002978 | Not Available | 9196 | Open in IMG/M |
| 3300001450|JGI24006J15134_10012766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 4059 | Open in IMG/M |
| 3300001450|JGI24006J15134_10038154 | All Organisms → Viruses → Predicted Viral | 2053 | Open in IMG/M |
| 3300001965|GOS2243_1039973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1466 | Open in IMG/M |
| 3300002482|JGI25127J35165_1057074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 834 | Open in IMG/M |
| 3300004097|Ga0055584_100995908 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 877 | Open in IMG/M |
| 3300006735|Ga0098038_1034864 | Not Available | 1866 | Open in IMG/M |
| 3300006752|Ga0098048_1098275 | Not Available | 887 | Open in IMG/M |
| 3300006754|Ga0098044_1305529 | Not Available | 608 | Open in IMG/M |
| 3300006789|Ga0098054_1019135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2737 | Open in IMG/M |
| 3300006923|Ga0098053_1018678 | Not Available | 1516 | Open in IMG/M |
| 3300006928|Ga0098041_1157077 | Not Available | 731 | Open in IMG/M |
| 3300007276|Ga0070747_1063827 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1395 | Open in IMG/M |
| 3300007963|Ga0110931_1076553 | Not Available | 1010 | Open in IMG/M |
| 3300007963|Ga0110931_1130917 | Not Available | 754 | Open in IMG/M |
| 3300007963|Ga0110931_1239748 | Not Available | 539 | Open in IMG/M |
| 3300009071|Ga0115566_10032085 | Not Available | 3724 | Open in IMG/M |
| 3300009071|Ga0115566_10471828 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 715 | Open in IMG/M |
| 3300009193|Ga0115551_1354168 | Not Available | 635 | Open in IMG/M |
| 3300009593|Ga0115011_10360143 | Not Available | 1122 | Open in IMG/M |
| 3300009593|Ga0115011_10394520 | Not Available | 1076 | Open in IMG/M |
| 3300009605|Ga0114906_1220675 | Not Available | 628 | Open in IMG/M |
| 3300009790|Ga0115012_10741656 | Not Available | 791 | Open in IMG/M |
| 3300009790|Ga0115012_11318909 | Not Available | 612 | Open in IMG/M |
| 3300010148|Ga0098043_1214062 | Not Available | 530 | Open in IMG/M |
| 3300010149|Ga0098049_1179979 | Not Available | 650 | Open in IMG/M |
| 3300012928|Ga0163110_11373187 | Not Available | 571 | Open in IMG/M |
| 3300012928|Ga0163110_11475018 | Not Available | 551 | Open in IMG/M |
| 3300012952|Ga0163180_10906906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 699 | Open in IMG/M |
| 3300013010|Ga0129327_10124877 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1274 | Open in IMG/M |
| 3300014818|Ga0134300_1086648 | Not Available | 522 | Open in IMG/M |
| 3300017697|Ga0180120_10181692 | Not Available | 879 | Open in IMG/M |
| 3300017705|Ga0181372_1012005 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1535 | Open in IMG/M |
| 3300017714|Ga0181412_1115225 | Not Available | 623 | Open in IMG/M |
| 3300017717|Ga0181404_1013803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2111 | Open in IMG/M |
| 3300017717|Ga0181404_1054570 | Not Available | 1003 | Open in IMG/M |
