


| Basic Information | |
|---|---|
| Family ID | F084689 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 112 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MSATSHGRRSWKDSPTAKAIAATISLLLIAGLIAVLAFALLSMQ |
| Number of Associated Samples | 86 |
| Number of Associated Scaffolds | 112 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 67.86 % |
| % of genes near scaffold ends (potentially truncated) | 42.86 % |
| % of genes from short scaffolds (< 2000 bps) | 79.46 % |
| Associated GOLD sequencing projects | 80 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (80.357 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (39.286 % of family members) |
| Environment Ontology (ENVO) | Unclassified (46.429 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (49.107 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.44% β-sheet: 0.00% Coil/Unstructured: 55.56% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 112 Family Scaffolds |
|---|---|---|
| PF13407 | Peripla_BP_4 | 3.57 |
| PF00589 | Phage_integrase | 1.79 |
| PF13671 | AAA_33 | 1.79 |
| PF00313 | CSD | 1.79 |
| PF07883 | Cupin_2 | 1.79 |
| PF13505 | OMP_b-brl | 1.79 |
| PF12847 | Methyltransf_18 | 0.89 |
| PF00497 | SBP_bac_3 | 0.89 |
| PF13458 | Peripla_BP_6 | 0.89 |
| PF13561 | adh_short_C2 | 0.89 |
| PF12071 | DUF3551 | 0.89 |
| PF01042 | Ribonuc_L-PSP | 0.89 |
| PF13545 | HTH_Crp_2 | 0.89 |
| PF12327 | FtsZ_C | 0.89 |
| PF01609 | DDE_Tnp_1 | 0.89 |
| PF04909 | Amidohydro_2 | 0.89 |
| PF13304 | AAA_21 | 0.89 |
| PF13683 | rve_3 | 0.89 |
| PF02738 | MoCoBD_1 | 0.89 |
| PF16518 | GrlR | 0.89 |
| PF01068 | DNA_ligase_A_M | 0.89 |
| PF06803 | DUF1232 | 0.89 |
| PF01425 | Amidase | 0.89 |
| PF11695 | DUF3291 | 0.89 |
| PF00817 | IMS | 0.89 |
| COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
|---|---|---|---|
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.89 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.89 |
| COG0389 | Nucleotidyltransferase/DNA polymerase DinP involved in DNA repair | Replication, recombination and repair [L] | 0.89 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.89 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.89 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.89 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.89 |
| COG3339 | Uncharacterized membrane protein YkvA, DUF1232 family | Function unknown [S] | 0.89 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.89 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.89 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.89 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 80.36 % |
| Unclassified | root | N/A | 19.64 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001593|JGI12635J15846_10736913 | Not Available | 567 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10327835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 623 | Open in IMG/M |
| 3300005336|Ga0070680_100322786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1311 | Open in IMG/M |
| 3300005471|Ga0070698_100921367 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300005937|Ga0081455_10020046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 6311 | Open in IMG/M |
| 3300005952|Ga0080026_10055681 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
| 3300006028|Ga0070717_10153077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1996 | Open in IMG/M |
