


| Basic Information | |
|---|---|
| Family ID | F084503 |
| Family Type | Metagenome |
| Number of Sequences | 112 |
| Average Sequence Length | 42 residues |
| Representative Sequence | HIKRFKASGCRRITFRISTMGDPMAQFRRLVEDVLPYVD |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 112 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.57 % |
| % of genes near scaffold ends (potentially truncated) | 94.64 % |
| % of genes from short scaffolds (< 2000 bps) | 95.54 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.429 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (12.500 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.214 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.643 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.84% β-sheet: 0.00% Coil/Unstructured: 67.16% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 112 Family Scaffolds |
|---|---|---|
| PF01575 | MaoC_dehydratas | 28.57 |
| PF00106 | adh_short | 8.04 |
| PF02515 | CoA_transf_3 | 8.04 |
| PF03401 | TctC | 4.46 |
| PF13561 | adh_short_C2 | 3.57 |
| PF00857 | Isochorismatase | 1.79 |
| PF12728 | HTH_17 | 1.79 |
| PF11730 | DUF3297 | 1.79 |
| PF01546 | Peptidase_M20 | 1.79 |
| PF13531 | SBP_bac_11 | 0.89 |
| PF00924 | MS_channel | 0.89 |
| PF04055 | Radical_SAM | 0.89 |
| PF07693 | KAP_NTPase | 0.89 |
| PF01042 | Ribonuc_L-PSP | 0.89 |
| PF13517 | FG-GAP_3 | 0.89 |
| PF00181 | Ribosomal_L2 | 0.89 |
| COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
|---|---|---|---|
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 8.04 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 4.46 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 1.79 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.79 |
| COG0090 | Ribosomal protein L2 | Translation, ribosomal structure and biogenesis [J] | 0.89 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.89 |
| COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.89 |
| COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 0.89 |
| COG4928 | Predicted P-loop ATPase, KAP-like | General function prediction only [R] | 0.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.43 % |
| Unclassified | root | N/A | 3.57 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000597|AF_2010_repII_A1DRAFT_10074581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 856 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10095673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 734 | Open in IMG/M |
| 3300000816|AF_2010_repII_A10DRAFT_1020240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 703 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101075717 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 691 | Open in IMG/M |
| 3300004267|Ga0066396_10000394 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3149 | Open in IMG/M |
| 3300004268|Ga0066398_10000958 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2456 | Open in IMG/M |
| 3300004633|Ga0066395_10190978 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1066 | Open in IMG/M |
| 3300004633|Ga0066395_10422158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 755 | Open in IMG/M |
| 3300005165|Ga0066869_10047507 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 746 | Open in IMG/M |
| 3300005563|Ga0068855_100789544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1010 | Open in IMG/M |
| 3300005577|Ga0068857_100747084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 932 | Open in IMG/M |
