


| Basic Information | |
|---|---|
| Family ID | F084386 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 112 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MWLLLLLILAVLIFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSL |
| Number of Associated Samples | 98 |
| Number of Associated Scaffolds | 112 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 14.14 % |
| % of genes near scaffold ends (potentially truncated) | 46.43 % |
| % of genes from short scaffolds (< 2000 bps) | 76.79 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (66.071 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (17.857 % of family members) |
| Environment Ontology (ENVO) | Unclassified (41.071 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (46.429 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 82.35% β-sheet: 0.00% Coil/Unstructured: 17.65% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 112 Family Scaffolds |
|---|---|---|
| PF07690 | MFS_1 | 23.21 |
| PF04185 | Phosphoesterase | 6.25 |
| PF12730 | ABC2_membrane_4 | 2.68 |
| PF08669 | GCV_T_C | 2.68 |
| PF13343 | SBP_bac_6 | 2.68 |
| PF13302 | Acetyltransf_3 | 0.89 |
| PF13416 | SBP_bac_8 | 0.89 |
| PF12679 | ABC2_membrane_2 | 0.89 |
| PF03928 | HbpS-like | 0.89 |
| PF08327 | AHSA1 | 0.89 |
| PF13229 | Beta_helix | 0.89 |
| PF01323 | DSBA | 0.89 |
| PF00491 | Arginase | 0.89 |
| PF13683 | rve_3 | 0.89 |
| PF01872 | RibD_C | 0.89 |
| PF10041 | DUF2277 | 0.89 |
| COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
|---|---|---|---|
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 6.25 |
| COG0010 | Arginase/agmatinase family enzyme | Amino acid transport and metabolism [E] | 0.89 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.89 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 66.07 % |
| All Organisms | root | All Organisms | 33.93 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003990|Ga0055455_10073675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 972 | Open in IMG/M |
| 3300003990|Ga0055455_10092339 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300004156|Ga0062589_100022049 | All Organisms → cellular organisms → Bacteria | 3041 | Open in IMG/M |
| 3300004643|Ga0062591_101693849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea | 641 | Open in IMG/M |
| 3300004803|Ga0058862_12826978 | Not Available | 694 | Open in IMG/M |
| 3300005330|Ga0070690_100159220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 1546 | Open in IMG/M |
| 3300005338|Ga0068868_100774627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 864 | Open in IMG/M |
| 3300005343|Ga0070687_100096076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1649 | Open in IMG/M |
| 3300005354|Ga0070675_102225202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 505 | Open in IMG/M |
| 3300005437|Ga0070710_10112832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1635 | Open in IMG/M |
| 3300005439|Ga0070711_100526122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 978 | Open in IMG/M |
| 3300005456|Ga0070678_100100958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2236 | Open in IMG/M |
| 3300005543|Ga0070672_100550135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1002 | Open in IMG/M |
| 3300005549|Ga0070704_100041999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3161 | Open in IMG/M |
| 3300005618|Ga0068864_100488568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1183 | Open in IMG/M |
| 3300005886|Ga0075286_1016330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 911 | Open in IMG/M |
| 3300005889|Ga0075290_1002126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2187 | Open in IMG/M |
| 3300006046|Ga0066652_100035590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3617 | Open in IMG/M |
| 3300006237|Ga0097621_100418516 | Not Available | 1202 | Open in IMG/M |
| 3300006573|Ga0074055_11485917 | Not Available | 1048 | Open in IMG/M |
| 3300006579|Ga0074054_12094518 | Not Available | 850 | Open in IMG/M |
| 3300006579|Ga0074054_12177872 | Not Available | 951 | Open in IMG/M |
| 3300006580|Ga0074049_13023281 | Not Available | 618 | Open in IMG/M |