| 3300017717|Ga0181404_1131263 | Not Available | 609 | Open in IMG/M |
| 3300017720|Ga0181383_1021053 | Not Available | 1752 | Open in IMG/M |
| 3300017720|Ga0181383_1047010 | Not Available | 1159 | Open in IMG/M |
| 3300017720|Ga0181383_1049312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1130 | Open in IMG/M |
| 3300017720|Ga0181383_1080304 | Not Available | 875 | Open in IMG/M |
| 3300017720|Ga0181383_1084788 | Not Available | 850 | Open in IMG/M |
| 3300017720|Ga0181383_1186274 | Not Available | 553 | Open in IMG/M |
| 3300017724|Ga0181388_1078135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 789 | Open in IMG/M |
| 3300017728|Ga0181419_1052309 | All Organisms → Viruses → Predicted Viral | 1062 | Open in IMG/M |
| 3300017731|Ga0181416_1000947 | Not Available | 7393 | Open in IMG/M |
| 3300017732|Ga0181415_1005666 | Not Available | 3061 | Open in IMG/M |
| 3300017732|Ga0181415_1061835 | Not Available | 848 | Open in IMG/M |
| 3300017732|Ga0181415_1133168 | Not Available | 558 | Open in IMG/M |
| 3300017733|Ga0181426_1025774 | All Organisms → Viruses → Predicted Viral | 1154 | Open in IMG/M |
| 3300017733|Ga0181426_1070377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 696 | Open in IMG/M |
| 3300017740|Ga0181418_1103903 | Not Available | 688 | Open in IMG/M |
| 3300017741|Ga0181421_1024721 | Not Available | 1635 | Open in IMG/M |
| 3300017744|Ga0181397_1001019 | Not Available | 10331 | Open in IMG/M |
| 3300017745|Ga0181427_1040522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1157 | Open in IMG/M |
| 3300017745|Ga0181427_1072199 | Not Available | 848 | Open in IMG/M |
| 3300017745|Ga0181427_1077490 | Not Available | 815 | Open in IMG/M |
| 3300017748|Ga0181393_1145670 | Not Available | 592 | Open in IMG/M |
| 3300017753|Ga0181407_1083462 | Not Available | 814 | Open in IMG/M |
| 3300017753|Ga0181407_1140100 | Not Available | 600 | Open in IMG/M |
| 3300017755|Ga0181411_1006853 | All Organisms → Viruses → Predicted Viral | 3870 | Open in IMG/M |
| 3300017757|Ga0181420_1086159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 976 | Open in IMG/M |
| 3300017757|Ga0181420_1087984 | Not Available | 964 | Open in IMG/M |
| 3300017758|Ga0181409_1059713 | All Organisms → Viruses → Predicted Viral | 1165 | Open in IMG/M |
| 3300017758|Ga0181409_1176812 | Not Available | 620 | Open in IMG/M |
| 3300017759|Ga0181414_1079373 | Not Available | 868 | Open in IMG/M |
| 3300017759|Ga0181414_1163890 | Not Available | 580 | Open in IMG/M |
| 3300017760|Ga0181408_1025501 | All Organisms → Viruses → Predicted Viral | 1622 | Open in IMG/M |
| 3300017760|Ga0181408_1075914 | Not Available | 882 | Open in IMG/M |
| 3300017763|Ga0181410_1068742 | All Organisms → Viruses → Predicted Viral | 1059 | Open in IMG/M |
| 3300017764|Ga0181385_1078425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1017 | Open in IMG/M |
| 3300017764|Ga0181385_1104280 | Not Available | 868 | Open in IMG/M |
| 3300017764|Ga0181385_1109799 | Not Available | 843 | Open in IMG/M |