| 3300005617|Ga0068859_102270032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 599 | Open in IMG/M |
| 3300005764|Ga0066903_106084219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 632 | Open in IMG/M |
| 3300005764|Ga0066903_108340972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 529 | Open in IMG/M |
| 3300005764|Ga0066903_109034834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 504 | Open in IMG/M |
| 3300006176|Ga0070765_100275814 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1548 | Open in IMG/M |
| 3300006178|Ga0075367_10727114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 631 | Open in IMG/M |
| 3300006872|Ga0101947_1038794 | Not Available | 870 | Open in IMG/M |
| 3300006881|Ga0068865_100119436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1957 | Open in IMG/M |
| 3300006903|Ga0075426_10822519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 699 | Open in IMG/M |
| 3300008886|Ga0115930_1020497 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1921 | Open in IMG/M |
| 3300009147|Ga0114129_12010041 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 699 | Open in IMG/M |
| 3300009148|Ga0105243_12160993 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300009792|Ga0126374_11239481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 599 | Open in IMG/M |
| 3300010358|Ga0126370_10203204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1499 | Open in IMG/M |
| 3300010358|Ga0126370_10859843 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 815 | Open in IMG/M |
| 3300010359|Ga0126376_12169683 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300010361|Ga0126378_13181726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 522 | Open in IMG/M |
| 3300010362|Ga0126377_11407127 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300010362|Ga0126377_11775704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 692 | Open in IMG/M |
| 3300010366|Ga0126379_10486418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1303 | Open in IMG/M |
| 3300010371|Ga0134125_10781177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1051 | Open in IMG/M |
| 3300010373|Ga0134128_12619086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 556 | Open in IMG/M |
| 3300010375|Ga0105239_10779185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1095 | Open in IMG/M |
| 3300010376|Ga0126381_101260124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1068 | Open in IMG/M |
| 3300010398|Ga0126383_12672037 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 582 | Open in IMG/M |
| 3300010400|Ga0134122_12318511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 583 | Open in IMG/M |
| 3300010401|Ga0134121_10386540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1261 | Open in IMG/M |
| 3300010868|Ga0124844_1101738 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1091 | Open in IMG/M |
| 3300010868|Ga0124844_1272390 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 585 | Open in IMG/M |
| 3300010999|Ga0138505_100066554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 531 | Open in IMG/M |
| 3300012189|Ga0137388_11162640 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 709 | Open in IMG/M |
| 3300012201|Ga0137365_10091014 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2297 | Open in IMG/M |
| 3300012205|Ga0137362_10279169 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1445 | Open in IMG/M |
| 3300012211|Ga0137377_11950524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 504 | Open in IMG/M |
