


| Basic Information | |
|---|---|
| Family ID | F084413 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 112 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MLSGIDDPGESRMGEISMSGSTREREAAVIGLRAFHSVLSSLLY |
| Number of Associated Samples | 102 |
| Number of Associated Scaffolds | 112 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 61.26 % |
| % of genes near scaffold ends (potentially truncated) | 69.64 % |
| % of genes from short scaffolds (< 2000 bps) | 81.25 % |
| Associated GOLD sequencing projects | 99 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.29 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (83.036 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (14.286 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.464 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (35.714 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.94% β-sheet: 0.00% Coil/Unstructured: 68.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 112 Family Scaffolds |
|---|---|---|
| PF08388 | GIIM | 86.61 |
| PF01261 | AP_endonuc_2 | 1.79 |
| PF00072 | Response_reg | 0.89 |
| PF00908 | dTDP_sugar_isom | 0.89 |
| PF04321 | RmlD_sub_bind | 0.89 |
| PF00005 | ABC_tran | 0.89 |
| PF14236 | DUF4338 | 0.89 |
| PF00078 | RVT_1 | 0.89 |
| PF06439 | 3keto-disac_hyd | 0.89 |
| PF01565 | FAD_binding_4 | 0.89 |
| PF01850 | PIN | 0.89 |
| COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
|---|---|---|---|
| COG0451 | Nucleoside-diphosphate-sugar epimerase | Cell wall/membrane/envelope biogenesis [M] | 1.79 |
| COG0702 | Uncharacterized conserved protein YbjT, contains NAD(P)-binding and DUF2867 domains | General function prediction only [R] | 1.79 |
| COG1086 | NDP-sugar epimerase, includes UDP-GlcNAc-inverting 4,6-dehydratase FlaA1 and capsular polysaccharide biosynthesis protein EpsC | Cell wall/membrane/envelope biogenesis [M] | 1.79 |
| COG1087 | UDP-glucose 4-epimerase | Cell wall/membrane/envelope biogenesis [M] | 0.89 |
| COG1088 | dTDP-D-glucose 4,6-dehydratase | Cell wall/membrane/envelope biogenesis [M] | 0.89 |
| COG1089 | GDP-D-mannose dehydratase | Cell wall/membrane/envelope biogenesis [M] | 0.89 |
| COG1090 | NAD dependent epimerase/dehydratase family enzyme | General function prediction only [R] | 0.89 |
| COG1091 | dTDP-4-dehydrorhamnose reductase | Cell wall/membrane/envelope biogenesis [M] | 0.89 |
| COG1898 | dTDP-4-dehydrorhamnose 3,5-epimerase or related enzyme | Cell wall/membrane/envelope biogenesis [M] | 0.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.04 % |
| Unclassified | root | N/A | 16.96 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000313|WSSedB1CaDRAFT_10085890 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300002558|JGI25385J37094_10063553 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 1200 | Open in IMG/M |
| 3300002909|JGI25388J43891_1051780 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300002912|JGI25386J43895_10019626 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1984 | Open in IMG/M |
| 3300002914|JGI25617J43924_10056384 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1433 | Open in IMG/M |
| 3300002916|JGI25389J43894_1042082 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300002933|G310J44882_10023121 | Not Available | 1574 | Open in IMG/M |
| 3300004025|Ga0055433_10011820 | Not Available | 1381 | Open in IMG/M |
| 3300004156|Ga0062589_100650934 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300005167|Ga0066672_10116762 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1645 | Open in IMG/M |