| 3300017764|Ga0181385_1119327 | Not Available | 805 | Open in IMG/M |
| 3300017765|Ga0181413_1002270 | Not Available | 6020 | Open in IMG/M |
| 3300017768|Ga0187220_1096383 | Not Available | 893 | Open in IMG/M |
| 3300017772|Ga0181430_1091916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 908 | Open in IMG/M |
| 3300017772|Ga0181430_1155113 | Not Available | 664 | Open in IMG/M |
| 3300017776|Ga0181394_1085136 | Not Available | 1021 | Open in IMG/M |
| 3300017779|Ga0181395_1166175 | Not Available | 692 | Open in IMG/M |
| 3300020169|Ga0206127_1053689 | All Organisms → Viruses → Predicted Viral | 2013 | Open in IMG/M |
| 3300020175|Ga0206124_10021285 | Not Available | 3205 | Open in IMG/M |
| 3300020404|Ga0211659_10024607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2937 | Open in IMG/M |
| 3300020410|Ga0211699_10110818 | Not Available | 1022 | Open in IMG/M |
| 3300020411|Ga0211587_10329874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 624 | Open in IMG/M |
| 3300020428|Ga0211521_10015050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 4628 | Open in IMG/M |
| 3300020428|Ga0211521_10055136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2036 | Open in IMG/M |
| 3300020438|Ga0211576_10047837 | Not Available | 2454 | Open in IMG/M |
| 3300020438|Ga0211576_10106094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1549 | Open in IMG/M |
| 3300020438|Ga0211576_10517813 | Not Available | 601 | Open in IMG/M |
| 3300020595|Ga0206126_10112595 | Not Available | 1330 | Open in IMG/M |
| 3300020595|Ga0206126_10429718 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 578 | Open in IMG/M |
| 3300021365|Ga0206123_10019216 | Not Available | 4114 | Open in IMG/M |
| 3300021365|Ga0206123_10470837 | Not Available | 507 | Open in IMG/M |
| 3300025103|Ga0208013_1068221 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 935 | Open in IMG/M |
| 3300025120|Ga0209535_1080639 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1236 | Open in IMG/M |
| 3300025127|Ga0209348_1043948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1538 | Open in IMG/M |
| 3300025127|Ga0209348_1228022 | Not Available | 506 | Open in IMG/M |
| 3300025128|Ga0208919_1154296 | Not Available | 710 | Open in IMG/M |
| 3300025132|Ga0209232_1050887 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1514 | Open in IMG/M |
| 3300025132|Ga0209232_1099403 | Not Available | 984 | Open in IMG/M |
| 3300025133|Ga0208299_1004126 | Not Available | 8785 | Open in IMG/M |
| 3300025138|Ga0209634_1110074 | Not Available | 1198 | Open in IMG/M |
| 3300025168|Ga0209337_1005173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 8917 | Open in IMG/M |
| 3300025632|Ga0209194_1112707 | Not Available | 675 | Open in IMG/M |
| 3300025816|Ga0209193_1083238 | Not Available | 822 | Open in IMG/M |
| 3300025890|Ga0209631_10020258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 5297 | Open in IMG/M |
| 3300027906|Ga0209404_10825408 | Not Available | 630 | Open in IMG/M |