| 3300012357|Ga0137384_10756612 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 787 | Open in IMG/M |
| 3300012469|Ga0150984_122530955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 788 | Open in IMG/M |
| 3300012916|Ga0157310_10462809 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 543 | Open in IMG/M |
| 3300012960|Ga0164301_11012186 | Not Available | 654 | Open in IMG/M |
| 3300012961|Ga0164302_10459551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 887 | Open in IMG/M |
| 3300012989|Ga0164305_11201431 | Not Available | 657 | Open in IMG/M |
| 3300014326|Ga0157380_10921713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 901 | Open in IMG/M |
| 3300014745|Ga0157377_10139923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1486 | Open in IMG/M |
| 3300015357|Ga0134072_10402911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 540 | Open in IMG/M |
| 3300015373|Ga0132257_103165243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 599 | Open in IMG/M |
| 3300015374|Ga0132255_103506407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 667 | Open in IMG/M |
| 3300015374|Ga0132255_105777513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 523 | Open in IMG/M |
| 3300016270|Ga0182036_10166125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1587 | Open in IMG/M |
| 3300016270|Ga0182036_10533537 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 933 | Open in IMG/M |
| 3300016404|Ga0182037_10326672 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1242 | Open in IMG/M |
| 3300017792|Ga0163161_11521480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 588 | Open in IMG/M |
| 3300018066|Ga0184617_1026374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1340 | Open in IMG/M |
| 3300018465|Ga0190269_11189488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 598 | Open in IMG/M |
| 3300018468|Ga0066662_10353777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1265 | Open in IMG/M |
| 3300019362|Ga0173479_10843353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 512 | Open in IMG/M |
| 3300019867|Ga0193704_1080677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 597 | Open in IMG/M |
| 3300021081|Ga0210379_10428688 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 585 | Open in IMG/M |
| 3300021560|Ga0126371_13788948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 510 | Open in IMG/M |
| 3300022756|Ga0222622_10432843 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 931 | Open in IMG/M |
| 3300025901|Ga0207688_10222138 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1138 | Open in IMG/M |
| 3300025915|Ga0207693_10754587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Promicromonosporaceae → Antribacter → unclassified Antribacter → Antribacter sp. KLBMP9083 | 751 | Open in IMG/M |
| 3300025923|Ga0207681_11606245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 544 | Open in IMG/M |
| 3300025926|Ga0207659_11296865 | Not Available | 625 | Open in IMG/M |
| 3300025930|Ga0207701_10562332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 973 | Open in IMG/M |
| 3300025945|Ga0207679_10664015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 944 | Open in IMG/M |
| 3300025972|Ga0207668_11052361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 728 | Open in IMG/M |
| 3300026023|Ga0207677_10912208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 792 | Open in IMG/M |
| 3300026118|Ga0207675_101859711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 621 | Open in IMG/M |