| 3300006050|Ga0075028_100054117 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1940 | Open in IMG/M |
| 3300006172|Ga0075018_10046392 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1793 | Open in IMG/M |
| 3300006172|Ga0075018_10301193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 791 | Open in IMG/M |
| 3300006175|Ga0070712_101438876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 602 | Open in IMG/M |
| 3300006358|Ga0068871_100043838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3595 | Open in IMG/M |
| 3300006893|Ga0073928_10279511 | All Organisms → cellular organisms → Bacteria | 1263 | Open in IMG/M |
| 3300007255|Ga0099791_10433779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 634 | Open in IMG/M |
| 3300007255|Ga0099791_10584447 | Not Available | 545 | Open in IMG/M |
| 3300007258|Ga0099793_10115102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1253 | Open in IMG/M |
| 3300007265|Ga0099794_10085449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1561 | Open in IMG/M |
| 3300007265|Ga0099794_10242351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 929 | Open in IMG/M |
| 3300007265|Ga0099794_10637192 | Not Available | 566 | Open in IMG/M |
| 3300007265|Ga0099794_10813697 | Not Available | 500 | Open in IMG/M |
| 3300009088|Ga0099830_10547746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium septentrionale | 946 | Open in IMG/M |
| 3300009088|Ga0099830_10897134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 733 | Open in IMG/M |
| 3300009143|Ga0099792_10701121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCBAU 051011 | 655 | Open in IMG/M |
| 3300010043|Ga0126380_11212043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 651 | Open in IMG/M |
| 3300010159|Ga0099796_10227276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 767 | Open in IMG/M |
| 3300010159|Ga0099796_10316251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 665 | Open in IMG/M |
| 3300010360|Ga0126372_11036093 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300010360|Ga0126372_11674750 | Not Available | 677 | Open in IMG/M |
| 3300010396|Ga0134126_10552331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. dw_411 | 1322 | Open in IMG/M |
| 3300011269|Ga0137392_10160265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium barranii → Bradyrhizobium barranii subsp. barranii | 1821 | Open in IMG/M |
| 3300011269|Ga0137392_10919081 | Not Available | 720 | Open in IMG/M |
| 3300011270|Ga0137391_10261272 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1499 | Open in IMG/M |
| 3300011271|Ga0137393_10321470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1319 | Open in IMG/M |
| 3300012096|Ga0137389_10587331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 957 | Open in IMG/M |
| 3300012096|Ga0137389_10869632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris → Rhodopseudomonas palustris BisB18 | 774 | Open in IMG/M |
| 3300012096|Ga0137389_10889644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 764 | Open in IMG/M |
| 3300012203|Ga0137399_10047898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3084 | Open in IMG/M |
| 3300012203|Ga0137399_11162588 | Not Available | 650 | Open in IMG/M |
| 3300012211|Ga0137377_10050994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 3823 | Open in IMG/M |