| 3300005171|Ga0066677_10047146 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2140 | Open in IMG/M |
| 3300005172|Ga0066683_10850160 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 526 | Open in IMG/M |
| 3300005179|Ga0066684_10078475 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1972 | Open in IMG/M |
| 3300005180|Ga0066685_10299844 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1112 | Open in IMG/M |
| 3300005466|Ga0070685_10097332 | Not Available | 1791 | Open in IMG/M |
| 3300005491|Ga0074212_107032 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300005544|Ga0070686_100413856 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
| 3300005554|Ga0066661_10337791 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300005556|Ga0066707_10119230 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1643 | Open in IMG/M |
| 3300005559|Ga0066700_10084647 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2044 | Open in IMG/M |
| 3300005561|Ga0066699_11051213 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 562 | Open in IMG/M |
| 3300006224|Ga0079037_100748980 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300006797|Ga0066659_10073014 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2251 | Open in IMG/M |
| 3300006854|Ga0075425_100449765 | Not Available | 1483 | Open in IMG/M |
| 3300006904|Ga0075424_101697402 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300009012|Ga0066710_100051342 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 5104 | Open in IMG/M |
| 3300009037|Ga0105093_10879401 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300009111|Ga0115026_11025096 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300009131|Ga0115027_10342168 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
| 3300009131|Ga0115027_10375201 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300009137|Ga0066709_100152423 | All Organisms → cellular organisms → Bacteria | 2958 | Open in IMG/M |
| 3300009156|Ga0111538_10083694 | All Organisms → cellular organisms → Bacteria | 4059 | Open in IMG/M |
| 3300009502|Ga0114951_10225517 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300009537|Ga0129283_10061933 | Not Available | 1503 | Open in IMG/M |
| 3300009553|Ga0105249_10120861 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2489 | Open in IMG/M |
| 3300009553|Ga0105249_11635278 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300009636|Ga0116112_1042184 | Not Available | 1383 | Open in IMG/M |
| 3300010301|Ga0134070_10160501 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300010301|Ga0134070_10446825 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300010322|Ga0134084_10094358 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300010325|Ga0134064_10124397 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300010335|Ga0134063_10042043 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1976 | Open in IMG/M |
| 3300010335|Ga0134063_10265711 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 819 | Open in IMG/M |
| 3300010397|Ga0134124_10017057 | All Organisms → cellular organisms → Bacteria | 5919 | Open in IMG/M |
| 3300010429|Ga0116241_10336490 | Not Available | 1203 | Open in IMG/M |
| 3300011430|Ga0137423_1155074 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300012200|Ga0137382_10104240 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1876 | Open in IMG/M |
| 3300012206|Ga0137380_10360007 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1297 | Open in IMG/M |