| 3300026295|Ga0209234_1181267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 734 | Open in IMG/M |
| 3300026328|Ga0209802_1318018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 515 | Open in IMG/M |
| 3300027371|Ga0209418_1075216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 605 | Open in IMG/M |
| 3300027866|Ga0209813_10394682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 556 | Open in IMG/M |
| 3300027874|Ga0209465_10246042 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 894 | Open in IMG/M |
| 3300027915|Ga0209069_10759147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 575 | Open in IMG/M |
| 3300028592|Ga0247822_11183816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 637 | Open in IMG/M |
| 3300028755|Ga0307316_10371696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 527 | Open in IMG/M |
| 3300028793|Ga0307299_10083515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1188 | Open in IMG/M |
| 3300028793|Ga0307299_10255870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 658 | Open in IMG/M |
| 3300028885|Ga0307304_10574935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 520 | Open in IMG/M |
| 3300031561|Ga0318528_10060167 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1937 | Open in IMG/M |
| 3300031716|Ga0310813_11088321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 732 | Open in IMG/M |
| 3300031716|Ga0310813_11140139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 716 | Open in IMG/M |
| 3300031723|Ga0318493_10241215 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 963 | Open in IMG/M |
| 3300031751|Ga0318494_10239224 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1040 | Open in IMG/M |
| 3300031764|Ga0318535_10041700 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1888 | Open in IMG/M |
| 3300031781|Ga0318547_10177732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1263 | Open in IMG/M |
| 3300031782|Ga0318552_10059732 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1824 | Open in IMG/M |
| 3300031792|Ga0318529_10117436 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1209 | Open in IMG/M |
| 3300031793|Ga0318548_10258284 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300031832|Ga0318499_10292905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 629 | Open in IMG/M |
| 3300031834|Ga0315290_11309784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 597 | Open in IMG/M |
| 3300031847|Ga0310907_10599844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → unclassified Comamonadaceae → Comamonadaceae bacterium | 600 | Open in IMG/M |
| 3300031890|Ga0306925_10275032 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1813 | Open in IMG/M |
| 3300031942|Ga0310916_10022855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4456 | Open in IMG/M |
| 3300031942|Ga0310916_11335366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 589 | Open in IMG/M |
| 3300031949|Ga0214473_11844009 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 596 | Open in IMG/M |
| 3300032052|Ga0318506_10052548 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1648 | Open in IMG/M |
| 3300032054|Ga0318570_10146816 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1053 | Open in IMG/M |
| 3300032054|Ga0318570_10543004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 530 | Open in IMG/M |
| 3300032075|Ga0310890_10093022 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1867 | Open in IMG/M |