| 3300012363|Ga0137390_10100080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2866 | Open in IMG/M |
| 3300012683|Ga0137398_10027052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3199 | Open in IMG/M |
| 3300012683|Ga0137398_10292869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium algeriense | 1093 | Open in IMG/M |
| 3300012685|Ga0137397_10215295 | Not Available | 1430 | Open in IMG/M |
| 3300012685|Ga0137397_10440244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 971 | Open in IMG/M |
| 3300012929|Ga0137404_10155364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1906 | Open in IMG/M |
| 3300012929|Ga0137404_10854888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 828 | Open in IMG/M |
| 3300012944|Ga0137410_10253694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1379 | Open in IMG/M |
| 3300015053|Ga0137405_1001880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1089 | Open in IMG/M |
| 3300015054|Ga0137420_1439015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6670 | Open in IMG/M |
| 3300015241|Ga0137418_10083032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2903 | Open in IMG/M |
| 3300018028|Ga0184608_10077401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Muriiphilus → Muriiphilus fusiformis | 1358 | Open in IMG/M |
| 3300018051|Ga0184620_10251995 | Not Available | 592 | Open in IMG/M |
| 3300018053|Ga0184626_10400783 | Not Available | 548 | Open in IMG/M |
| 3300018066|Ga0184617_1115306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 764 | Open in IMG/M |
| 3300018078|Ga0184612_10214062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 999 | Open in IMG/M |
| 3300018429|Ga0190272_11063337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 780 | Open in IMG/M |
| 3300019789|Ga0137408_1293147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1620 | Open in IMG/M |
| 3300019789|Ga0137408_1370759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 5592 | Open in IMG/M |
| 3300019789|Ga0137408_1415643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 7268 | Open in IMG/M |
| 3300019789|Ga0137408_1481688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3170 | Open in IMG/M |
| 3300019874|Ga0193744_1001201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4733 | Open in IMG/M |
| 3300019874|Ga0193744_1013683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1495 | Open in IMG/M |
| 3300019881|Ga0193707_1159967 | Not Available | 619 | Open in IMG/M |
| 3300019881|Ga0193707_1163790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 607 | Open in IMG/M |
| 3300019881|Ga0193707_1181295 | Not Available | 556 | Open in IMG/M |
| 3300019882|Ga0193713_1008174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3212 | Open in IMG/M |
| 3300019883|Ga0193725_1005886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3538 | Open in IMG/M |
| 3300019886|Ga0193727_1006484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4706 | Open in IMG/M |
| 3300019886|Ga0193727_1008002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4182 | Open in IMG/M |
| 3300019886|Ga0193727_1180161 | Not Available | 544 | Open in IMG/M |
| 3300020002|Ga0193730_1075240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 958 | Open in IMG/M |
| 3300020004|Ga0193755_1030653 | All Organisms → cellular organisms → Bacteria | 1781 | Open in IMG/M |
| 3300020004|Ga0193755_1205095 | Not Available | 559 | Open in IMG/M |