| 3300012207|Ga0137381_10307228 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1381 | Open in IMG/M |
| 3300012209|Ga0137379_11384996 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300012210|Ga0137378_11707054 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 536 | Open in IMG/M |
| 3300012211|Ga0137377_10477329 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1185 | Open in IMG/M |
| 3300012349|Ga0137387_10456863 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300012353|Ga0137367_10387094 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300012354|Ga0137366_10161967 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1680 | Open in IMG/M |
| 3300012356|Ga0137371_10501133 | Not Available | 937 | Open in IMG/M |
| 3300012359|Ga0137385_11619058 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300012362|Ga0137361_10162099 | Not Available | 2006 | Open in IMG/M |
| 3300012362|Ga0137361_11382374 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300012380|Ga0134047_1135674 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300012922|Ga0137394_10960730 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300012972|Ga0134077_10141926 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
| 3300014157|Ga0134078_10254043 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300015259|Ga0180085_1174113 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300015357|Ga0134072_10495890 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300018054|Ga0184621_10107699 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
| 3300018054|Ga0184621_10221023 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300019360|Ga0187894_10052638 | All Organisms → cellular organisms → Bacteria | 2380 | Open in IMG/M |
| 3300020006|Ga0193735_1105007 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300020010|Ga0193749_1017741 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1393 | Open in IMG/M |
| 3300020074|Ga0194113_10004766 | All Organisms → cellular organisms → Bacteria | 17711 | Open in IMG/M |
| 3300021968|Ga0193698_1009877 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1205 | Open in IMG/M |
| 3300024186|Ga0247688_1077489 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300025936|Ga0207670_10298251 | Not Available | 1261 | Open in IMG/M |
| 3300025961|Ga0207712_11504925 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300026309|Ga0209055_1240107 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300026310|Ga0209239_1188019 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300026316|Ga0209155_1024908 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2471 | Open in IMG/M |
| 3300026536|Ga0209058_1045546 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2547 | Open in IMG/M |
| 3300026536|Ga0209058_1315140 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300026538|Ga0209056_10185554 | Not Available | 1541 | Open in IMG/M |
| 3300026540|Ga0209376_1119502 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1312 | Open in IMG/M |
| 3300026552|Ga0209577_10107228 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2255 | Open in IMG/M |
| 3300027846|Ga0209180_10173082 | Not Available | 1245 | Open in IMG/M |
| 3300027875|Ga0209283_10089785 | Not Available | 2001 | Open in IMG/M |
| 3300027890|Ga0209496_10332491 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300027900|Ga0209253_10483752 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300027905|Ga0209415_10510419 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300028647|Ga0272412_1037970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 2034 | Open in IMG/M |