| 3300031519|Ga0307488_10005104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 10864 | Open in IMG/M |
| 3300031757|Ga0315328_10629879 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 611 | Open in IMG/M |
| 3300032011|Ga0315316_10018352 | Not Available | 5343 | Open in IMG/M |
| 3300032011|Ga0315316_10052052 | Not Available | 3265 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 41.96% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 27.68% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 7.14% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 5.36% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 4.46% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 2.68% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 1.79% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.79% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.79% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 0.89% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.89% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.89% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.89% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.89% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001965 | Marine microbial communities from Coastal Floreana, Equador - GS028 | Environmental | Open in IMG/M |
| 3300002482 | Marine viral communities from the Pacific Ocean - ETNP_2_30 | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006923 | Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009193 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009605 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012952 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300014818 | Marine microbial communities to study oil droplet degradation from Trondheimsfjord, Norway - 0152 : 8 days incubation | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017705 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_08 viral metaG | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017724 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17 | Environmental | Open in IMG/M |
| 3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017732 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11 | Environmental | Open in IMG/M |
| 3300017733 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23 | Environmental | Open in IMG/M |
| 3300017740 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13 | Environmental | Open in IMG/M |
| 3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
| 3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
| 3300017745 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15 | Environmental | Open in IMG/M |
| 3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
| 3300017760 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16 | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300020169 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160419_1 | Environmental | Open in IMG/M |
| 3300020175 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2 | Environmental | Open in IMG/M |