| 3300020006|Ga0193735_1103947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 789 | Open in IMG/M |
| 3300020012|Ga0193732_1022744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1086 | Open in IMG/M |
| 3300020170|Ga0179594_10150557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Muriiphilus → Muriiphilus fusiformis | 860 | Open in IMG/M |
| 3300020199|Ga0179592_10001059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 11184 | Open in IMG/M |
| 3300020579|Ga0210407_10038364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3565 | Open in IMG/M |
| 3300021168|Ga0210406_10442313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1036 | Open in IMG/M |
| 3300021403|Ga0210397_10412122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1012 | Open in IMG/M |
| 3300021433|Ga0210391_10743274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. | 768 | Open in IMG/M |
| 3300021968|Ga0193698_1051680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 527 | Open in IMG/M |
| 3300024330|Ga0137417_1155708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 991 | Open in IMG/M |
| 3300025915|Ga0207693_10094778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2339 | Open in IMG/M |
| 3300025915|Ga0207693_11058252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 618 | Open in IMG/M |
| 3300025917|Ga0207660_10037978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. dw_411 | 3359 | Open in IMG/M |
| 3300025928|Ga0207700_10019253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4607 | Open in IMG/M |
| 3300026217|Ga0209871_1016814 | All Organisms → cellular organisms → Bacteria | 1360 | Open in IMG/M |
| 3300026291|Ga0209890_10008718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4184 | Open in IMG/M |
| 3300026345|Ga0257148_1003974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1010 | Open in IMG/M |
| 3300026489|Ga0257160_1017479 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1103 | Open in IMG/M |
| 3300026551|Ga0209648_10165052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1732 | Open in IMG/M |
| 3300027388|Ga0208995_1039120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium cytisi | 834 | Open in IMG/M |
| 3300027546|Ga0208984_1097361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium cytisi | 636 | Open in IMG/M |
| 3300027633|Ga0208988_1037923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1239 | Open in IMG/M |
| 3300027663|Ga0208990_1079253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 936 | Open in IMG/M |
| 3300027738|Ga0208989_10210177 | Not Available | 642 | Open in IMG/M |
| 3300027875|Ga0209283_10463019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 820 | Open in IMG/M |
| 3300027882|Ga0209590_10356788 | Not Available | 942 | Open in IMG/M |
| 3300027903|Ga0209488_10205154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1484 | Open in IMG/M |
| 3300027903|Ga0209488_10573589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. WSM471 | 821 | Open in IMG/M |
| 3300028819|Ga0307296_10791781 | Not Available | 517 | Open in IMG/M |
| 3300028828|Ga0307312_10036997 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2870 | Open in IMG/M |
| 3300028885|Ga0307304_10460957 | Not Available | 579 | Open in IMG/M |
| 3300028906|Ga0308309_10587089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 967 | Open in IMG/M |