| 3300029922|Ga0311363_11323478 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300029952|Ga0311346_11235106 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300031344|Ga0265316_10060158 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2953 | Open in IMG/M |
| 3300031524|Ga0302320_10330857 | Not Available | 1988 | Open in IMG/M |
| 3300031813|Ga0316217_10057320 | Not Available | 2011 | Open in IMG/M |
| 3300031997|Ga0315278_10950306 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300032156|Ga0315295_10896505 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300032164|Ga0315283_10902679 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
| 3300032256|Ga0315271_10222384 | Not Available | 1521 | Open in IMG/M |
| 3300032256|Ga0315271_10319098 | Not Available | 1282 | Open in IMG/M |
| 3300032275|Ga0315270_10407008 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300032397|Ga0315287_10999680 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
| 3300032397|Ga0315287_12123853 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300032401|Ga0315275_11299946 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300032516|Ga0315273_10256295 | All Organisms → cellular organisms → Bacteria | 2382 | Open in IMG/M |
| 3300032516|Ga0315273_12585927 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300033402|Ga0326728_10517756 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300033405|Ga0326727_10442085 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1165 | Open in IMG/M |
| 3300033416|Ga0316622_100975897 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300033418|Ga0316625_100412327 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300033483|Ga0316629_11799469 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300033485|Ga0316626_10085690 | Not Available | 2265 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 13.39% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 9.82% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 8.93% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 7.14% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.46% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 3.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.68% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.68% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.68% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 1.79% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.79% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.79% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.79% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.79% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.79% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.89% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.89% |
| Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Sediment | 0.89% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.89% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.89% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.89% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.89% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.89% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.89% |