| 3300020404 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978) | Environmental | Open in IMG/M |
| 3300020410 | Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148) | Environmental | Open in IMG/M |
| 3300020411 | Marine microbial communities from Tara Oceans - TARA_B100000131 (ERX556098-ERR599130) | Environmental | Open in IMG/M |
| 3300020428 | Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556032-ERR599094) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020595 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1 | Environmental | Open in IMG/M |
| 3300021365 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1 | Environmental | Open in IMG/M |
| 3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025133 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025632 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 (SPAdes) | Environmental | Open in IMG/M |
| 3300025816 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes) | Environmental | Open in IMG/M |
| 3300025890 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes) | Environmental | Open in IMG/M |
| 3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031757 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 32315 | Environmental | Open in IMG/M |
| 3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24006J15134_100029782 | 3300001450 | Marine | MLYTLRVVATMIVAFAAGIVINRYLYMFFDWFLDFIERWDDEER* |
| JGI24006J15134_100127662 | 3300001450 | Marine | MLYTLRVVATMIVAFAAGIVINRYLYKFFDWFLDRIESYDDGEL* |
| JGI24006J15134_100381544 | 3300001450 | Marine | MLYTLKVVATMIVAFTAGIVINRYLYKFFDWFLDAMEKWDEEDH* |
| GOS2243_10399732 | 3300001965 | Marine | MLYILKVVATMIVSFASGIVIHRTLWRFFDWLLDKLEDMDDKDY* |
| JGI25127J35165_10570743 | 3300002482 | Marine | MNYNYILDVIATIIVSFAAGMVLHRVLWKFFDWVLDAMERWDDEE* |
| Ga0055584_1009959082 | 3300004097 | Pelagic Marine | MLYILKVVATMIVSFAAGIVLHRMLWKFFDWVLDALERMDDEEGL* |
| Ga0098038_10348642 | 3300006735 | Marine | MLYTLKVIATMIVAFAGGIVFNRLLYKFFDWILSSIERVDE* |
| Ga0098048_10982751 | 3300006752 | Marine | MLYTLKVAATIVLAFIAGTVIHRVLWKFFDWVLDGLERMDDNERF* |
| Ga0098044_13055293 | 3300006754 | Marine | MLYILKVVATMIVAFAAGIVINRFLYKFFDWFLDKIESYDDGEY* |
| Ga0098054_10191352 | 3300006789 | Marine | MLYTLKVAATIVLAFIAGTVIHRVLWRFFDWVLDGLERMDDNERF* |
| Ga0098053_10186784 | 3300006923 | Marine | MLYTLKVIATIIVAFAGGIVFNRLLYKFFDWILSSIERVDE* |
| Ga0098041_11570772 | 3300006928 | Marine | MLYTLKVVATMIVSFAGGIVLHRVLWKFFDWVLDAMERMDDEGP* |
| Ga0070747_10638271 | 3300007276 | Aqueous | MLYILKVVATMIVAFAAGIVINRYLYKFFDWFLDKIESYDDGEV* |
| Ga0110931_10765532 | 3300007963 | Marine | MLYTLKVVATMIVAFAGGIVLNRLLYRFFDWFLDLIESFDEQDRH* |
| Ga0110931_11309172 | 3300007963 | Marine | MLYTLKVVATMIVSFAAGIVLHRILWRFFDWLLDKLEDM |
| Ga0110931_12397481 | 3300007963 | Marine | MLYTLKVVATMIVSFAAGIVLHRMLWKFFDWVLDLIESYDDGEV* |
| Ga0115566_100320854 | 3300009071 | Pelagic Marine | MLYTLKVVATMIVAFAAGIVINRYLYKFFDWFLDRIESYDDGEF* |
| Ga0115566_104718282 | 3300009071 | Pelagic Marine | MLYTLRVIATMIVAFAAGIVINRYLYKFFDWFLDKIESYDDGEF* |