| 3300006581|Ga0074048_13455968 | Not Available | 877 | Open in IMG/M |
| 3300006755|Ga0079222_10074401 | Not Available | 1686 | Open in IMG/M |
| 3300006806|Ga0079220_10092134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1550 | Open in IMG/M |
| 3300006852|Ga0075433_11725278 | Not Available | 539 | Open in IMG/M |
| 3300006881|Ga0068865_100556856 | Not Available | 964 | Open in IMG/M |
| 3300006914|Ga0075436_100069979 | Not Available | 2425 | Open in IMG/M |
| 3300006954|Ga0079219_10065629 | Not Available | 1636 | Open in IMG/M |
| 3300009162|Ga0075423_13020640 | Not Available | 515 | Open in IMG/M |
| 3300009174|Ga0105241_12003514 | Not Available | 570 | Open in IMG/M |
| 3300010039|Ga0126309_10215947 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300010152|Ga0126318_10005243 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300010152|Ga0126318_10426486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 519 | Open in IMG/M |
| 3300010152|Ga0126318_10490536 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300010375|Ga0105239_11621025 | Not Available | 748 | Open in IMG/M |
| 3300010400|Ga0134122_10673965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 967 | Open in IMG/M |
| 3300011107|Ga0151490_1110579 | Not Available | 670 | Open in IMG/M |
| 3300011119|Ga0105246_10468502 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
| 3300012212|Ga0150985_121690632 | Not Available | 1043 | Open in IMG/M |
| 3300012285|Ga0137370_10951229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 530 | Open in IMG/M |
| 3300012406|Ga0134053_1436816 | Not Available | 671 | Open in IMG/M |
| 3300012469|Ga0150984_101272316 | Not Available | 941 | Open in IMG/M |
| 3300012469|Ga0150984_108440277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea | 565 | Open in IMG/M |
| 3300012955|Ga0164298_10171438 | Not Available | 1241 | Open in IMG/M |
| 3300012957|Ga0164303_11297152 | Not Available | 538 | Open in IMG/M |
| 3300012958|Ga0164299_11620644 | Not Available | 510 | Open in IMG/M |
| 3300012960|Ga0164301_10007400 | All Organisms → cellular organisms → Bacteria | 4196 | Open in IMG/M |
| 3300013297|Ga0157378_11051764 | Not Available | 850 | Open in IMG/M |
| 3300014326|Ga0157380_10598311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 1090 | Open in IMG/M |
| 3300015371|Ga0132258_10582747 | Not Available | 2807 | Open in IMG/M |
| 3300017792|Ga0163161_11336485 | Not Available | 624 | Open in IMG/M |
| 3300019269|Ga0184644_1389695 | Not Available | 738 | Open in IMG/M |
| 3300019890|Ga0193728_1041102 | All Organisms → cellular organisms → Bacteria | 2273 | Open in IMG/M |
| 3300020069|Ga0197907_10755136 | Not Available | 573 | Open in IMG/M |
| 3300020075|Ga0206349_1577728 | Not Available | 617 | Open in IMG/M |
| 3300020077|Ga0206351_10303021 | Not Available | 506 | Open in IMG/M |
| 3300020080|Ga0206350_10532083 | Not Available | 1197 | Open in IMG/M |
| 3300020081|Ga0206354_10061644 | Not Available | 502 | Open in IMG/M |
| 3300020082|Ga0206353_11804570 | Not Available | 1537 | Open in IMG/M |
| 3300021344|Ga0193719_10348446 | Not Available | 616 | Open in IMG/M |
| 3300022467|Ga0224712_10070973 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1414 | Open in IMG/M |
| 3300022467|Ga0224712_10484887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea | 596 | Open in IMG/M |
| 3300022467|Ga0224712_10652770 | Not Available | 516 | Open in IMG/M |
| 3300025321|Ga0207656_10248685 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 870 | Open in IMG/M |
| 3300025321|Ga0207656_10587197 | Not Available | 568 | Open in IMG/M |
| 3300025556|Ga0210120_1012031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1720 | Open in IMG/M |
| 3300025898|Ga0207692_10140839 | Not Available | 1372 | Open in IMG/M |
| 3300025900|Ga0207710_10701214 | Not Available | 531 | Open in IMG/M |
| 3300025901|Ga0207688_10546900 | Not Available | 727 | Open in IMG/M |
| 3300025904|Ga0207647_10181105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 1224 | Open in IMG/M |
| 3300025923|Ga0207681_10665772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 864 | Open in IMG/M |