| Beach Aquifer Porewater | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater | 0.89% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.89% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.89% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.89% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.89% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.89% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.89% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000313 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site B1 Cattail | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
| 3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300002916 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002933 | Combined Assembly of freshwater hypolimnion microbial communities from Trout Bog Lake, Wisconsin, USA | Environmental | Open in IMG/M |
| 3300004025 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005491 | Sediment ecosystem from Lake Washington, Seattle, Washington, USA - Formaldehyde enrichment | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009037 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009502 | Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG | Environmental | Open in IMG/M |
| 3300009537 | Microbial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - D-2W | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009636 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010429 | AD_USRAca | Engineered | Open in IMG/M |
| 3300011430 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012380 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300015259 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10D | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300019360 | White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300020010 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s2 | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300021968 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c1 | Environmental | Open in IMG/M |
| 3300024186 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK29 | Environmental | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027890 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028647 | Metatranscriptome of activated sludge microbial communities from WWTP in Nijmegen, Gelderland, Netherland - WWTP Weurt (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029952 | II_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031813 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - 1anoA | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300033416 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033483 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033485 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| WSSedB1CaDRAFT_100858901 | 3300000313 | Wetland | MLSGRADLGESRMGEISMSGSTRERGAVVIGLRTFHSLLSSLLYW |
| JGI25385J37094_100635533 | 3300002558 | Grasslands Soil | MLPGRDDSGESRMREICTSGSTRERGTAVIDAIVFHSVFSSLLYRF |
| JGI25388J43891_10517802 | 3300002909 | Grasslands Soil | MLSGRDDSGESRMREICMSGSTRERGAAVIDAIVFHSVLSSLLYR |
| JGI25386J43895_100196261 | 3300002912 | Grasslands Soil | MLPGRDDSGESRMREICTSGSTRESGTAVIDAIVFHSVFSSLLYRF |
| JGI25617J43924_100563842 | 3300002914 | Grasslands Soil | MFSGIDDPGESRMGEISMSGSTREREAAVIGLWAFHSVLSSLLYW |
| JGI25389J43894_10420822 | 3300002916 | Grasslands Soil | MLSGRADLGESRMGETSMSGSTRERGAAVIDAIVFHSVLSSLLYW |
| G310J44882_100231211 | 3300002933 | Freshwater | MLAGKDDAGESRMGEISMSGLTRERGPSGTDNCGRFNSIMDTSLLYWFLNCXXXI |
| Ga0055433_100118202 | 3300004025 | Natural And Restored Wetlands | MLAGKADAGESRMGEISMSGSTRERGAAVIGLWAFHSVLSS |