| 3300033550|Ga0247829_10071961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2516 | Open in IMG/M |
| 3300034354|Ga0364943_0262659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 647 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.61% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.82% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 8.93% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.46% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.57% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.68% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.68% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.79% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.79% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.79% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.79% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.79% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.89% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.89% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.89% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.89% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.89% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.89% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.89% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.89% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.89% |
| Micrasterias Crux-Melitensis (Mzch 98) Associated | Host-Associated → Microbial → Bacteria → Unclassified → Unclassified → Micrasterias Crux-Melitensis (Mzch 98) Associated | 0.89% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.89% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.89% |
| Drinking Water Pipes | Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Drinking Water Pipes | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000816 | Forest soil microbial communities from Amazon forest - 2010 replicate II A10 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005165 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006178 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Host-Associated | Open in IMG/M |
| 3300006872 | Biofilm microbial communities from drinking water pipes in Singapore | Engineered | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300008886 | Microbial communities associated with unicellular green alga Micrasterias crux-melitensis, Germany - (MZCH: 98) | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300010999 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300019867 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1 | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300027371 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027866 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A1DRAFT_100745813 | 3300000597 | Forest Soil | RFKAAGCRRMTFRISTMGDXMAQFRRLVEDVLPYVD* |
| AF_2010_repII_A1DRAFT_100956731 | 3300000597 | Forest Soil | MARRRECVEHIKRFKASGCRRITFRISTMGDPMAQFQRLVEDVLPYVD* |
| AF_2010_repII_A10DRAFT_10202402 | 3300000816 | Forest Soil | ECVEHIKRFKASGCRRITFRISTMGDPMAQFQRLVEDVLPYVD* |
| JGIcombinedJ26739_1010757171 | 3300002245 | Forest Soil | HIKLFKASGCRRITFRISTMGDPMAQLRRLVEDVLPYVD* |
| Ga0066396_100003942 | 3300004267 | Tropical Forest Soil | MNFGITLSKQIKRYKARRVVGITFWISTMGDQMAQFRRVIEDVLPYLD* |
| Ga0066398_100009583 | 3300004268 | Tropical Forest Soil | MNFGITLSKQIKRYKARRVVGRITFWISTMGDQMAQFRRVIEDVLPYLD* |
| Ga0066395_101909782 | 3300004633 | Tropical Forest Soil | MNFGITLSKQIKRYKARRVVGRITFWISTIGDQMAQFRRVIEDVLPYLD* |
