


| Basic Information | |
|---|---|
| Family ID | F084627 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 112 |
| Average Sequence Length | 40 residues |
| Representative Sequence | AATIVAKHYGSREAMIEAGKKRNEIREVVASKLAREVMPK |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 112 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 5.41 % |
| % of genes near scaffold ends (potentially truncated) | 91.96 % |
| % of genes from short scaffolds (< 2000 bps) | 86.61 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (65.179 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (14.286 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.321 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (61.607 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 112 Family Scaffolds |
|---|---|---|
| PF01596 | Methyltransf_3 | 2.68 |
| PF13650 | Asp_protease_2 | 2.68 |
| PF10282 | Lactonase | 2.68 |
| PF01145 | Band_7 | 1.79 |
| PF00793 | DAHP_synth_1 | 1.79 |
| PF00440 | TetR_N | 1.79 |
| PF00691 | OmpA | 1.79 |
| PF12838 | Fer4_7 | 1.79 |
| PF00773 | RNB | 0.89 |
| PF00294 | PfkB | 0.89 |
| PF00149 | Metallophos | 0.89 |
| PF04055 | Radical_SAM | 0.89 |
| PF04343 | DUF488 | 0.89 |
| PF02239 | Cytochrom_D1 | 0.89 |
| PF00155 | Aminotran_1_2 | 0.89 |
| PF11412 | DsbC | 0.89 |
| PF01402 | RHH_1 | 0.89 |
| PF13507 | GATase_5 | 0.89 |
| PF04226 | Transgly_assoc | 0.89 |
| PF10412 | TrwB_AAD_bind | 0.89 |
| PF07238 | PilZ | 0.89 |
| PF12728 | HTH_17 | 0.89 |
| PF13515 | FUSC_2 | 0.89 |
| PF01740 | STAS | 0.89 |
| PF00133 | tRNA-synt_1 | 0.89 |
| PF00342 | PGI | 0.89 |
| PF00313 | CSD | 0.89 |
| PF02934 | GatB_N | 0.89 |
| PF12849 | PBP_like_2 | 0.89 |
| PF14499 | DUF4437 | 0.89 |
| PF07676 | PD40 | 0.89 |
| PF09723 | Zn-ribbon_8 | 0.89 |
| PF14534 | DUF4440 | 0.89 |
| PF01148 | CTP_transf_1 | 0.89 |
| PF13599 | Pentapeptide_4 | 0.89 |
| PF01862 | PvlArgDC | 0.89 |
| PF00069 | Pkinase | 0.89 |
| PF13231 | PMT_2 | 0.89 |
| PF00575 | S1 | 0.89 |
| PF07040 | DUF1326 | 0.89 |
| PF03466 | LysR_substrate | 0.89 |
| PF07679 | I-set | 0.89 |
| COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.57 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 2.68 |
| COG4123 | tRNA1(Val) A37 N6-methylase TrmN6 | Translation, ribosomal structure and biogenesis [J] | 2.68 |
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 2.68 |
| COG4776 | Exoribonuclease II | Transcription [K] | 0.89 |
| COG5588 | Uncharacterized conserved protein, DUF1326 domain | Function unknown [S] | 0.89 |
| COG0060 | Isoleucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.89 |
| COG0064 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit | Translation, ribosomal structure and biogenesis [J] | 0.89 |
| COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.89 |
| COG0166 | Glucose-6-phosphate isomerase | Carbohydrate transport and metabolism [G] | 0.89 |
| COG0495 | Leucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.89 |
| COG0525 | Valyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.89 |
| COG0557 | Exoribonuclease R | Transcription [K] | 0.89 |
| COG1945 | Pyruvoyl-dependent arginine decarboxylase | Amino acid transport and metabolism [E] | 0.89 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.89 |
| COG2511 | Archaeal Glu-tRNAGln amidotransferase subunit E, contains GAD domain | Translation, ribosomal structure and biogenesis [J] | 0.89 |