| Ga0115551_13541681 | 3300009193 | Pelagic Marine | QNPNQRRTIKMLYTLRVVATMIVAFAAGIVINRYLYKFFDWFLDRIESYDDGEF* |
| Ga0115011_103601432 | 3300009593 | Marine | MSYALDVIATITVAFAAGMVIHRVLWKFFDWVLDAIERMDDEDY* |
| Ga0115011_103945203 | 3300009593 | Marine | STARSFKMNYILDVIATIIVSFAAGMVLHRVLWKFFDWVLDKLEDMDETER* |
| Ga0114906_12206752 | 3300009605 | Deep Ocean | MLYILKVVATMIVSFAAGIVLHRMLWRFFDWVLDKIESYDDEEL* |
| Ga0115012_107416562 | 3300009790 | Marine | NIMSYALDVIATITVAFAAGMVIHRVLWKFFDWVLDAIERMDDEDY* |
| Ga0115012_113189091 | 3300009790 | Marine | MLYTLKVVATMIVSFAGGIVLHRMLWRFFDWVLDAMERMDDEDL* |
| Ga0098043_12140621 | 3300010148 | Marine | APNWTLKANKIMNYILDVIATIVVSFAAGMVLHRVLWKFFDWVLDAMEKWDEEDL* |
| Ga0098049_11799791 | 3300010149 | Marine | TLKVAATIVLAFIAGTVIHRVLWKFFDWVLDGLERMDDNERF* |
| Ga0163110_113731871 | 3300012928 | Surface Seawater | MNYILDVIATIVVSFAAGMVLHRVLWKFFDWVLDKLEDMDEKY* |
| Ga0163110_114750181 | 3300012928 | Surface Seawater | WNCPDQRHTIKMLYILKVVATMIVSFAAGIVIHRVLWKFFDWFLDKIESYDDGEY* |
| Ga0163180_109069061 | 3300012952 | Seawater | MLYILKVVATMIVSFAAGIVLHRVLWKFFDWVLDGLERMDDEDRL* |
| Ga0129327_101248773 | 3300013010 | Freshwater To Marine Saline Gradient | MLYILKVVATMIVAFAAGIVINRYLYKFFDWFLDKIESYDDGEY* |
| Ga0134300_10866481 | 3300014818 | Marine | MLYILKVVATMIVAFAAGIVINRYLYKFFDWFLDRIESYDDGEF* |
| Ga0180120_101816922 | 3300017697 | Freshwater To Marine Saline Gradient | MLYTLKVVATMIVAFAAGIVINRYLYKFFDWFLDKIESYDDGEY |
| Ga0181372_10120052 | 3300017705 | Marine | MLYILKVVATMIVAFAAGIVINRFLYKFFDWFLDKIESYDDGEY |
| Ga0181412_11152251 | 3300017714 | Seawater | IKMLYTLRVIATMIVAFAAGIVINRYLYKFFDWVLDKLEDMDETER |
| Ga0181404_10138033 | 3300017717 | Seawater | MLYTLKVVATMIVAFAAGIVINRYLYKFFDWVLDKLEDMDETER |
| Ga0181404_10545702 | 3300017717 | Seawater | MLYTLKVVATMIVSFAAGIVLHRMLWKFFDWVLDAMERMDDEDRL |
| Ga0181404_11312632 | 3300017717 | Seawater | MDYLLDVIATIVVAFAAGMVLHRVLWKFFDWVLDAIEKWDDEDR |
| Ga0181383_10210533 | 3300017720 | Seawater | MLYTLKVVATMIVSFAAGIVLHRMLWRFFDWVLDALERMDDEDI |
| Ga0181383_10470102 | 3300017720 | Seawater | MLYILKVVATMIVAFAAGIVINRYLYKFFDWFLDKIESYDDGEY |
| Ga0181383_10493122 | 3300017720 | Seawater | MLYTLKVVATMIVAFAAGIVINRYLYKFFDWFLDKLEDMDETER |
| Ga0181383_10803041 | 3300017720 | Seawater | MLYTLKVVATMIVSFAAGIVLHRILWKFFDKVLDAMEKWDEEDH |
| Ga0181383_10847882 | 3300017720 | Seawater | MIKCQRNTXPIWELKNKMLYTLRVVATMIVAFAAGIVINRYLYKFFDWFLDKIESYDDGE |
| Ga0181383_11862742 | 3300017720 | Seawater | MLYTLKVVATMIVAFAGGIVLNRLLYRFFDWFLDLIESFDEQDRH |
| Ga0181388_10781351 | 3300017724 | Seawater | MLYILKVVATMIVSFAAGIVLHRMLWRFFDWVLDALERMDDEDI |
| Ga0181419_10523093 | 3300017728 | Seawater | MLYTLRVVATMIVAFAAGIVINRYLHKFFDWFLDFIERWDDEER |
| Ga0181416_100094717 | 3300017731 | Seawater | MLYTLKVVATMIVSFAAGIVLHRMLWRFFDWVLDKIESYDGEEL |
| Ga0181415_10056664 | 3300017732 | Seawater | YTLKVVATMIVSFAASIVLHRMLWRFFDWVLDAMERMDDEEL |
| Ga0181415_10618352 | 3300017732 | Seawater | KMLYTLKVVATMIVAFAAGIVINRYLYKFFDWVLDAMEKWDEEDH |