| Ga0066395_104221582 | 3300004633 | Tropical Forest Soil | YGSPRECVEHIKRFKASGCRRITFRISTMGDPMAQFRRLVEDVLPYVD* |
| Ga0066869_100475071 | 3300005165 | Soil | CVEHIKRFKASGCRRITFRISTMGDPMAQFRRLVEDVLPYVD* |
| Ga0068855_1007895441 | 3300005563 | Corn Rhizosphere | GSPRDCIAQLKQFKASGCRRITFRISTMGDPMEQFRRVTQEVLPFVN* |
| Ga0068857_1007470841 | 3300005577 | Corn Rhizosphere | HLRQFKASGCRRITFRISTMGDPMEQFRRVTQEVLPFVN* |
| Ga0068859_1022700322 | 3300005617 | Switchgrass Rhizosphere | HLRQFKASGCRRITFRISTMGDPMEQFRRVTQEVLPFVD* |
| Ga0066903_1060842191 | 3300005764 | Tropical Forest Soil | LQRYAACGCRRITFRISTMGDPMAQFRRLAEEVLPFV* |
| Ga0066903_1083409721 | 3300005764 | Tropical Forest Soil | CVEHIKRFKAAGCRRITFRISTMGDVMEQFRRLVEEVLPYID* |
| Ga0066903_1090348342 | 3300005764 | Tropical Forest Soil | ECVEHIKRFKASGCRRITFRISTMRDPMAQFQRLVEDVLPYVD* |
| Ga0070765_1002758141 | 3300006176 | Soil | ECVEHIKLFKASGCRRITFRISTMGDPMVQFRRLVEDVLPYVD* |
| Ga0075367_107271142 | 3300006178 | Populus Endosphere | DCIEHLKQFKASGCRRITFRISTMGDPMEQFRRVAEEVLPFVD* |
| Ga0101947_10387942 | 3300006872 | Drinking Water Pipes | EDLKKWKAAGCKRLTFRISTMGDPLKQLKRVAEEVLPFV* |
| Ga0068865_1001194361 | 3300006881 | Miscanthus Rhizosphere | QFKASGCRRITFRISTMGDPMQQFRRVAEEVLPFVD* |
| Ga0075426_108225192 | 3300006903 | Populus Rhizosphere | PRDCVEQIKRYKASGCRRITFRISTMGDQMAQFRRVIEDVLPYVD* |
| Ga0115930_10204971 | 3300008886 | Micrasterias Crux-Melitensis (Mzch 98) Associated | HLRQFKNSGCNRVTFRISTMGDPMAVFRRAVEEVLPFV* |
| Ga0114129_120100412 | 3300009147 | Populus Rhizosphere | FKASGCRRITFRISTMGDPMEQFRRLVEDVLAYVD* |
| Ga0105243_121609931 | 3300009148 | Miscanthus Rhizosphere | TPRDCIEQLKRYKEAGCNRVTFRISTMGDPMAQLRRVTEEVLPFV* |
| Ga0126374_112394811 | 3300009792 | Tropical Forest Soil | DCIAHLQQYKASGCRRITFRISTMGDPMAQLRRVTEEVLPFVN* |
| Ga0126370_102032041 | 3300010358 | Tropical Forest Soil | AHLKRFKAAGCRRITFRISTMGDPMAQFRRLVEDVLPYVD* |
| Ga0126370_108598432 | 3300010358 | Tropical Forest Soil | YGAPRDCIAQLRAFKSCGCRRITFRIATMGDPMTQLRRLAEEVLPFV* |
| Ga0126376_121696831 | 3300010359 | Tropical Forest Soil | RDCIEHIRQFRACGCRRITFRISTMRDPLAQFRRLVEDVLPHVG* |
| Ga0126378_131817261 | 3300010361 | Tropical Forest Soil | KASGCRRITFRISTMRDPMAQFQRLVEDVLPYVD* |
| Ga0126377_114071273 | 3300010362 | Tropical Forest Soil | PRECVEHIKRFKASGCRRITFRISTMGDPMAQFRRLVEDVLPYVD* |
| Ga0126377_117757041 | 3300010362 | Tropical Forest Soil | PRDCIAHLQRYAACGCRRITFRISTMGDAMAQLRRLVDEVLPYV* |
| Ga0126379_104864182 | 3300010366 | Tropical Forest Soil | SPRDCIAHLKQYKASGCRRITFRISTMGDPMAQLRRVTEEVLPFVS* |
| Ga0134125_107811771 | 3300010371 | Terrestrial Soil | CIEHLRQFKASGCRRITFRISTMGDPMEQFRRVTQEVLPFVN* |
| Ga0134128_126190861 | 3300010373 | Terrestrial Soil | LFKASGCRRIIFRISTMGDPMEQFRRIAEEVLPFVV* |
| Ga0105239_107791852 | 3300010375 | Corn Rhizosphere | LKQFKASGCRRITFRISTMGDPMEQFRRLAEEVLPFVD* |
| Ga0126381_1012601241 | 3300010376 | Tropical Forest Soil | IKRFKAAGCRRITFRISTMGDVMEQFRRLVEDVLPYVD* |
| Ga0126383_126720371 | 3300010398 | Tropical Forest Soil | HIKRFKASGCRRITFRISTMGDPMAQFRRLVEDVLPYVD* |
| Ga0134122_123185112 | 3300010400 | Terrestrial Soil | QFKASGCRRITFRISTMGDPMEQFRRVAEEVLPFVE* |
| Ga0134121_103865401 | 3300010401 | Terrestrial Soil | PRDCIEHLRQYKEAGCNRVTFRISTMGDPMAQLRRVTEEVLPFV* |
| Ga0124844_11017383 | 3300010868 | Tropical Forest Soil | IRRFKASGCRRITFRISTMRDPMAQFQRLVEDVLPYVD* |
| Ga0124844_12723901 | 3300010868 | Tropical Forest Soil | RFKVKASGCRRITFRISTMRDPMAQFQRLVEDVLPYVD* |