| COG3189 | Uncharacterized conserved protein YeaO, DUF488 family | Function unknown [S] | 0.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 65.18 % |
| Unclassified | root | N/A | 34.82 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001151|JGI12713J13577_1016394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium AB60 | 633 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100551753 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium AB60 | 1029 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101033940 | Not Available | 707 | Open in IMG/M |
| 3300004080|Ga0062385_11077942 | Not Available | 543 | Open in IMG/M |
| 3300004152|Ga0062386_101518135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 558 | Open in IMG/M |
| 3300005445|Ga0070708_100285675 | All Organisms → cellular organisms → Bacteria | 1553 | Open in IMG/M |
| 3300005538|Ga0070731_10639088 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 708 | Open in IMG/M |
| 3300005614|Ga0068856_102130805 | Not Available | 570 | Open in IMG/M |
| 3300005764|Ga0066903_101676446 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1209 | Open in IMG/M |
| 3300005764|Ga0066903_103019318 | Not Available | 912 | Open in IMG/M |
| 3300005921|Ga0070766_10024896 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3209 | Open in IMG/M |
| 3300005921|Ga0070766_11067508 | Not Available | 557 | Open in IMG/M |
| 3300006052|Ga0075029_100491621 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 809 | Open in IMG/M |
| 3300006052|Ga0075029_100716837 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300006086|Ga0075019_10299864 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300006173|Ga0070716_100649594 | Not Available | 800 | Open in IMG/M |
| 3300006893|Ga0073928_10525927 | Not Available | 844 | Open in IMG/M |
| 3300007265|Ga0099794_10521780 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300009549|Ga0116137_1013920 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3182 | Open in IMG/M |
| 3300010048|Ga0126373_12055417 | Not Available | 633 | Open in IMG/M |
| 3300010341|Ga0074045_10050969 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2999 | Open in IMG/M |
| 3300010361|Ga0126378_10645827 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1171 | Open in IMG/M |
| 3300010366|Ga0126379_10373598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1464 | Open in IMG/M |
| 3300010376|Ga0126381_101007475 | All Organisms → cellular organisms → Bacteria | 1202 | Open in IMG/M |
| 3300011120|Ga0150983_14330094 | Not Available | 525 | Open in IMG/M |
| 3300012096|Ga0137389_11423112 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
| 3300012582|Ga0137358_10115128 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1825 | Open in IMG/M |
| 3300014495|Ga0182015_10080192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 2296 | Open in IMG/M |
| 3300014495|Ga0182015_10598479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 699 | Open in IMG/M |
| 3300016270|Ga0182036_11669164 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
| 3300016294|Ga0182041_11019904 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 749 | Open in IMG/M |
| 3300016341|Ga0182035_10396154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1159 | Open in IMG/M |