| Ga0062589_1006509342 | 3300004156 | Soil | MLAGGDDVGESRMGEISMSGLTRERRAAVIGLRTSHSVLSSLLYRF* |
| Ga0066672_101167622 | 3300005167 | Soil | MLSGIDDPGESRMGEISMSGSTREREAAVIGLWAFHPVLSSLLYRFLLGFLVSLL* |
| Ga0066677_100471461 | 3300005171 | Soil | MLSGRADSGESRMREICMSGSTRERGAAVIDAIVFHSVLSSLLYRLILRISFSFS |
| Ga0066683_108501602 | 3300005172 | Soil | MLSGRADPGESRMGETSMSGSTRERGAAVIDAIVFHSVLSSLLYCPSVVKLKI* |
| Ga0066684_100784753 | 3300005179 | Soil | MLSGRADSGESRMREICMSGSTRERGAAVIDAIVFHSVLSSLLYR |
| Ga0066685_102998442 | 3300005180 | Soil | ADPGESRMGETSMSGSTRERGAAVIDAIVFHSVLSSLLYCPSVVKLKI* |
| Ga0070685_100973322 | 3300005466 | Switchgrass Rhizosphere | VGESRMGEISMSGLTRERRAAVIGLRTSHSVLSSLLYRFKQVFPMNSK |
| Ga0074212_1070321 | 3300005491 | Sediment | MLSGKDDAGESRMGEISMSGLTRERGAAVIGLRASHSVLSSL |
| Ga0070686_1004138562 | 3300005544 | Switchgrass Rhizosphere | MLAGRDDVGESRMGEISMSGLTRERRAAVIGLRTSHSVLSSLLYRLPLW* |
| Ga0066661_103377911 | 3300005554 | Soil | MLSGRADLGESRMGETSMSGSTRERGAAVIDAIVFHSVLSSLLYW* |
| Ga0066707_101192302 | 3300005556 | Soil | MLSGIDDPGESRMGEISMSGSTREREAAVIGLWAFHSVLSSLLY* |
| Ga0066700_100846471 | 3300005559 | Soil | MLSGIDDPGESRMGEISMSGSTREREAAVIGLWAFHPVLSSLLYRLCGCFGLVAAL |
| Ga0066699_110512131 | 3300005561 | Soil | DSGESRMREICMSGSTRERGAAVIDAIVFHSVLSSLLYRFIA* |
| Ga0079037_1007489801 | 3300006224 | Freshwater Wetlands | MLSGKDDAGESRMGEISMSGLTREREAAVIGLWVFHPVLSSLLYWFE* |
| Ga0066659_100730142 | 3300006797 | Soil | MLSGIDDPGESRMGEISMSGSTREREAAVIGLWAFHPVLSSLLYRIAFSPFSSDF* |
| Ga0075425_1004497652 | 3300006854 | Populus Rhizosphere | MLSGSDDPGESRMGEISMSGSTRERKAAVIGLRAFHSVLSSLLYWLILWVAAPLLCVHPW |
| Ga0075424_1016974022 | 3300006904 | Populus Rhizosphere | MLFGKDDSGESRMGEISMSGLTRERGATVIGLGAFHPVLSSLLYRFSGLHEFP* |
| Ga0066710_1000513427 | 3300009012 | Grasslands Soil | SGESRMREICMSGSTRERGAAVIDAIVFHSVLSSLLYRILFGA |
| Ga0105093_108794012 | 3300009037 | Freshwater Sediment | MPPGRDVSGESRMGEISMSGSMRERGVPVIGRKAFHPVLSSLLYRF* |
| Ga0115026_110250961 | 3300009111 | Wetland | MLSGKDDAGESRMGEISMSGLTREREAAVIGLWASHSVLSSLLYWSSHSWRFYQSQAAR |
| Ga0115027_103421681 | 3300009131 | Wetland | MLSGTDDVGESRMGEISMSGLTREREAAVIGLGIFHSVLSSLLYWLQA* |
| Ga0115027_103752012 | 3300009131 | Wetland | MLCGRDDSGESRMGEISMSGSTRERAAAVIGLMAFHPVLSSLLYWLKKSFLIIPPL |
| Ga0066709_1001524233 | 3300009137 | Grasslands Soil | MLSGRADSGESRMREICMSGSTRERGAAVIDAIVFHSVLSSLLYRILFGA* |
| Ga0111538_100836946 | 3300009156 | Populus Rhizosphere | MLSGRADLGESRMREICMSGSTREREAAVFGLCASHSVLSSLLYW |
| Ga0114951_102255171 | 3300009502 | Freshwater | MLSGRDDSGESRMGEISMSGSTRERGATVIGPRTFQPVLSSLLYRLA |
| Ga0129283_100619331 | 3300009537 | Beach Aquifer Porewater | MLSGRDGLGESRMGEISMSGSTREREAAVIGLRTSHPV |
| Ga0105249_101208613 | 3300009553 | Switchgrass Rhizosphere | MLSGRDDLGESRMREIFMSGSTREREAAVIGRWAFHSVLSSLLYRQ* |
| Ga0105249_116352781 | 3300009553 | Switchgrass Rhizosphere | MLSGRDDLGESRMREICRSGSTREREAAVFSLRASHSVL |
| Ga0116112_10421841 | 3300009636 | Peatland | MLSVIDDPGESRMGEISMSGSTREGGAAVIGLRAFHSVLSSLLYIRFGSRFVV |
| Ga0134070_101605012 | 3300010301 | Grasslands Soil | MLSGRADPGESRMGETSMSGSTREREVTVIDAYVFHSV |
| Ga0134070_104468252 | 3300010301 | Grasslands Soil | MLSGIDDLGESRMGEISMSGSTREREAAVIDSYVFHSVLSSLLYR* |
| Ga0134084_100943582 | 3300010322 | Grasslands Soil | MLSGRADSGESRMREICMSGSTRERGAAVIDAIVFHSVLSSLLY |
| Ga0134064_101243972 | 3300010325 | Grasslands Soil | MLSGRADPGESRMGETSMSGSTREREVTVIDAIVFHSVLSSLLYCPSVV* |
| Ga0134063_100420431 | 3300010335 | Grasslands Soil | MLSGRADPGESRMGETSMSGSTRERGAAVIDAIVFHSVLSSLLYC |