| 3300030943|Ga0311366_11408203 | Not Available | 598 | Open in IMG/M |
| 3300031128|Ga0170823_15924250 | Not Available | 592 | Open in IMG/M |
| 3300031421|Ga0308194_10368879 | Not Available | 516 | Open in IMG/M |
| 3300031446|Ga0170820_11378812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. | 986 | Open in IMG/M |
| 3300031879|Ga0306919_10771909 | Not Available | 739 | Open in IMG/M |
| 3300032180|Ga0307471_100724167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1160 | Open in IMG/M |
| 3300033544|Ga0316215_1004294 | All Organisms → cellular organisms → Bacteria | 1364 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 39.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 18.75% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.36% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.36% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.46% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.68% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.68% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.79% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 1.79% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.79% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.89% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.89% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.89% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.89% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.89% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019874 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a1 | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300020012 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s1 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021968 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c1 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026217 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes) | Environmental | Open in IMG/M |
| 3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
| 3300026345 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-A | Environmental | Open in IMG/M |
| 3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027388 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030943 | III_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_107369132 | 3300001593 | Forest Soil | EPEGDEMIATSHGRRSWKDSPTAKAIAATISLLLIADLIAVLAFALLSMQ* |
| JGIcombinedJ51221_103278351 | 3300003505 | Forest Soil | MTAASHGRRSWKDSPKAKRIAATISLLLIAGLIAMLAVAFLFTQ* |
| Ga0070680_1003227861 | 3300005336 | Corn Rhizosphere | MINTSRGGGSWKDSPRAKIIAGTISLLLIAGLIAMFAAIV* |
| Ga0070698_1009213673 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MTATSHGRRSWKDSPKAKMIAATISLLSIAGLIAMLAVAILFAQ* |
| Ga0081455_100200468 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MTLATQHGRSRRSWKDSPKAKTIAAVITLLLIVCLVVLLANAFLSMS* |
| Ga0080026_100556813 | 3300005952 | Permafrost Soil | SWKDSPKAKRIAVTIALLLIAGLIAMLAVAFLFTQ* |
| Ga0070717_101530772 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MTATNHGRRSWKDSPKAKRIAATISLLLIAGLIAVLAIAFLFTQ* |
| Ga0075028_1000541175 | 3300006050 | Watersheds | MIATSHERQSWKDNPKAKKIAATISLLLIAGLIAVLAFALLSMQ* |
| Ga0075018_100463923 | 3300006172 | Watersheds | MIATSHERQSWKDNPKAKKIAATISLLLIAGLIAVLAFALLSMQRSSPSACSD* |
| Ga0075018_103011932 | 3300006172 | Watersheds | MIATRYSRRSWKDNPKAKTIAATISLLLIAGLIAVLAFAFLSMQ* |