| 3300016357|Ga0182032_10930998 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 740 | Open in IMG/M |
| 3300016357|Ga0182032_11734229 | Not Available | 545 | Open in IMG/M |
| 3300016371|Ga0182034_11275214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Calotrichaceae → Calothrix | 640 | Open in IMG/M |
| 3300016387|Ga0182040_11328064 | Not Available | 608 | Open in IMG/M |
| 3300016404|Ga0182037_11795531 | Not Available | 548 | Open in IMG/M |
| 3300016445|Ga0182038_11682267 | Not Available | 571 | Open in IMG/M |
| 3300017823|Ga0187818_10395025 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
| 3300017933|Ga0187801_10051427 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1498 | Open in IMG/M |
| 3300017943|Ga0187819_10523582 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300017943|Ga0187819_10839476 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300017955|Ga0187817_10007202 | All Organisms → cellular organisms → Bacteria | 6200 | Open in IMG/M |
| 3300017955|Ga0187817_10062716 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2303 | Open in IMG/M |
| 3300017961|Ga0187778_11068888 | Not Available | 561 | Open in IMG/M |
| 3300017970|Ga0187783_10263854 | Not Available | 1258 | Open in IMG/M |
| 3300017973|Ga0187780_11425162 | Not Available | 511 | Open in IMG/M |
| 3300017975|Ga0187782_11136643 | Not Available | 610 | Open in IMG/M |
| 3300018006|Ga0187804_10125944 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1067 | Open in IMG/M |
| 3300018023|Ga0187889_10121354 | All Organisms → cellular organisms → Bacteria | 1267 | Open in IMG/M |
| 3300018034|Ga0187863_10225244 | Not Available | 1043 | Open in IMG/M |
| 3300018037|Ga0187883_10026031 | All Organisms → cellular organisms → Bacteria | 3200 | Open in IMG/M |
| 3300018037|Ga0187883_10054352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2118 | Open in IMG/M |
| 3300018040|Ga0187862_10452206 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 780 | Open in IMG/M |
| 3300018046|Ga0187851_10048559 | All Organisms → cellular organisms → Bacteria | 2784 | Open in IMG/M |
| 3300018057|Ga0187858_10202901 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1293 | Open in IMG/M |
| 3300020583|Ga0210401_10000273 | All Organisms → cellular organisms → Bacteria | 65465 | Open in IMG/M |
| 3300020583|Ga0210401_10538053 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1031 | Open in IMG/M |
| 3300021170|Ga0210400_10260948 | Not Available | 1418 | Open in IMG/M |
| 3300021181|Ga0210388_10757862 | Not Available | 843 | Open in IMG/M |
| 3300021402|Ga0210385_10796681 | Not Available | 725 | Open in IMG/M |
| 3300021402|Ga0210385_10805704 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300021406|Ga0210386_11309976 | Not Available | 609 | Open in IMG/M |
| 3300021420|Ga0210394_10899351 | Not Available | 770 | Open in IMG/M |
| 3300021475|Ga0210392_10266948 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1218 | Open in IMG/M |
| 3300021560|Ga0126371_11184927 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300022510|Ga0242652_1052071 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300022531|Ga0242660_1146843 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300022850|Ga0224552_1000470 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 8438 | Open in IMG/M |