| 3300025934|Ga0207686_10250252 | Not Available | 1294 | Open in IMG/M |
| 3300026003|Ga0208284_1002672 | Not Available | 1375 | Open in IMG/M |
| 3300026035|Ga0207703_11489322 | Not Available | 651 | Open in IMG/M |
| 3300026995|Ga0208761_1030675 | Not Available | 542 | Open in IMG/M |
| 3300027765|Ga0209073_10252423 | Not Available | 686 | Open in IMG/M |
| 3300027787|Ga0209074_10333938 | Not Available | 616 | Open in IMG/M |
| 3300028708|Ga0307295_10166347 | Not Available | 617 | Open in IMG/M |
| 3300028711|Ga0307293_10012519 | Not Available | 2399 | Open in IMG/M |
| 3300028711|Ga0307293_10252602 | Not Available | 560 | Open in IMG/M |
| 3300028814|Ga0307302_10086099 | Not Available | 1492 | Open in IMG/M |
| 3300028828|Ga0307312_10390829 | Not Available | 913 | Open in IMG/M |
| 3300030830|Ga0308205_1029375 | Not Available | 667 | Open in IMG/M |
| 3300030858|Ga0102759_1913546 | Not Available | 529 | Open in IMG/M |
| 3300030902|Ga0308202_1102898 | Not Available | 592 | Open in IMG/M |
| 3300030902|Ga0308202_1117308 | Not Available | 565 | Open in IMG/M |
| 3300031091|Ga0308201_10233335 | Not Available | 625 | Open in IMG/M |
| 3300031092|Ga0308204_10346338 | Not Available | 510 | Open in IMG/M |
| 3300031170|Ga0307498_10294062 | Not Available | 605 | Open in IMG/M |
| 3300031184|Ga0307499_10125863 | Not Available | 729 | Open in IMG/M |
| 3300031421|Ga0308194_10395965 | Not Available | 503 | Open in IMG/M |
| 3300031938|Ga0308175_100084766 | Not Available | 2869 | Open in IMG/M |
| 3300031938|Ga0308175_100583036 | Not Available | 1201 | Open in IMG/M |
| 3300031938|Ga0308175_101838427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 679 | Open in IMG/M |
| 3300031996|Ga0308176_11796950 | Not Available | 654 | Open in IMG/M |
| 3300033433|Ga0326726_10165696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 2024 | Open in IMG/M |
| 3300034090|Ga0326723_0022312 | All Organisms → cellular organisms → Bacteria | 2591 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 17.86% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 8.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.25% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.46% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.57% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 3.57% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.57% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 2.68% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.68% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.68% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.68% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.68% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 2.68% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.79% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.79% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.79% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.89% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.89% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.89% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.89% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.89% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003990 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005886 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205 | Environmental | Open in IMG/M |
| 3300005888 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103 | Environmental | Open in IMG/M |
| 3300005889 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_201 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012406 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300019269 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025556 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026003 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_201 (SPAdes) | Environmental | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026995 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300030830 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_368 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030858 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 6B (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030902 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0055455_100736752 | 3300003990 | Natural And Restored Wetlands | MWLLLLLILAVLIFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFTRRSAL* |