| Ga0070712_1014388762 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MTATSRRSWKDNPKAKAIAATISLLLIAGLIAVLAFALLTLR* |
| Ga0068871_1000438383 | 3300006358 | Miscanthus Rhizosphere | MINTSRGGGSWKDSPRAKIIAGTISLLLIAGLIAMLAAIV* |
| Ga0073928_102795111 | 3300006893 | Iron-Sulfur Acid Spring | EMTAASHGRRSWKDGPKAKRIAATISLLLIAGLIAMLAVAFLFTQ* |
| Ga0099791_104337791 | 3300007255 | Vadose Zone Soil | MVATSHGRRSWKDNPKAKTIAATVSLLLITGLIAVLAFALLSMQ* |
| Ga0099791_105844472 | 3300007255 | Vadose Zone Soil | MIATSHGRRSWKDNPKAKTIAATVSSLLIAALIAVLVLAFCSMR* |
| Ga0099793_101151021 | 3300007258 | Vadose Zone Soil | MTTTSHGRRSWKDSPKAKRIAATISLLLIAGLIAMLAVAFLFTQ* |
| Ga0099794_100854496 | 3300007265 | Vadose Zone Soil | MSATSHGRRSCKDSPAAKAIAATISSLLIAGFIAVLAFALLFMQ* |
| Ga0099794_102423511 | 3300007265 | Vadose Zone Soil | MIATSHGRRSWKDNSKAKTLAATVSSLLIIGMIAVLAFA |
| Ga0099794_106371922 | 3300007265 | Vadose Zone Soil | MIATSHGRRSWKDNSKAKTIAATVSSLLITGWIAVLAFALLSNAVK |
| Ga0099794_108136971 | 3300007265 | Vadose Zone Soil | MIATSHGRRSWKDNPKAKTIAAMVSLLLITGLIAVLVLAFCCRR* |
| Ga0099830_105477461 | 3300009088 | Vadose Zone Soil | ATSHGRRSWKDSPKAKRIAATISLLLIAGLIAMLAVAFLFTQ* |
| Ga0099830_108971341 | 3300009088 | Vadose Zone Soil | SEEMTATSHGRRSWKDSPKAKRIAATISLLLIAGLIAMLAVAFLFTQ* |
| Ga0099792_107011212 | 3300009143 | Vadose Zone Soil | ATSHGRRSWKDSPTAKAIAATISLLLIAGLIAVLAFALLSVQ* |
| Ga0126380_112120431 | 3300010043 | Tropical Forest Soil | MNATSHGRHSWKDNPKAKAIAATISLLLIASLIALLAFAFLSAQ* |
| Ga0099796_102272761 | 3300010159 | Vadose Zone Soil | TSQGRRSWKDSPTAKAIAATISLLLIAGLIAVLAFALLSMQ* |
| Ga0099796_103162512 | 3300010159 | Vadose Zone Soil | KGEEMSATSHGRRSWKDSPTAKAIAATISLLLIAGLIAVLAFALLSVQ* |
| Ga0126372_110360932 | 3300010360 | Tropical Forest Soil | EEMTVTSRPCHGRRSWKDSPRAKTIARTISLLLGVGLIIVLVFAFHDAG* |
| Ga0126372_116747502 | 3300010360 | Tropical Forest Soil | MTATSHGRHSWKDSPKAKAVAATISLLLIASLIAMLTFAFLFAQ* |
| Ga0134126_105523313 | 3300010396 | Terrestrial Soil | MINTSRGGGSWKDSPRAKIIAGTISLLLIAGLIAM |
| Ga0137392_101602653 | 3300011269 | Vadose Zone Soil | MIATSHGRRSWKDSPKAKRIAVTIVLLLIAGLIAMLAVAFLFTQ* |
| Ga0137392_109190811 | 3300011269 | Vadose Zone Soil | AEGEEMIATSHGRRSWKDSPKAKAIAATVSLLLLAGLIAVLAFELLSMR* |
| Ga0137391_102612722 | 3300011270 | Vadose Zone Soil | MIATSHGRRSWKDNPKAKTIAATVSSLLIAGLIAVLAFALLSMQ* |
| Ga0137393_103214702 | 3300011271 | Vadose Zone Soil | MIATSHGRRSWKDNPKAKTIAATVSSLLIAALIAVLVLALLKAKGK* |
| Ga0137389_105873311 | 3300012096 | Vadose Zone Soil | RRSWKDSPTAKAIAATISLLLIAGLIAVLAFALLSMQ* |
| Ga0137389_108696321 | 3300012096 | Vadose Zone Soil | LATSHRRRSWKDSPTAKAIAATVSSLLIAALIAVLAFALLSIK* |
| Ga0137389_108896442 | 3300012096 | Vadose Zone Soil | MIATSHGRRSWKDNPKAKTIAATVSSLLIAALIAVLVLALLKANGK* |
| Ga0137399_100478987 | 3300012203 | Vadose Zone Soil | MIATSHGRRLWKDNPKAKTIAATVSSLLIAALIAVLVLAFCSMR* |
| Ga0137399_111625881 | 3300012203 | Vadose Zone Soil | MIATSHGRRSWKDSPKAKRIAVTIALLLIAGLIAMLAVAFLFTQ* |
| Ga0137377_100509942 | 3300012211 | Vadose Zone Soil | MIATSHGRRSWKDNPTAKTIAATVSSLLIAGLIAVLAFALLSMQ* |
| Ga0137390_101000801 | 3300012363 | Vadose Zone Soil | MSATSHGRRSWKDSPTAKAMAATISLLFIAVLAFALLSMQ* |
| Ga0137398_100270525 | 3300012683 | Vadose Zone Soil | MRATSQGRRSWKDSPTAKAIAATISLLLIAGLIAVLAFALLSMQ* |
| Ga0137398_102928691 | 3300012683 | Vadose Zone Soil | MSATSHGRRSCKDSPAAKAIAATISSLLIAGFIAVLAFALLF |
| Ga0137397_102152952 | 3300012685 | Vadose Zone Soil | MSATSHRRSWKDNPKAKTIAATVSSLLIAGLIAVLAFALLSKQ* |