| 3300026294|Ga0209839_10035016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1883 | Open in IMG/M |
| 3300027326|Ga0209731_1051874 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
| 3300027545|Ga0209008_1062993 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300027548|Ga0209523_1008157 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1873 | Open in IMG/M |
| 3300027562|Ga0209735_1095671 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 646 | Open in IMG/M |
| 3300027570|Ga0208043_1018761 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2214 | Open in IMG/M |
| 3300027795|Ga0209139_10048928 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1486 | Open in IMG/M |
| 3300027842|Ga0209580_10333625 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 755 | Open in IMG/M |
| 3300027898|Ga0209067_10244074 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300027898|Ga0209067_10957938 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300027908|Ga0209006_10505865 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1007 | Open in IMG/M |
| 3300028552|Ga0302149_1178318 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300028780|Ga0302225_10069232 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1736 | Open in IMG/M |
| 3300028780|Ga0302225_10159817 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1091 | Open in IMG/M |
| 3300028781|Ga0302223_10133650 | Not Available | 819 | Open in IMG/M |
| 3300028798|Ga0302222_10376236 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300028871|Ga0302230_10169052 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 853 | Open in IMG/M |
| 3300028906|Ga0308309_10505052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1045 | Open in IMG/M |
| 3300029943|Ga0311340_10435197 | All Organisms → cellular organisms → Bacteria | 1193 | Open in IMG/M |
| 3300030524|Ga0311357_10201731 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1943 | Open in IMG/M |
| 3300030677|Ga0302317_10368757 | Not Available | 636 | Open in IMG/M |
| 3300030687|Ga0302309_10592004 | Not Available | 521 | Open in IMG/M |
| 3300031090|Ga0265760_10038332 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1425 | Open in IMG/M |
| 3300031234|Ga0302325_11592087 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300031708|Ga0310686_104867776 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1041 | Open in IMG/M |
| 3300031736|Ga0318501_10539055 | Not Available | 638 | Open in IMG/M |
| 3300031744|Ga0306918_11039988 | Not Available | 635 | Open in IMG/M |
| 3300031754|Ga0307475_10332997 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1219 | Open in IMG/M |
| 3300031823|Ga0307478_10392795 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1148 | Open in IMG/M |
| 3300031835|Ga0318517_10213156 | Not Available | 871 | Open in IMG/M |
| 3300031910|Ga0306923_12513888 | Not Available | 507 | Open in IMG/M |
| 3300031912|Ga0306921_11968680 | Not Available | 623 | Open in IMG/M |
| 3300031941|Ga0310912_10452123 | Not Available | 1001 | Open in IMG/M |
| 3300031941|Ga0310912_11351746 | Not Available | 539 | Open in IMG/M |
| 3300031954|Ga0306926_13024765 | Not Available | 501 | Open in IMG/M |
| 3300031962|Ga0307479_10028541 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Silvibacterium → Silvibacterium bohemicum | 5309 | Open in IMG/M |