| Ga0055455_100923392 | 3300003990 | Natural And Restored Wetlands | MWLLILLILALLVFGVWGAIKVAFWVILVALAVALVVGFLGRGRFGSRGAV* |
| Ga0062589_1000220495 | 3300004156 | Soil | MWLLLLLILAVLIFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSY* |
| Ga0062591_1016938491 | 3300004643 | Soil | LILAILVFGVIGAIKLALWVLLLAVLIAVVAGFLGRGLFTRTN* |
| Ga0058862_128269781 | 3300004803 | Host-Associated | LILAVLIFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSF* |
| Ga0070690_1001592203 | 3300005330 | Switchgrass Rhizosphere | MWLLLLLILAVLIFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSF* |
| Ga0068868_1007746272 | 3300005338 | Miscanthus Rhizosphere | MIWLLRLIFAILVFGVFGAIKLAFWVLLLAVLVAVVAGFLGRGLFTGTR* |
| Ga0070687_1000960762 | 3300005343 | Switchgrass Rhizosphere | MWLLLLLILAVLIFGIWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSY* |
| Ga0070675_1022252021 | 3300005354 | Miscanthus Rhizosphere | MWLLLLLILAVLIFGVWGAVKVAFWVLLIALAVAVIAGFLGRGLFVRRSSL* |
| Ga0070710_101128322 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MWFLILLILALIVFGVWGAIKLAFWVLLIALAVAVVAGFLGRGLFTGRRGAL* |
| Ga0070711_1005261222 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MRASAVLIFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSF* |
| Ga0070678_1001009582 | 3300005456 | Miscanthus Rhizosphere | MWLLLLLILAVLIFGVWGAVKVAFWVLLIALAVAVVAAFLGRGLFVRRSSL* |
| Ga0070672_1005501351 | 3300005543 | Miscanthus Rhizosphere | MWLLLLLILAVLIFGIWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSF* |
| Ga0070704_1000419995 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MWLLLLLIVAVLIFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSY* |
| Ga0066654_106539951 | 3300005587 | Soil | GIWGAVKLAFWVLLIALLVALVAGFLGRGLFTRTY* |
| Ga0068864_1004885682 | 3300005618 | Switchgrass Rhizosphere | MWLLLLLILAVLIFGVWGAVKVAFWVLLIALAVAVVAAFLGRGLFVRRSSF* |
| Ga0075286_10163302 | 3300005886 | Rice Paddy Soil | MWLLLLLILAVLIFGIWGAVKVAFWVLLIALAVAVVAGFLGRGLFTRRSA |
| Ga0075289_10086271 | 3300005888 | Rice Paddy Soil | IFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSL* |
| Ga0075290_10021262 | 3300005889 | Rice Paddy Soil | MWLLLLLILAVLIFGVWGAVKVAFWVLLIALVVAVVAGFLGRGLFVRRSSF* |
| Ga0066652_1000355903 | 3300006046 | Soil | MWLLLLLILAVLLFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSL* |
| Ga0097621_1004185164 | 3300006237 | Miscanthus Rhizosphere | IFGVWGAVKVAFWVLLIALAVAVVAAFLGRGLFVRRSSL* |
| Ga0074055_114859174 | 3300006573 | Soil | MWLLLLLILAVLIFGVWGAVKVAFWVLLIALAVAIVAGFLGRGLFVRRSSL* |
| Ga0074054_120945183 | 3300006579 | Soil | MWLLLLLILAVLVLGVWGAVKVAFWVLLIALAVAVVAGFLGRGLLARRSSL* |
| Ga0074054_121778721 | 3300006579 | Soil | RMWLLLLLILAVLIFGVWGAVKVAFWVLLIALAVAIVAGFLGRGLFVRRSSL* |
| Ga0074049_130232812 | 3300006580 | Soil | RMWLLLLLILAVLVLGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSL* |
| Ga0074048_134559683 | 3300006581 | Soil | GVWGAVKVAFWVLLIALAVAVVAGFLGRGLLVRRSSL* |
| Ga0079222_100744012 | 3300006755 | Agricultural Soil | MWLLLLFILALILFGIWGAIKLTFWVLLIALAVAVVAGFLGRGLFGTRGTV* |
| Ga0066659_110956333 | 3300006797 | Soil | FGVWGAIKLAFWVLLIALAVALIIGFLGRGLFGSRRGAI* |
| Ga0079220_100921342 | 3300006806 | Agricultural Soil | MRASAVLIFGVWGAVKVAFWVLWIALAVAVVAGFLGRGLFVRRSSF* |
| Ga0075433_117252781 | 3300006852 | Populus Rhizosphere | GVWGAVKVAFWVLLIALAVAIIAGFLGRGLFTRRSAL* |
| Ga0068865_1005568563 | 3300006881 | Miscanthus Rhizosphere | RMWLLLLLILAVLIFGVWGAVKVAFWVLLIALAVAVVAAFLGRGLFVRRSSL* |
| Ga0075436_1000699795 | 3300006914 | Populus Rhizosphere | DAGIWLRMWLLLLLILAVLIFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSF* |
| Ga0079219_100656292 | 3300006954 | Agricultural Soil | MWLLLLLILAVLIFGVWGAVKVAFWVLWIALAVAVVAGFLGRALFVRRSSF* |
| Ga0075423_130206401 | 3300009162 | Populus Rhizosphere | LLLLILAVLLLGVWGAVKVAFWVLLIALAVAIIAGFLGRVLFTRRSAL* |