| Ga0138505_1000665541 | 3300010999 | Soil | PRECIAHLKQFKASGCRRITFRISTMGDPIEQFRRVAEEVLPFVN* |
| Ga0137388_111626401 | 3300012189 | Vadose Zone Soil | VQIEQLKASGCRRITFRISTMGDPMAQLRRVVDEVLPFVD* |
| Ga0137365_100910141 | 3300012201 | Vadose Zone Soil | GSPRDCIAHLKRFKAAGCRRITFRISTMGDPMAQFRRLVEDVLPYVD* |
| Ga0137362_102791691 | 3300012205 | Vadose Zone Soil | WLPYGSPRECVEHIKLFKASGCRRITFRISTMGDPMAQLRRLVEDVLPYVD* |
| Ga0137377_119505241 | 3300012211 | Vadose Zone Soil | RFKAAGCRRITFRISTMGDPMAQFRRLVEDVLPYVD* |
| Ga0137384_107566122 | 3300012357 | Vadose Zone Soil | FKASGCRRITFRISTMGDPMQQFRRVVEDVLPYVD* |
| Ga0150984_1225309551 | 3300012469 | Avena Fatua Rhizosphere | DCIEHLRQFKASGCRRITFRISTMGDPMEQFRRLAEEVLPFVD* |
| Ga0157310_104628091 | 3300012916 | Soil | YGSPRDCIEHLKRYKEAGCNRVTFRISTMGDPMAQLRRVTEEVLPFV* |
| Ga0164301_110121861 | 3300012960 | Soil | ACIEHLKLFQAAGGRRLTFRIPTLGDPMEPFRRIAEEVLPFVV* |
| Ga0164302_104595511 | 3300012961 | Soil | LKQFKASGCRRITFRISTMGDPMRQLRRVAEEVLPFVD* |
| Ga0164305_112014311 | 3300012989 | Soil | YGSPRDCIEHLKRYKDAGCHRVTFRISTMGDPMAQLKRVTEEVLPFV* |
| Ga0157380_109217132 | 3300014326 | Switchgrass Rhizosphere | QLKQFKASGSRRITFRISTMGDPMEQFRRLAEEVLPFVD* |
| Ga0157377_101399231 | 3300014745 | Miscanthus Rhizosphere | RDCIAQLKQFKASGCRRITFRISTMGDPMEQFRRVTQEVLPFVN* |
| Ga0134072_104029111 | 3300015357 | Grasslands Soil | GSPRECVEQIKGYKASGCRRITFRISTMGDQMAQFRRVIEDVLPYVD* |
| Ga0132257_1031652431 | 3300015373 | Arabidopsis Rhizosphere | RDCIAHLQSFAASGCRRITFRISTMGDPMAQLRRLVEEVLPYV* |
| Ga0132255_1035064071 | 3300015374 | Arabidopsis Rhizosphere | YGSPRDCIEHLKLFKASGCRRITFRISTMGDPMEQFRRVAEEVLPFVE* |
| Ga0132255_1057775132 | 3300015374 | Arabidopsis Rhizosphere | FAASGCRRITFRISTMGDPMAQLRRLVEEVLPYV* |
| Ga0182036_101661253 | 3300016270 | Soil | KRFKASGCRRITFRISTMGDPMAQFRRLVEDVLQYVD |
| Ga0182036_105335371 | 3300016270 | Soil | HIKRFKASGCRRITFRISTMGDPMAQFQRLVEDVLPYVD |
| Ga0182037_103266723 | 3300016404 | Soil | YGSPRECVEHIKRFKASGCRRITFRISTMGDPMAQLQRLVEDVLPYVD |
| Ga0163161_115214801 | 3300017792 | Switchgrass Rhizosphere | HIKRFKASGCRRITFRISTMGDAMEQFRRLVEDVLPYVD |
| Ga0184617_10263742 | 3300018066 | Groundwater Sediment | YGSPRDCIEHLKQFKASGCRRITFRISTMGDPMEQFRRVAEEVLPFVN |
| Ga0190269_111894881 | 3300018465 | Soil | DCIEHLRQFKASGCRRITFRISTMGDPMEQFRRVTQEVLPFVN |
| Ga0066662_103537773 | 3300018468 | Grasslands Soil | ECVEHIKGFKASGCRRITFRISTMGDPMEQFRRLVEDVLPYVD |
| Ga0173479_108433532 | 3300019362 | Soil | KQFKASGCRRITFRISTMGDPMEQFRRLAEEVLPFVD |
| Ga0193704_10806771 | 3300019867 | Soil | AHLKQFKASGCRRITFRISTMGDPMEQFRRVAEEVLPFVN |
| Ga0210379_104286882 | 3300021081 | Groundwater Sediment | IAQLAQFKASGCRRITFRISTMGDPMAQLRRVVEEVLPGVR |
| Ga0126371_137889482 | 3300021560 | Tropical Forest Soil | FKAAGCRRITFRISTMGDPMAQFRRLVEDVLPYVD |
| Ga0222622_104328431 | 3300022756 | Groundwater Sediment | PRDCIAQLKQFKASGCRRITFRISTMRDPMTQFRRVVDEVLPFV |
| Ga0207688_102221381 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | KQFKASGCRRITFRISTMGDPMRQLRRVAEEVLPFVD |
| Ga0207693_107545872 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VCFAARRDADRDCVAQLQQFKASGCRRITFRISTMRDPIAQLRRVVEEVLPFV |
| Ga0207681_116062452 | 3300025923 | Switchgrass Rhizosphere | SPRDCIEHLKQFKASGCRRITFRISTMGDPMRQLRRVAEEVLPFVD |
| Ga0207659_112968651 | 3300025926 | Miscanthus Rhizosphere | DCIVHLRRFKESGCNRVTFRISTMGDPMAQLRRVAEEVLPFV |
| Ga0207701_105623322 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | DCIEQLKRYKEVGCNRVTFRISTMGDPMAQLRRVTEEVLPFV |