| 3300031962|Ga0307479_11763842 | Not Available | 571 | Open in IMG/M |
| 3300032094|Ga0318540_10398227 | Not Available | 665 | Open in IMG/M |
| 3300032160|Ga0311301_10985792 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1118 | Open in IMG/M |
| 3300032261|Ga0306920_101120877 | Not Available | 1140 | Open in IMG/M |
| 3300032261|Ga0306920_102383238 | Not Available | 731 | Open in IMG/M |
| 3300034091|Ga0326724_0050188 | All Organisms → cellular organisms → Bacteria | 3045 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.39% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 8.93% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 8.04% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 6.25% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 6.25% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.46% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.46% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.57% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.57% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.68% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.68% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.79% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.79% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.79% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.79% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.79% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.79% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.89% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.89% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.89% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.89% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.89% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001151 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009549 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022510 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022850 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 1-5 | Environmental | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300027326 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028552 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_1 | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300028781 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_3 | Environmental | Open in IMG/M |
| 3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300028871 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030677 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030687 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_1 | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300034091 | Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12713J13577_10163941 | 3300001151 | Forest Soil | AKHYGSRDAMFEAARKRSEIRDVVASHLAREVMPK* |
| JGIcombinedJ26739_1005517532 | 3300002245 | Forest Soil | APIAVKHYGSRDAMFEAARKRSEIRDVVASHLAREVMPK* |
| JGIcombinedJ26739_1010339402 | 3300002245 | Forest Soil | TTIVVKHYGTREAMVEVGKKRADLREIVASHLAREVTPK* |
| Ga0062385_110779421 | 3300004080 | Bog Forest Soil | KAATIVVKHYGSREAAFESARKRSDIRDVVASHLAREVMPK* |
| Ga0062386_1015181351 | 3300004152 | Bog Forest Soil | ATVVAKHYGSRDAMLEAGKKRQDYREVVMSKLAREVMPK* |