| Ga0137397_104402441 | 3300012685 | Vadose Zone Soil | RSWKDNPKAKTIAATVSSLLIAALIAVLVLALLKAEGK* |
| Ga0137404_101553641 | 3300012929 | Vadose Zone Soil | MLATSHGRRSWKDSPTAKAIAATISLLLIAGSIAVLAFSLLSMQ* |
| Ga0137404_108548883 | 3300012929 | Vadose Zone Soil | MTTRNRSRQSWKDSPKAKTIAATISLLLIAGLIAGLAFALLSM |
| Ga0137410_102536943 | 3300012944 | Vadose Zone Soil | GRRSWKDNPKAKTIAATVSSLLIAALIAVLVLALLKAEGK* |
| Ga0137405_10018801 | 3300015053 | Vadose Zone Soil | SPQVMGADRSWKDNPKAKTIAATVSSLLIAALIAVLVLAFCSMR* |
| Ga0137420_14390156 | 3300015054 | Vadose Zone Soil | MAADRAKDSPAAKAIAATISSLLIAGFIAVLAFALLFMQ* |
| Ga0137418_100830325 | 3300015241 | Vadose Zone Soil | MSATSHGRQSWKDSPTAKAIAATISLLLIAGLIAVLAFALLSMQ* |
| Ga0184608_100774014 | 3300018028 | Groundwater Sediment | LLPVGLLKGEEMSATSHGRRSWKDNPKAKAIAATISSLLIAALIAVLAFALLSMQ |
| Ga0184620_102519952 | 3300018051 | Groundwater Sediment | MIATSHGRRSWKDNSKAKTIAATVSSLVIAALIAVLVLALLKANGK |
| Ga0184626_104007832 | 3300018053 | Groundwater Sediment | MSATSHRRRSWKDNPKAKKIAATISLLLIAGLIAVLAFALLSKQ |
| Ga0184617_11153063 | 3300018066 | Groundwater Sediment | MIATSHGRRSWKDNPKAKTIAATVSSLLIAALIAVLVLALLKAKGK |
| Ga0184612_102140622 | 3300018078 | Groundwater Sediment | MIATSHGRRSWKDNPKAKTIAATISLLLIAGLIALLAFALLSI |
| Ga0190272_110633371 | 3300018429 | Soil | EMSATSHRRRSWKDDPKAKTIAATISLLLIAGLIAVLAFALLSMQ |
| Ga0137408_12931475 | 3300019789 | Vadose Zone Soil | MIATSHGRRSWKDNPKAKTIAATVSSLLIAALIAVLV |
| Ga0137408_13707596 | 3300019789 | Vadose Zone Soil | MRATSQGRRSWKDSPTAKAIAATISLLLIAGLIAVLAFALLSMQ |
| Ga0137408_14156438 | 3300019789 | Vadose Zone Soil | MIATSHGRRSWKDNPKAKTIAATVSSLLIAALIAVLVLAFCSMR |
| Ga0137408_14816887 | 3300019789 | Vadose Zone Soil | MIATSHGRRLWKDNPKAKTIAATVSSLLIAALIAVLVLAF |
| Ga0193744_10012012 | 3300019874 | Soil | MSATSHGRRSWKDNPKAKAIAATISSLLIAALIAVLAFALLSMQ |
| Ga0193744_10136833 | 3300019874 | Soil | RRSWKDNPKAKTIAATVSSLVIAALIAVLVLALLKANGK |
| Ga0193707_11599672 | 3300019881 | Soil | MSATSHGRRSWKDSPTAKAIAATISLLLIAGLIAVL |
| Ga0193707_11637901 | 3300019881 | Soil | MIATSRGRRSWKDNPKAKTIAATVSSLLIAALIAVLVLALLKAKGK |
| Ga0193707_11812951 | 3300019881 | Soil | MIATSHGRRSWKDNPKAKTIAATVSSLVIAALIAVLVLALLKANGK |
| Ga0193713_10081746 | 3300019882 | Soil | MSATSHGRRSWKDNPKAKTIAATVSSLLIGGLIAVLAFALLSMQ |
| Ga0193725_10058868 | 3300019883 | Soil | MSATSHGRRSWKDSPTAKAIAATISLLLIAGLIAVLAFALPSMQ |
| Ga0193727_10064842 | 3300019886 | Soil | MSATSHGRRSWKDSPTAKAIAATISLLLIAGLIAVLAFALLSMQ |
| Ga0193727_100800210 | 3300019886 | Soil | MSATSHGRRSWKDSPTAKAIAATISLLLIAGLIAVLVLAFALQ |
| Ga0193727_11801611 | 3300019886 | Soil | GEGKEMSATSHRHRSWKDCPTAKAIAATVSSLLIAALIAVLVLAFYCRR |
| Ga0193730_10752403 | 3300020002 | Soil | RRSWKDSLTAKAIAATISLLLIAGLIAVLAFALLSIR |
| Ga0193755_10306532 | 3300020004 | Soil | MIATSHGRRSWKDNPKAKTIAATVSSLLIGGLIAVLAFALLSMQ |
| Ga0193755_12050953 | 3300020004 | Soil | HGRRSWKDSPKAKRIAVTIALLLIGGLIALLAVAFLFTQ |
| Ga0193735_11039472 | 3300020006 | Soil | MIATSHGRRSWKDSPKAKRIAVTIALLLIGGLIALLAVAFLFTQ |
| Ga0193732_10227442 | 3300020012 | Soil | MIATSRGRRSWKDNPKAKTIAATVSSLVIAALIAVLVLALLKANGK |
| Ga0179594_101505572 | 3300020170 | Vadose Zone Soil | MSATSHGRRSCKDSPAAKAIAATISSLLIAGFIAVLAFALLFMQ |
| Ga0179592_1000105911 | 3300020199 | Vadose Zone Soil | MVATSHGRRSWKDNSQSETIAATVSLLLITGLIAVLAFALLSMQ |
| Ga0210407_100383643 | 3300020579 | Soil | MIATSHSRRSWKDSPKAKMIAATASLLLIAGLIAILAFEFLSLR |