| Ga0207679_106640152 | 3300025945 | Corn Rhizosphere | CIAQLKQFKASGCRRITFRISTMGDPMEQFRRVTQEVLPFVN |
| Ga0207668_110523611 | 3300025972 | Switchgrass Rhizosphere | RDCIAQLKQFKASGCRRITFRISTMGDPMEQFRRVTQEVLPFVN |
| Ga0207677_109122082 | 3300026023 | Miscanthus Rhizosphere | KQFKASGCRRITFRISTMGDPMQQFRRVAEEVLPFVD |
| Ga0207675_1018597111 | 3300026118 | Switchgrass Rhizosphere | SPRDCIEHLKRFKAHGCRRVTFRISTMADPLQQLRRVVEEVLPFV |
| Ga0209234_11812673 | 3300026295 | Grasslands Soil | HLKRFKAAGCRRITFRISTMGDPMAQFRRLVEDVLPYVD |
| Ga0209802_13180181 | 3300026328 | Soil | RECVEHIKRFKASGCRRITFRISTMGDPMAQLRRLVEDVLPYVD |
| Ga0209418_10752162 | 3300027371 | Forest Soil | LKASGCRRITFRISTMGDAMEQFRRLVEDVLPYVD |
| Ga0209813_103946822 | 3300027866 | Populus Endosphere | FKASGCRRITFRISTMGDPMEQFRRVAEEVLPFVD |
| Ga0209465_102460423 | 3300027874 | Tropical Forest Soil | KRFKASGCRRITFRISTMRDPMAQFQRLVEDVLPYVD |
| Ga0209069_107591471 | 3300027915 | Watersheds | IAHLRQFKACGCRRITFRISTMGDPMAQLRRVTEEVLPFV |
| Ga0247822_111838162 | 3300028592 | Soil | FKASGCRRITFRISTMGDPMEQFRRVTQEVLPFVN |
| Ga0307316_103716961 | 3300028755 | Soil | IAQLKEFKASGCRRITFRISTMGDPMEQFRRVAEEVLPFVN |
| Ga0307299_100835151 | 3300028793 | Soil | AHLKEFKASGCRRITFRISTMGDPMEQFRRVAEEVLPFVN |
| Ga0307299_102558701 | 3300028793 | Soil | SWLTYGPPRDCIAQLKQFKASGCRRITFRISTMRDPMTQFRRVVDEVLPFV |
| Ga0307304_105749351 | 3300028885 | Soil | TYGSPRECIAHLKQFKASGCRRITFRISTMGDPMEQFRRVAEEVLPFVN |
| Ga0318528_100601674 | 3300031561 | Soil | HIKRFKASGCRRIIFRISTMGDPMAQFQRLVEDVLPYVD |
| Ga0310813_110883212 | 3300031716 | Soil | EHLRRYKAAGCNRVTFRISTMGDPMAQLKRVTDEVLPFV |
| Ga0310813_111401391 | 3300031716 | Soil | YGSPRDCIEHLKQFKASGCRRITFRISTMGDPMRQLRRVAEEVLPFVD |
| Ga0318493_102412151 | 3300031723 | Soil | IKRFKASGCRRITFRISTMRDPMAQFQRLVEDVLPYVD |
| Ga0318494_102392243 | 3300031751 | Soil | TYGSPRECVEHIKRFKASGCRRITFRISTMGDPMAQFQRLVEDVLPYVD |
| Ga0318535_100417004 | 3300031764 | Soil | GSPRECVEHIKRFKASGCRRIIFRISTMGDPMAQFQRLVEDVLPYVD |
| Ga0318547_101777321 | 3300031781 | Soil | CVEHIKRFKASGCRRITFRISTMGDPMAQFQRLVEDVLPYVD |
| Ga0318552_100597321 | 3300031782 | Soil | ECVEHIKRFKASGCRRITFRISTMGDPMAQFQRLVEDVLPYVD |
| Ga0318529_101174363 | 3300031792 | Soil | IKRFKASGCRRITFRISTMGDPMAQFQRLVEDVLPYVD |
| Ga0318548_102582841 | 3300031793 | Soil | YGSPRECVEHIKRFKASGCRRITFRISTMGDPMAQFQRLVEDVLPYVD |
| Ga0318499_102929052 | 3300031832 | Soil | RFKAAGCRRITFRISTMGDPIVQFQRLVEDVLPYVD |
| Ga0315290_113097842 | 3300031834 | Sediment | YGSPRNCIEHLKQFKASGCRRVTFRISTMGDPMAQLRRVVEEVLPFV |
| Ga0310907_105998442 | 3300031847 | Soil | CIEHLKRFKAHGCRRITFRISTMADPLRQLRRVVEEVLPFV |
| Ga0306925_102750321 | 3300031890 | Soil | EHIKRFKASGCRRIIFRISTMGDPMAQFQRLVEDVLPYVD |
| Ga0310916_100228551 | 3300031942 | Soil | ECVEHIKRFKASGCRRITFRISTMGDPMAQFRRLVEDVLQYVD |
| Ga0310916_113353662 | 3300031942 | Soil | HIKRFKASGCRRITFRISTMGDPMAQFRRLVEDVLPYVD |
| Ga0214473_118440091 | 3300031949 | Soil | GSPRDCIEHIERFKASGCRRITFRISTMRDPMAQFRRLVEDVLPYVE |
| Ga0318506_100525484 | 3300032052 | Soil | AWLIHGSPRECVEHIKRFKASGCRRIIFRISTMGDPMAQFQRLVEDVLPYVD |
| Ga0318570_101468161 | 3300032054 | Soil | WLTHGSPRECVEHIKRFKASGCRRIIFRISTMGDPMAQFQRLVEDVLPYVD |
| Ga0318570_105430042 | 3300032054 | Soil | RRFKAAGCRRITFRISTMGDPIVQFQRLVEDVLPYVD |
| Ga0310890_100930221 | 3300032075 | Soil | LKTYKASGCRRVTFRISTMGDPMAQLRRVTEEVLPFV |
| Ga0247829_100719611 | 3300033550 | Soil | HLKRYKAHGCRRVTFRISTMGDPMTQLRRVTEEVLPFV |
| Ga0364943_0262659_506_646 | 3300034354 | Sediment | GSPRDCIEHLKRFKAHGCRRITFRISTMADPLRQLRRVVEEVLPFV |
| ⦗Top⦘ |