| Ga0070708_1002856753 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VTPGATIAAKHYGSRDAMIDAGKKRNEIREVVASKLAREVMPK* |
| Ga0070731_106390882 | 3300005538 | Surface Soil | IAKHYGSRDAMIEAGKKRNDLREVVASKLAREVMPR* |
| Ga0068856_1021308051 | 3300005614 | Corn Rhizosphere | DAKAATVVAKHYGSRDAMIEAGKKRNDLRDVVMSKLGREVMPK* |
| Ga0066903_1016764462 | 3300005764 | Tropical Forest Soil | LDAVDAKAATIVAKHYGSRDAMIDAGKKRNELRTVVASKLAREVMPK* |
| Ga0066903_1030193181 | 3300005764 | Tropical Forest Soil | VVTKHYGSREAQMEAAKKRTESREVVASHLAREVIPK* |
| Ga0070766_100248961 | 3300005921 | Soil | SVAKHYGSRDAMIEAGKKRAELREVVASKLAREVMPK* |
| Ga0070766_110675082 | 3300005921 | Soil | TSVAKHYGSRDAMIEAGKKRNELREVVASKLAREVMPK* |
| Ga0075029_1004916211 | 3300006052 | Watersheds | ATTLVAKHYGSREAMLEAGKKRNELRDVVSNKLAREVMPK* |
| Ga0075029_1007168371 | 3300006052 | Watersheds | AKHYGSREAMLEAGKKRNELREVVASKLAHEVIPK* |
| Ga0075019_102998641 | 3300006086 | Watersheds | AKHYGSRDAMLEAAKKRNDIRELVASKLAHEVMPK* |
| Ga0070716_1006495942 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | KHYGSRDAMIDAGKKRNDLREVVMSKLAREVMPK* |
| Ga0073928_105259273 | 3300006893 | Iron-Sulfur Acid Spring | AKHYGSREAMIEAGKKRNEIREVVASKLAREVMPK* |
| Ga0099794_105217802 | 3300007265 | Vadose Zone Soil | DAKAATIVAKHYGSRDAMIDAGKRRNEIREVVASKLAREVMPK* |
| Ga0116137_10139201 | 3300009549 | Peatland | TKHYGSRDAMLYAAKKRNEIREVVASKLAHEVMPK* |
| Ga0126373_120554171 | 3300010048 | Tropical Forest Soil | MRKAATISAKHYGSRDAMLEAAKKRNDIRDVMMSKLAHELMPK* |
| Ga0074045_100509691 | 3300010341 | Bog Forest Soil | GKAVTISTKHYGSRDAMLDAAKKRSEIREVVASKLAREVMPK* |
| Ga0126378_106458271 | 3300010361 | Tropical Forest Soil | AATIIAKHYGSREAAFEAARKRSDLREVIASHLAREVTPK* |
| Ga0126379_103735982 | 3300010366 | Tropical Forest Soil | MRKAATISAKHYGSRDAMLEAAKKRNDIRDVVMSKLAHEVMPK* |
| Ga0126381_1010074752 | 3300010376 | Tropical Forest Soil | MRKAATTSAKHYGSRDAMLEAAKKRNDIRDVIMSKLAHEVMPK* |
| Ga0150983_143300941 | 3300011120 | Forest Soil | AATIVAKHYGSRDAMLEANKKRTDLRELVMSKLAREVMPK* |
| Ga0137389_114231121 | 3300012096 | Vadose Zone Soil | AEKHYGSREAMNDAARKRDDIREVVASHLAREVMPK* |
| Ga0137358_101151281 | 3300012582 | Vadose Zone Soil | QLDAKAATSVAKHYGSREAMIEAGKKRNDLREVVASKLAREVMPK* |
| Ga0182015_100801923 | 3300014495 | Palsa | DAKATPIVVKHYGSRESAFEAARKRSEIRDVVASHLAHEVIPK* |
| Ga0182015_105984792 | 3300014495 | Palsa | AATIVAKHYGSREAMIEAGKKRNEIREVVASKLAREVMPK* |
| Ga0182036_116691642 | 3300016270 | Soil | AKAATISAKHYGSREAMIEAGKKRSEIREVVMSKLAREVLPK |
| Ga0182041_110199042 | 3300016294 | Soil | DAKAATIAAKHYGSRDAMIEAGKKRNDLREVVASKVAREVMPK |
| Ga0182035_103961543 | 3300016341 | Soil | AKHYGSRDAMLDAAKKRNEIREVVMSKLAHEVMPK |
| Ga0182032_109309981 | 3300016357 | Soil | DTVDAKAATIAAKHYGSRDAMIEAGKKRNDLREVVASKVAREVMPK |
| Ga0182032_117342291 | 3300016357 | Soil | IAAKHYGSREAMIEAGKKRNDLREVVASKLAREVTPK |
| Ga0182034_112752142 | 3300016371 | Soil | VVKHYGSREAAFEAAKKRAEIREVVGSHLAREVTPK |
| Ga0182040_113280642 | 3300016387 | Soil | AKAATISAKHYGSRDAMLDAAKKRNDIRDVVMSKLAHEVMPK |
| Ga0182037_117955312 | 3300016404 | Soil | QLDAKAGAVVTKHYGSREAQMEAAKKRTESREVVASHLAREVTPK |
| Ga0182038_116822672 | 3300016445 | Soil | DAKAATISAKHYGSRDAMLDAAKKRNDIRDVVMSKLAHEVMPK |
| Ga0187818_103950251 | 3300017823 | Freshwater Sediment | ATIIAKHYGSREAMIEAGKKRNDIREVVASKLAREVMPK |
| Ga0187801_100514271 | 3300017933 | Freshwater Sediment | KAATIIAKHYGSREAMIEAGKKRNDLREVVASKLAREVMPK |