| Ga0210406_104423131 | 3300021168 | Soil | MTATGHGRRYWKDNPKAKRIAAMISLLLIAALIAMLAVAFLFGQ |
| Ga0210397_104121222 | 3300021403 | Soil | MTATSRRSWKDNPKAKAIAAAISLLLIAGLIAVLVFALLTLR |
| Ga0210391_107432741 | 3300021433 | Soil | VESEEMTAASHGRRSWKDSPKAKRIAATISLLLIAGLIAMLAVAFLFTQ |
| Ga0193698_10516801 | 3300021968 | Soil | MIATSHGRRSWKDNPKAKTIAATVSSLVIAALIAVLVLALLKA |
| Ga0137417_11557081 | 3300024330 | Vadose Zone Soil | MVATSHGRRSWKDNPKAKTIAATVSLLLITGLIAVLAFALLSMQ |
| Ga0207693_100947786 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MTATSHGRRSWKDSPKAKTIAATISLLLIAGLIVVLTF |
| Ga0207693_110582522 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MTATSRRSWKDNPKAKAIAATISLLLIAGLIAVLAFALLTLR |
| Ga0207660_100379784 | 3300025917 | Corn Rhizosphere | MINTSRGGGSWKDSPRAKIIAGTISLLLIAGLIAMFAAIV |
| Ga0207700_100192536 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MTATSHGRRSWKDSPKAKMIAATISLLSIAGLIAMLALAILFAQ |
| Ga0209871_10168142 | 3300026217 | Permafrost Soil | SHRRRSWKDSPKAKRIAVTIALLLIAGLIAMLAVAFLFTQ |
| Ga0209890_100087189 | 3300026291 | Soil | MIATSHRRRSWKDSPKAKRIAVTIALLLIAGLIAMLAVAFLFTQ |
| Ga0257148_10039742 | 3300026345 | Soil | MIATSHGRRSWKDNPKAKTIAATVSLLLITGLIAVLAFALLSMQ |
| Ga0257160_10174793 | 3300026489 | Soil | MIATSHGRRSWKDSPKAKRIAVTIALLLIAGLIAMLAVAFLFTQ |
| Ga0209648_101650521 | 3300026551 | Grasslands Soil | ESEEMTATSHGRRSWKDSPKAKRIAATISLLLIAGLIAMLAVAFLFTQ |
| Ga0208995_10391201 | 3300027388 | Forest Soil | ARIESEEMTATSHGRRSWKDSPKAKRIAAPISLLLIAGLIAMLAVAFLFTQ |
| Ga0208984_10973611 | 3300027546 | Forest Soil | HGRRSWKDSPKAKRIAAPISLLLIAGLIAMLAVAFLFTQ |
| Ga0208988_10379233 | 3300027633 | Forest Soil | MIATSHGRRSWKDNPKAKTIAATVSSLLIAGLIAVLAFALLSMQ |
| Ga0208990_10792531 | 3300027663 | Forest Soil | MIATSHGRRSWKDNPKAKTIAATVSSLLIAALFAVLVLAFCSMR |
| Ga0208989_102101772 | 3300027738 | Forest Soil | MIATSHGRRSWKDSPNAKGIAVTIALLLIAGLIAMLAVAFLFTQ |
| Ga0209283_104630192 | 3300027875 | Vadose Zone Soil | MTATSHGRRSWKDSPKAKRIAATISLLLIAGLIAMLAVAFLFTQ |
| Ga0209590_103567884 | 3300027882 | Vadose Zone Soil | MSATSHGRRSWKDSPTAKAMAATISLLFIAVLAFALLS |
| Ga0209488_102051543 | 3300027903 | Vadose Zone Soil | EMTATSHGRRSWKDSPKAKRIAAPISLLLIAGLIAMLAVAFLFTQ |
| Ga0209488_105735892 | 3300027903 | Vadose Zone Soil | MSATSHGRRSWKDSPTAKAIAATISLLLIAGLIAVLA |
| Ga0307296_107917811 | 3300028819 | Soil | MSATSHRRRSWKDSPTAKAIAATISLLLIAGMIAVLAFALLSNAVKLI |
| Ga0307312_100369974 | 3300028828 | Soil | MIATSHGRRSWKDNSKAKTIAATVSSLLITGLIAVLAFALPSNAVKLP |
| Ga0307304_104609571 | 3300028885 | Soil | RSWKDSPTAKAIAATISLPLIAGLIAVLAFALLSMH |
| Ga0308309_105870891 | 3300028906 | Soil | MTAASHGRRSWKDSPKAKRIAATISLLLIAGLIAMLAV |
| Ga0311366_114082031 | 3300030943 | Fen | MIATSHGRRSWKDSPKAKRIAAIISLLLIAGLIAMLAIAFLSGNVA |
| Ga0170823_159242502 | 3300031128 | Forest Soil | RAEGEEMTAASHGRRSWKDSPKAKRIAATISLLLIAGLIAMLAVAFLFTQ |
| Ga0308194_103688791 | 3300031421 | Soil | MIATSHGRRSWKDNPNAKAIAATISLLLIAGLIAVLAFALLSNAVKLI |
| Ga0170820_113788122 | 3300031446 | Forest Soil | GSEEMTAASHGRRSWKDSPKAKRIAATISLLLIAGLIAMLAVAFLFTQ |
| Ga0306919_107719092 | 3300031879 | Soil | GRRSWKDSPKAKRIVRTISTLLIVGLVVALALAFLSMS |
| Ga0307471_1007241671 | 3300032180 | Hardwood Forest Soil | ARVESEEMTATNHGRRSWKDSPKAKRIAATISLLLIAGLIATLAVAFLFTQ |
| Ga0316215_10042941 | 3300033544 | Roots | VRSEEMTAASHGRRSWKDSPKAKRIAATISLLSIAGLIAMLAVAFLFTQ |
| ⦗Top⦘ |