| Ga0134063_102657111 | 3300010335 | Grasslands Soil | RADPGESRMGETSMSGSTRERGAAVIDAIVFHSVLSSLLYCPSVVKLKI* |
| Ga0134124_100170571 | 3300010397 | Terrestrial Soil | MLSGRDDLGESRMREICMSGSTREREAAVFGLCASHSVLSSLLYW |
| Ga0116241_103364901 | 3300010429 | Anaerobic Digestor Sludge | MRSGTEDLGESRMGEISMSGSTREREAAVIGLRTSHSVAFLSTLLELAVGLGV |
| Ga0137423_11550741 | 3300011430 | Soil | MLAGRDDAGESRMGEISMSGSTREREAAVIDPYVFHSVLSSLLYWSGFVFVG* |
| Ga0137382_101042402 | 3300012200 | Vadose Zone Soil | MLSGIDDLGESRMGEISMSGSTREREAAVIDSYVFHSVLSSLLYWFSFCS* |
| Ga0137380_103600071 | 3300012206 | Vadose Zone Soil | MLSGRDGLGESRMWEICMSGSTREREAAVIGLWAFHSVLSSLLY |
| Ga0137381_103072281 | 3300012207 | Vadose Zone Soil | MLSGRADLGESRMGEISMSGSTREREAAVIDFCVFHSVLSSLLYWLRPDL |
| Ga0137379_113849962 | 3300012209 | Vadose Zone Soil | MLSGIADPGESRMGEISMSGSTREREAAVIGLRAFHSVLSSLLYW |
| Ga0137378_117070541 | 3300012210 | Vadose Zone Soil | DDSGESRMREICMSGSTREREAAVIGLRASHPVLSSLLYRFESFS* |
| Ga0137377_104773291 | 3300012211 | Vadose Zone Soil | MLSGKDDPGESRMGEISMSGSTREREASVIGLRASHPVLSSLLYWPSASSELAVY |
| Ga0137387_104568631 | 3300012349 | Vadose Zone Soil | MLSGRDGLGESRMWEICMSGSTREREAAVIGLWAFHSVLSS |
| Ga0137367_103870942 | 3300012353 | Vadose Zone Soil | MLSGRDDPGESRMGEISMSGSTRERAAAVIGLWAFHSVLSSLLYWFPFFA* |
| Ga0137366_101619672 | 3300012354 | Vadose Zone Soil | MLSGRDDLGESRMREICMSGSTREREAAVFGLWASHSVLSSLLYR* |
| Ga0137371_105011331 | 3300012356 | Vadose Zone Soil | MLSGIADPGESRKGENSRSRSTRQSEEPVVGLRAFRSELSALLYRQLLFIQS |
| Ga0137385_116190582 | 3300012359 | Vadose Zone Soil | MLSGRADLGESRMGEISMSGSTREREAAVIDFYVFHSVLSSLLYWLGKNYEKTQR |
| Ga0137361_101620991 | 3300012362 | Vadose Zone Soil | MLSGIADPGESRMGEISMSGSTREREAAVIGLRAFHSVLSSLLYWQ |
| Ga0137361_113823742 | 3300012362 | Vadose Zone Soil | MLPGRDDSGESRMREICTSGSTRERGTAVIDAIVFHSVFSSLLYRFIHFGD* |
| Ga0134047_11356741 | 3300012380 | Grasslands Soil | MLSGRADPGESRMGETSMSGSTREREVTVIDAYVF |
| Ga0137394_109607301 | 3300012922 | Vadose Zone Soil | MPSGKDDPGESRMGEISMSGSTREREAAVIDVYVF |
| Ga0134077_101419262 | 3300012972 | Grasslands Soil | MLSGRADPGESRMGETSMSGSTRERGAAVIDAIVFHFVLSSLLYCPSVVKLKI* |
| Ga0134078_102540431 | 3300014157 | Grasslands Soil | MLSGRADSGESRMREICMSGSTRERGAAVIDAIVFHSVLSSLLYH |
| Ga0180085_11741132 | 3300015259 | Soil | MLSGRDDSGESRMGEISMSGSTRERGAAVIGLWASHSVLSSLLYWLF |
| Ga0134072_104958902 | 3300015357 | Grasslands Soil | MLSGRADPGESRMGETSMSGSTRERGAAVIDAIVFHSVLSSLL |
| Ga0184621_101076991 | 3300018054 | Groundwater Sediment | MLTGIDDLGESRMGEISMSGSTRERGAAVIDVYVSHSVLSSLLY |
| Ga0184621_102210231 | 3300018054 | Groundwater Sediment | MLSGRDDLGESRMREICMSGSTREREAAVFGLCASH |
| Ga0187894_100526381 | 3300019360 | Microbial Mat On Rocks | MRSGRDDPGESRMREISMSGSTREREAAVIGPRAFHSVLSSLLYW |
| Ga0193735_11050071 | 3300020006 | Soil | MLSGRDDLGESRMREICMSGSTREREAAVVGLCASH |
| Ga0193749_10177412 | 3300020010 | Soil | MLSGIDDPGESRMGEISMSGSTREREAAVIGLRAFHSVLSSLLYWLN |
| Ga0194113_100047669 | 3300020074 | Freshwater Lake | MLYGRDDSGESRMGEISMSGSTRERGAAVIGLWAFHSVLSSLLYRLNGFFGPFFRAG |
| Ga0193698_10098771 | 3300021968 | Soil | MLSGRDDPGESRMGEISMSGSTRERGAAVIGLRAFHSVLSSLLYWFQL |
| Ga0247688_10774891 | 3300024186 | Soil | MLSGRDDLGESRMWEICMSGSTREREAAVIGLRAFH |
| Ga0207670_102982511 | 3300025936 | Switchgrass Rhizosphere | MLAGRDDVGESRMGEISMSGLTRERRAAVIGLRTSHSVLSSLLYRLPLW |
| Ga0207712_115049252 | 3300025961 | Switchgrass Rhizosphere | MLSGRDDLGESRMREIFMSGSTREREAAVIGRWAFHSVLSSLLYPLRMN |
| Ga0209055_12401072 | 3300026309 | Soil | MLSGRDDSGESRMREICMSGSTRERGAAVIDAIVFHSVLSSLLYRIRRSAV |