| Ga0187819_105235821 | 3300017943 | Freshwater Sediment | LDQSDAKAATIVVKHYGSREAAFEAARKRSDIREVVASHLAREVMPK |
| Ga0187819_108394761 | 3300017943 | Freshwater Sediment | QLDSKAATVVTKHYGSRDAMLEAGRKRNELRDVVLSKLAHEVMPK |
| Ga0187817_100072027 | 3300017955 | Freshwater Sediment | IIAKHYGSREAMIEAGKKRNDIREVVASKLAREVMPK |
| Ga0187817_100627164 | 3300017955 | Freshwater Sediment | IAKHYGSREAMIEAGKKRNEIREVVASKLAREVMPK |
| Ga0187778_110688882 | 3300017961 | Tropical Peatland | IDARAATIAAKHYGSREAMIEAGKKRIEIRFLVASKVAREVMPK |
| Ga0187783_102638542 | 3300017970 | Tropical Peatland | LDAKAATIAAKHYGSRDAMIEAGKRRSELREVIASHLAREVMLK |
| Ga0187780_114251621 | 3300017973 | Tropical Peatland | IDAKAGSLVTKHYGSREALMKAAKERNDIREVVASKVAREVTPK |
| Ga0187782_111366432 | 3300017975 | Tropical Peatland | LDAKAATISAKHYGSREAMIEAGKKRAEFRDVIASHLAREVTLK |
| Ga0187804_101259441 | 3300018006 | Freshwater Sediment | AKAATISTKHYGSRDAMLEAAKKRNDIREVVASKLAREVTPK |
| Ga0187889_101213541 | 3300018023 | Peatland | TILAKHYGSREAMIEAGKKRNEIREVVASKLAREVMPK |
| Ga0187863_102252441 | 3300018034 | Peatland | IAKHYGSREAMIEAGKKRNDIREVVASKLAHEVMPK |
| Ga0187883_100260315 | 3300018037 | Peatland | QADARAATILAKHYGSREAMIEAGKKRNEIREVVASKLAREVMPK |
| Ga0187883_100543523 | 3300018037 | Peatland | QLDAHAATILAKHYGSREAMIEAGKKRNEIREVVASKLAREVMPK |
| Ga0187862_104522062 | 3300018040 | Peatland | TISTKHYGSRDAMLDAAKKRNEIREVVASKLAHEVMPK |
| Ga0187851_100485591 | 3300018046 | Peatland | KAATIIAKHYGSREAMIEAGKKRNEIREVVASKLAREVMPK |
| Ga0187858_102029011 | 3300018057 | Peatland | KAATSVAKHYGSRDAMIEAGKKRNDLREVVASKLAREVMPK |
| Ga0210401_100002731 | 3300020583 | Soil | KAATLVAKHYGSRDAMIEAGKKRQDLREVVMSKLAREVMPK |
| Ga0210401_105380532 | 3300020583 | Soil | GIDAKAATIVAKHYGSRDAMLEAGKKRQDLREVVMSKLAREVMPK |
| Ga0210400_102609483 | 3300021170 | Soil | ATIVAKHYGSREAAFEAARKRSDFRDVVASHLAREVMPK |
| Ga0210388_107578622 | 3300021181 | Soil | AATLVAKNYGSRDAMIEAGKKRQDLREVVMSKLAREVMPK |
| Ga0210385_107966811 | 3300021402 | Soil | TSVAKHYGSRDAMIEAGKKRAELREVVASKLAREVMPK |
| Ga0210385_108057041 | 3300021402 | Soil | AKHYGSRDAAIEAGKMRAGLRDVVASHLAREVMLK |
| Ga0210386_113099762 | 3300021406 | Soil | AATIVAKHYGSRDAMIEAGKKRQDLREVVMSKLAREVMPK |
| Ga0210394_108993511 | 3300021420 | Soil | DAKAATIVAKHYGSRDAMIEAGKKRNDLREVVMSKLAREIMPK |
| Ga0210392_102669483 | 3300021475 | Soil | IDGIDAKAATIVAKHYGSRDAMLEAGKKRQDLREVVMSKLAREVMPK |
| Ga0126371_111849272 | 3300021560 | Tropical Forest Soil | MRKAATTSAKHYGSRDAMLEAAKKRNDIRDVMMSKLAHELMPK |
| Ga0242652_10520712 | 3300022510 | Soil | LDAKGATISAKHYGSRDAMIEAGKKRNDLREVVASKLAREVTPK |
| Ga0242660_11468431 | 3300022531 | Soil | AATIAAKHYGSRDAMIDAGKRRNEIREVVASKLAREVMPK |
| Ga0224552_100047010 | 3300022850 | Soil | AHAATILAKHYGSLEAMIEAGKKRNEIREVVASKLAREVMPK |
| Ga0209839_100350161 | 3300026294 | Soil | QIDAKAATISTKHYGSREAMLEAAKKRSEIREVVASKLAREVMPK |
| Ga0209731_10518742 | 3300027326 | Forest Soil | IAAKHYGSRDAMIDAGKKRNELREVVASKLAREVMPK |
| Ga0209008_10629931 | 3300027545 | Forest Soil | DQLDAKATPIIVKHYGSRDAAFEAVRKRSEIRDVVASHLAHEVMPK |
| Ga0209523_10081574 | 3300027548 | Forest Soil | ATIAAKHYGSRDAMIDAGKKRNELREVVASKLAREVVPK |
| Ga0209735_10956711 | 3300027562 | Forest Soil | LDAKATPIVVKHYGSRESAFEAARKRSEIRDVVASHLAHELIPK |
| Ga0208043_10187611 | 3300027570 | Peatlands Soil | IAKHYGSREAMIEAGKKRNEIRTVVASKLAREIMPK |