| Ga0181415_11331681 | 3300017732 | Seawater | ELKNKMLYTLRVVATMIVAFAAGIVINRYLYKFFDWFLDKIESYDDGEL |
| Ga0181426_10257743 | 3300017733 | Seawater | MLYTLRVVATMIVAFAAGIVINRYLYKFFDWFLDKIESYDDGEY |
| Ga0181426_10703773 | 3300017733 | Seawater | MLYTLKVVATMIVAFAAGIVINRYLYKFFDWVLDAMEK |
| Ga0181418_11039031 | 3300017740 | Seawater | KMLYTLKVVATMIVAFAAGIVINRYLYKFFDWFLDKLEDMDETER |
| Ga0181421_10247212 | 3300017741 | Seawater | WKNNKKEKAQNKMLYTLKVVATMIVSFAAGIVLHRILWRFFDWLLDKLEDMDDKY |
| Ga0181397_100101914 | 3300017744 | Seawater | MLYTLRVVATMIVAFAAGIVINRYLYMFFDWFLDFIERWDDEDR |
| Ga0181427_10405221 | 3300017745 | Seawater | MLYTLKVVATMIVAFAAGIVINRYLYKFFDWVLDKLEDMDETE |
| Ga0181427_10721992 | 3300017745 | Seawater | MLYILKVVATMIVSFAAGIVLHRVLWKFFDWFLDRIESYDDGEL |
| Ga0181427_10774903 | 3300017745 | Seawater | ATMIVAFAAGIVINRYLYKFFDWFLDKLEDMDETER |
| Ga0181393_11456701 | 3300017748 | Seawater | KMLYTVRVVATMIVAFAAGIVINRYLYKFFDWFLDKIESYDDGEF |
| Ga0181407_10834622 | 3300017753 | Seawater | KMLYTLKVVATMIVSFAAGIVLHRILWRFFDWLLDKLEDMDDKY |
| Ga0181407_11401001 | 3300017753 | Seawater | MLYILKVAATIVLAFIAGTVINRVLYKFFDWVLDGLERMDDNERF |
| Ga0181411_10068532 | 3300017755 | Seawater | MLYTLKVVATMIVSFAAGIVLHRILWRFFDWLLDKLEDMDDKY |
| Ga0181420_10861594 | 3300017757 | Seawater | MFYTVREVATMIIAFAAGIVINRYLYTFFDWFLDKVDSYDDGEV |
| Ga0181420_10879841 | 3300017757 | Seawater | HTIKMLYILKVVATMIVSFAAGIVLHRVLWKFFDWMLDKLEDMDEKY |
| Ga0181409_10597134 | 3300017758 | Seawater | MLYILKVVATMIVSFAAGIVLHRVLWKFFDWMLDKL |
| Ga0181409_11768122 | 3300017758 | Seawater | YTLRVIATMIVAFAAGIVINRYLYKFFDWFLDKIESYDDGEF |
| Ga0181414_10793732 | 3300017759 | Seawater | HTIKMLYTLKVVATMIVAFAAGIVINRYLYKFFDWVLDAMEKWDEEDH |
| Ga0181414_11638902 | 3300017759 | Seawater | WHRPDQRHTIKMLYTLKVVATMIVAFAAGIVINRYLYKFFDWFLDKLEDMDETER |
| Ga0181408_10255015 | 3300017760 | Seawater | MLYTLKVVATMIVSFAAGIVLHRILWRFFDWLLDKLEDMD |
| Ga0181408_10759141 | 3300017760 | Seawater | TIKMLYTLKVVATMIVAFAAGIVINRYLYKFFDWVLDAMEKWDEEDH |
| Ga0181410_10687421 | 3300017763 | Seawater | MLYTLRVVATMIVAFAAGIVINRYLYKFFDWFLDKIESYDDGEL |
| Ga0181385_10784253 | 3300017764 | Seawater | MLYTLKVVATMIVAFAAGIVINRYLYKFFDWFLDKVESYDDGEV |
| Ga0181385_11042802 | 3300017764 | Seawater | MLYILKVIATMIVAFAAGIVINRYLYKFFDWFLDKLEDMDETER |
| Ga0181385_11097991 | 3300017764 | Seawater | MLYTLRVVATMIVAFAAGIVINRYLHKFFDWFLDKIESYDDGEL |
| Ga0181385_11193271 | 3300017764 | Seawater | MLYTLRVVATMIVAFAAGIVINRYLHKFFDWFLDRIESYDDGEL |
| Ga0181413_100227011 | 3300017765 | Seawater | MLYTLKVVATMIVAFAGGIVLNRLLYRFFDWFLDFIESFDEQDRH |
| Ga0187220_10963831 | 3300017768 | Seawater | ILKVVATMIVAFAAGIVINRYLYKFFDWFLDKIESYDDGEY |
| Ga0181430_10919163 | 3300017772 | Seawater | MLYTLKVVATMIVAFAAGIVINRYLYKFFDWVLDAMEKWDE |
| Ga0181430_11551131 | 3300017772 | Seawater | RHTIKMLYTLKVVATMIVAFAGGIVLHRILWKFFDWVLDAMERWDEDERL |
| Ga0181394_10851361 | 3300017776 | Seawater | MLYTLKVVATMIVAFAAGIVINRYLYKFFDWVLDAMERMDDEDRL |
| Ga0181395_11661751 | 3300017779 | Seawater | MLYILKVVATMIVSFAAGIVLHRMLWRFFDWVLDAMERMDDEEL |