| Ga0209239_11880192 | 3300026310 | Grasslands Soil | MLSGRDDSGESRMREICMSGSTRERGAAVIDAIVFHS |
| Ga0209155_10249081 | 3300026316 | Soil | MLSGRADSGESRMREICMSGSTRERGAAVIDAIVFHSVLSSLLYRLT |
| Ga0209058_10455463 | 3300026536 | Soil | MLSGRADPGESRMGETSMSGSTRERGAAVIDAIVFHSVLSSLLYCPSVVKLKI |
| Ga0209058_13151401 | 3300026536 | Soil | MLSGKDDVGESRMGEISMSGSTRERGAAVIGLWVFHSVLSSLLYRLLPGARFH |
| Ga0209056_101855541 | 3300026538 | Soil | MLSGIDDPGESRMGEISMSGSTREREAAVIGLWGLSF |
| Ga0209376_11195022 | 3300026540 | Soil | MLSGRDDSGESRMREICTSGSTGERGAAVIDAIVFHSVLSSLLYRFELHRYV |
| Ga0209577_101072282 | 3300026552 | Soil | MLSGIDDPGESRMGEISMSGSTREREAAVIGLWAFHPVLSSLLYRLCG |
| Ga0209180_101730821 | 3300027846 | Vadose Zone Soil | MFSGIDDPGESRMGEISMSGSTREREAAVIGLWAFH |
| Ga0209283_100897852 | 3300027875 | Vadose Zone Soil | MLSGRDGLGESRMWEICMSGSTRERKAAVIGLWAF |
| Ga0209496_103324911 | 3300027890 | Wetland | MLSGTEDLGESRMGEISMSGSTRERRTAVIGLRASHSVFSSLLYWQIRE |
| Ga0209253_104837522 | 3300027900 | Freshwater Lake Sediment | MLSGTDDAGESRMGEISMSGSTRERGAAVIGLGIFHSVLSSLLYWLKK |
| Ga0209415_105104192 | 3300027905 | Peatlands Soil | MLSGIDDPGESRMGEISMSGSTREREAAVIGLRAFHSVLSSLLY |
| Ga0272412_10379703 | 3300028647 | Activated Sludge | MLSGIDDPGESRMGEISMSGLTRERGATVTGLGAFHPVLSSLLY |
| Ga0311363_113234781 | 3300029922 | Fen | MLSGRDDPGESRMGEISMSGSTREREAAVIGLRAFHSVLSS |
| Ga0311346_112351062 | 3300029952 | Bog | MLSGRDDPGESRMGEISMSGSTREREAAVIGLRAFHSV |
| Ga0265316_100601583 | 3300031344 | Rhizosphere | MLSGTDDPGESRMGEISMSGSTREREAAVIGRRAFHSVLSSLLYWFNGSTA |
| Ga0302320_103308572 | 3300031524 | Bog | MLSGRDDPGESRMGEISMSGSTREREAAVIGLRAFHSVLSSLLYWLKGKS |
| Ga0316217_100573201 | 3300031813 | Freshwater | MLSGRDDLGESRMGEISMSGSTRERKAAVIGLRAFHS |
| Ga0315278_109503062 | 3300031997 | Sediment | MLTGKADAGESRMGEISMSGSTRERGAAVIGLWAFH |
| Ga0315295_108965052 | 3300032156 | Sediment | MLSGRDDVGESRMGEISMSGLTRERGAAVIGLWAFHPVLSSLLYWLKIG |
| Ga0315283_109026791 | 3300032164 | Sediment | MLSGKDDAGESRMGEISMSGLTRERGAAVIGLGVFHPVLSSLLYWFLGRSKLACKRPVL |
| Ga0315271_102223842 | 3300032256 | Sediment | MLAGKADAGESRMGEISMSGSTRERGAAVIDPYVFH |
| Ga0315271_103190981 | 3300032256 | Sediment | MLSGIDDPGESRMGEISMSGSTRERGAAVIGLWAFHSALSLSTLL |
| Ga0315270_104070082 | 3300032275 | Sediment | MPSGRDDLGESRMGEISMSGLTRERGAAVIGLWTFHPVLSSLLYS |
| Ga0315287_109996802 | 3300032397 | Sediment | MLSGKDDAGESRMGEISMSGLTRERGAAVIGLGVFHSVLSSLLYWLNCVFQVD |
| Ga0315287_121238531 | 3300032397 | Sediment | MLAGRDDAGESRMGEISMSGSTREREAAVIGLRAFHSVLSSLLYWLH |
| Ga0315275_112999463 | 3300032401 | Sediment | MHSGKDDPGESRMGEISMSGSTRERGATVIGLRTFHPVLSSLLYWLWYSFRF |
| Ga0315273_102562951 | 3300032516 | Sediment | MLCGRDDSGESRMGEISMSGSTREREAAVIGLGTYHSV |
| Ga0315273_125859272 | 3300032516 | Sediment | MLSGRDDSGESRMGEISMSGSTREREAAVIGPGTCHPVLSSLLYR |
| Ga0326728_105177562 | 3300033402 | Peat Soil | MLSGIDDLGESRMGEISMSGSTRERKAAVIGLWAFHSVLSSLLYWLTVV |
| Ga0326727_104420851 | 3300033405 | Peat Soil | MLSGIDDLGESRMGEISMSGSTRERKAAVIGLWAFHSVLSSLLYWSKFSVPPSPSAVE |
| Ga0316622_1009758973 | 3300033416 | Soil | MLCGRDDSGESRMGEISMSGSTREREAAVIGLGTCHSVLSSLLYRF |
| Ga0316625_1004123271 | 3300033418 | Soil | MLSGRVDSGESRMGEISMSGSTRERGAAVIGLRTSHPVLSSL |
| Ga0316627_1015702761 | 3300033482 | Soil | MLSGRADPGESRMGEISMSGSTREREAAVIGLRAFHSVLSSLLYWFSSAEIRLRGLAG |
| Ga0316629_117994691 | 3300033483 | Soil | MLSGQDDAGESRMGEISMSGSTRERGAAVIGLGIFHSVL |
| Ga0316626_100856901 | 3300033485 | Soil | MLCGRDDSGESRMGEISMSGSTREREAAVIGLGTFHSV |
| ⦗Top⦘ |