| Ga0209139_100489283 | 3300027795 | Bog Forest Soil | DAKATPIVVKHYGSREAAFEAARKRSEIREVVASHLAREVTPK |
| Ga0209580_103336252 | 3300027842 | Surface Soil | AKAASIAVKHYGSREAALEAARKRSDIRDVVASHLAREVTPK |
| Ga0209067_102440742 | 3300027898 | Watersheds | DAKAATIGAKHYGSRDAMLEAAKKRNDIRELVASKLAHEVMPK |
| Ga0209067_109579382 | 3300027898 | Watersheds | LVAKHYGSREAMLEAGRKRNELREVVSSKLAREVMPK |
| Ga0209006_105058652 | 3300027908 | Forest Soil | TIVAKHYGSRDAMLDAGKKRNDLREVVMSKLAREITPK |
| Ga0302149_11783181 | 3300028552 | Bog | HAATILAKHYGSREAMIEAGKKRNEIREVVASKLAREVMPK |
| Ga0302225_100692321 | 3300028780 | Palsa | TIKHFGSREAMLEAAKKRSDIRDVVASKLAREVTPK |
| Ga0302225_101598171 | 3300028780 | Palsa | IVTKHYGSREAMIEAGKRRTELREVIASHLAREVALK |
| Ga0302223_101336502 | 3300028781 | Palsa | DQLDAKAATISAQHYGSRDAMIEAGKKRADIREVTASKLAREVMPK |
| Ga0302222_103762361 | 3300028798 | Palsa | IDQADTKAATIIAKHYGSREAMIEAGKKRSEIREVVASKLAREVMPK |
| Ga0302230_101690522 | 3300028871 | Palsa | ATISAQHYGSRDAMIEAGKKRADIREVTASKLAREVMPK |
| Ga0308309_105050521 | 3300028906 | Soil | ATSVAKHYGSRDAMIEAGKKRAELREVVASKLAREVMPK |
| Ga0311340_104351973 | 3300029943 | Palsa | TIIAKHYGSREAMIEAGKKRNEIREVVASKLAREVMPK |
| Ga0311357_102017313 | 3300030524 | Palsa | ISAQHYGSRDAMIEAGKKRADIREVTASKLAREVMPK |
| Ga0302317_103687571 | 3300030677 | Palsa | DAKATPVVVKHYGSREAAFEAARKRSELRDVVASHLAHEVMPK |
| Ga0302309_105920042 | 3300030687 | Palsa | AATISAQHYGSRDAMIEAGKKRADIREVTASKLAREVMPK |
| Ga0265760_100383322 | 3300031090 | Soil | VTKTKHHGSREAMIEAGKKRSEIREVVASKLAREVTPK |
| Ga0302325_115920872 | 3300031234 | Palsa | MAKHYGSREAMIEAGKKRLEIRTVVASKLAREVTPK |
| Ga0170820_158558382 | 3300031446 | Forest Soil | VKHYGSREAGLEAAKKRAEIREVIASHLAREVMVK |
| Ga0310686_1048677762 | 3300031708 | Soil | QIDAKAATIVVKHYGSREAAFEAARKRSDIRDVVASHLAREVMPK |
| Ga0318501_105390552 | 3300031736 | Soil | DAKAATISAKHYGSREAMLEAGKKRNDIREVVASKLAHEVTPK |
| Ga0306918_110399881 | 3300031744 | Soil | AKHYGSREAMIEAGKKRNDLREVVASKLAREVIPK |
| Ga0307475_103329972 | 3300031754 | Hardwood Forest Soil | ISAKHYGSREAMIEAGKKRSEIREVVMSKLAREVLPK |
| Ga0307478_103927951 | 3300031823 | Hardwood Forest Soil | TIATKHYGSREAMIEAGKKRSELRDLVGSHLAREVMLK |
| Ga0318517_102131562 | 3300031835 | Soil | AVKHYGSREAAFEAQKKRAELRDVVGSHLAREVTPK |
| Ga0306923_125138882 | 3300031910 | Soil | DQLDAKAASIAVKHYGSREAAFEAQKKRAELRDVVGSHLAREVTPK |
| Ga0306921_119686802 | 3300031912 | Soil | IDAKAATISAKHYGSRDAMLDAAKKRNDIRDVVMSKLAHEVMPK |
| Ga0310912_104521232 | 3300031941 | Soil | DQIDAKAGTIAAKHYGSREAMIEAGKKRAETRQPVASKLAREVMPK |
| Ga0310912_113517462 | 3300031941 | Soil | DQIDAKAATISAKHYGSREAMIEAGKKRSEIREVVMSKLAREVLPK |
| Ga0306926_130247651 | 3300031954 | Soil | AGIVVKHYGSREAAFEAAKKRAEIREVVGSHLAREVTPK |
| Ga0307479_100285417 | 3300031962 | Hardwood Forest Soil | DAKAATSVAKHYGSREAMIEAGKKRNDLREVVASKLARQVMPK |
| Ga0307479_117638421 | 3300031962 | Hardwood Forest Soil | IATKHYGTREAMIEAGKKRADLREVIASHLAREVTPK |
| Ga0318540_103982271 | 3300032094 | Soil | ASIVVKHYGSREAAFEAAKKRAEIREVVGSHLAREVTPK |
| Ga0311301_109857921 | 3300032160 | Peatlands Soil | AKHYGSREAMIEAGKKRTEIREVVMSKLAHEVLPK |
| Ga0306920_1011208771 | 3300032261 | Soil | DQIDAKAATISAKHYGSRDAMLDAAKKRNEIREVVMSKLAHEVMPK |
| Ga0306920_1023832381 | 3300032261 | Soil | ATISAKHYGSREAMIEAGKKRNEIREVVMSKLAHEVMPK |
| Ga0326724_0050188_2919_3044 | 3300034091 | Peat Soil | KAATISTKHYGSRDAMLEAAKKRNEIREVVASKLAHEVMPK |
| ⦗Top⦘ |