| Ga0206127_10536892 | 3300020169 | Seawater | MLYTLRVVATMIVAFAVGIVINRYLYKFFDWFLDKIESYDDGEL |
| Ga0206124_100212852 | 3300020175 | Seawater | MLYILKVVATMIVSFAAGIVLHRMLWKFFDWVLDALERMDDEDRL |
| Ga0211659_100246077 | 3300020404 | Marine | MDYLLDVVATIVVAFAAGMVLHRVLWKFFDYVLDKLEDWEQEDR |
| Ga0211699_101108181 | 3300020410 | Marine | MLYTLKVVATMIVSFAGGIVLHRVLWKFFDWVLDAMERMDDEDL |
| Ga0211587_103298742 | 3300020411 | Marine | MLYILKVVATMIVSFAAGIVLHRVLWKFFDWVLDALERMDDEDI |
| Ga0211521_100150502 | 3300020428 | Marine | MNYILDVIATIIVSFAAGMVLHRVLWKFFDWVLDKLEDMDETE |
| Ga0211521_100551362 | 3300020428 | Marine | MLYTLKVVATMIVSFAAGIVLHRMLWRFFDKVLDALERMDDEDI |
| Ga0211576_100478374 | 3300020438 | Marine | YTLKVVATMIVAFAAGIVINRYLYKFFDWFLDKLEDMDETER |
| Ga0211576_101060942 | 3300020438 | Marine | MLYILKVVATMIVSFAAGIVLHRVLWKFFDWMLDKLEDMDEKY |
| Ga0211576_105178131 | 3300020438 | Marine | MLYTLKVVATMIVAFAAGIVINRYLYKFFDWVLDAMEKWDEEDH |
| Ga0206126_101125952 | 3300020595 | Seawater | IKMLYILKVVATMIVSFAAGIVLHRMLWKFFDWVLDALERMDDEDRL |
| Ga0206126_104297182 | 3300020595 | Seawater | MLYTLRVIATMIVAFAAGIVINRYLYKFFDWFLDKIESYDDGEF |
| Ga0206123_100192166 | 3300021365 | Seawater | MLYILKVVATMIVSFAAGIVLHRMLWKFFDWVLDAMERMDDEDRL |
| Ga0206123_104708372 | 3300021365 | Seawater | MLYTLKVVATMIVAFAAGIVINRYLYKFFDWFLDKIESYDDGEL |
| Ga0208013_10682211 | 3300025103 | Marine | MLYTLKVAATIVLAFIAGTVIHRVLWKFFDWVLDGLERMDDNERF |
| Ga0209535_10806392 | 3300025120 | Marine | MLYTVRVVATMIVAFAAGIVINRYLYKFFDWFLDKIESYDDGEF |
| Ga0209348_10439482 | 3300025127 | Marine | MNYNYILDVIATIIVSFAAGMVLHRVLWKFFDWVLDAMERWDDEE |
| Ga0209348_12280222 | 3300025127 | Marine | MYILDVIATIIVSFAAGMVIHRVLWKFFDWVLDKIESYDDGEL |
| Ga0208919_11542961 | 3300025128 | Marine | MLYTLKVVATMIVSFAAGIVLHRILWRFFDWLLDKLEDMEDKY |
| Ga0209232_10508872 | 3300025132 | Marine | MLYILKVVATMIVSFAAGIVLHRVLWKFFDWMLDAMERMDDEDI |
| Ga0209232_10994034 | 3300025132 | Marine | MLYILKVVATMIVSFAAGIVLHRVLWKFFDWWLDKLEDMDEKY |
| Ga0208299_10041264 | 3300025133 | Marine | MLYTLKVIATIIVAFAGGIVFNRLLYKFFDWILSSIERVDE |
| Ga0209634_11100741 | 3300025138 | Marine | MLYTLRVVATMIVAFAAGIVINRYLYMFFDWFLDFIERWDDEER |
| Ga0209337_100517311 | 3300025168 | Marine | MLYTLKVVATMIVAFTAGIVINRYLYKFFDWFLDAMEKWDEEDH |
| Ga0209194_11127071 | 3300025632 | Pelagic Marine | MLYTLKVVATMIVAFAAGIVINRYLYKFFDWFLDRIESYDDGEF |
| Ga0209193_10832382 | 3300025816 | Pelagic Marine | MLYILKVVATMIVSFAAGIVLHRVLWKFFDWVLDALERMDDEDRL |
| Ga0209631_100202587 | 3300025890 | Pelagic Marine | MLYILKVVATMIVAFAAGIVINRYLYKFFDWFLDRIESYDDGEF |
| Ga0209404_108254082 | 3300027906 | Marine | LNIMSYALDVIATITVALAAGMVIHRVLWKFFDWVLDAIERMDDEDY |
| Ga0307488_100051041 | 3300031519 | Sackhole Brine | MLYTLRVVATMIVAFAAGIVINRYLYKFFDWFLDRIESYDDGEL |
| Ga0315328_106298792 | 3300031757 | Seawater | MSYLNTLAVAVVALAAGMVIHRVLWKFFDWVLDLIESYDDGEV |
| Ga0315316_100183523 | 3300032011 | Seawater | MLYTLKVVATMIVAFAGGIVLHRILWKFFDWVLDAMERWDEDERL |
| Ga0315316_100520522 | 3300032011 | Seawater | MLYTLKVVATMIVSFAAGIVLHRMLWRFFDWVLDAMERMDDEEL |
| ⦗Top⦘ |