| Ga0105241_120035143 | 3300009174 | Corn Rhizosphere | ALILFGVWGAIKVAFWVLLIALAVALIVGFLGRGLFGGRRGAI* |
| Ga0126309_102159474 | 3300010039 | Serpentine Soil | SMIWLLLFILAILIFGIGGAIKLTFWVILIALAVILIAAFLGRGLYSRA* |
| Ga0126318_100052432 | 3300010152 | Soil | LILALIVFGVWGAIKLAFWVLLIALIVALVVGLLGRGLFSGRRGTV* |
| Ga0126318_104264861 | 3300010152 | Soil | LILALIVFGVWGAIKLAFWVLLIALIVALVVGLLGRGLFGGRRGTV* |
| Ga0126318_104905363 | 3300010152 | Soil | ILLILALILFGVWGAIKLAFWVLLIALAVALIVGFLGRGLFGSRGGAI* |
| Ga0134128_124801093 | 3300010373 | Terrestrial Soil | FGVWGAIKLAFWVLLIALAVALVVGFLGRGLFGSRRGAI* |
| Ga0105239_116210253 | 3300010375 | Corn Rhizosphere | LALILFGVWGAIKLAFWVLLIALAVALVVGFLGRGLFGSRRGAI* |
| Ga0134122_106739652 | 3300010400 | Terrestrial Soil | MWLLLLLILAVLIFGVWGAVKVAFWVLLIALAVALVVGFLGRGLFGSRRGAI* |
| Ga0151490_11105791 | 3300011107 | Soil | LLLILAVLIFGVWGAVKVAFWVLLIALAVAIVAGFLGRGLFVRRSSL* |
| Ga0105246_104685024 | 3300011119 | Miscanthus Rhizosphere | ALILFGVWGAIKLAFWVLLIALAVALVVGFLGRGLFGSRRGAI* |
| Ga0150985_1216906323 | 3300012212 | Avena Fatua Rhizosphere | MRIGMWLLLLLILAVLVFGIWGAVKVAFWVLLIALAVAIIAGFLGRGLFVRRSSF* |
| Ga0137370_109512291 | 3300012285 | Vadose Zone Soil | ILALILFGVWGAIKVAFWVLLIALAVALIAGFLGRGLFGSRRGAI* |
| Ga0134053_14368161 | 3300012406 | Grasslands Soil | MWLLLLLILAVLVFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSL* |
| Ga0150984_1012723163 | 3300012469 | Avena Fatua Rhizosphere | MRIGMWLLLLLILAVLVFGIWGAVKVAFWVLLIALAVAIIAGFLGRGLFVRRSSL* |
| Ga0150984_1084402771 | 3300012469 | Avena Fatua Rhizosphere | DLLAILVFGVFGAIKIAFWVLLLAVLVAVVAGFLGRGLFTGTR* |
| Ga0150984_1106282882 | 3300012469 | Avena Fatua Rhizosphere | VFGVIGAIKLAFWVLLIALLVAVVAGFLGRSLFTTR* |
| Ga0164298_101714384 | 3300012955 | Soil | MWLLLLLILAVIIFGVWGAVKVAFWVLLIALAVAIVAGFLGRGLFVRRSSL* |
| Ga0164303_112971522 | 3300012957 | Soil | MWFLILLILALIVFGVWGAIKLAFWVLLIALAVAVVAGFLGRGLFSSRRGAL* |
| Ga0164299_116206442 | 3300012958 | Soil | YLPPDAGIWLRMWLLLLLILAVLIFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSY* |
| Ga0164301_100074005 | 3300012960 | Soil | MWLLLLLILAVLIFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSL* |
| Ga0164307_118272852 | 3300012987 | Soil | VFGVWGAIKLAFWVLLIALAVAVVAGFLGRGLFSSRRGAL* |
| Ga0157371_112672653 | 3300013102 | Corn Rhizosphere | WGAIKLAFWVLLIALAVALVVGFLGRGLFGSRRGAI* |
| Ga0157378_110517643 | 3300013297 | Miscanthus Rhizosphere | MWLLLLLILAVLIFGVWGAVKVAFWVLLIALAVAVVAAFLGRGLFVRRSSY* |
| Ga0157380_105983112 | 3300014326 | Switchgrass Rhizosphere | MWLLLLLILAVLIFGVWGAVKVAFCVLLIALAVAVVAGFLGRGLFVRRSSF* |
| Ga0132258_105827473 | 3300015371 | Arabidopsis Rhizosphere | MWLLLLILAVLVVGVWGAVKVAFWVLLIALAVAVIAGFLGRGLFVRRSSF* |
| Ga0163161_113364852 | 3300017792 | Switchgrass Rhizosphere | MWLLLLLILAVLIFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSF |
| Ga0184644_13896953 | 3300019269 | Groundwater Sediment | LAVLVFGIWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSL |
| Ga0193728_10411024 | 3300019890 | Soil | MWFLILLILALIVFGVVGAIKLAFWVLLIALAVAVVAGFLGRGLFGSRRGAL |
| Ga0197907_107551361 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | WLRMWLLLLLILAVLIFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSY |
| Ga0206349_15777282 | 3300020075 | Corn, Switchgrass And Miscanthus Rhizosphere | LLLILALIVFGVWGAIKLAFWVLLIALIVALIVGFLGRGLFGGRRGAI |
| Ga0206351_103030212 | 3300020077 | Corn, Switchgrass And Miscanthus Rhizosphere | LLILALIVFGVWGAIKLAFWVLLIALIVALIVGFLGRGLFGGRRGAI |
| Ga0206350_105320831 | 3300020080 | Corn, Switchgrass And Miscanthus Rhizosphere | LLLLLILAVLIFGIWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSY |
| Ga0206354_100616442 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | VLIFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSF |
| Ga0206354_102197943 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | VLIFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSY |
| Ga0206353_118045704 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | LILAVLIFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSY |
| Ga0193719_103484462 | 3300021344 | Soil | PLRMWLLLLLILAVLVFGIWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSL |
| Ga0224712_100709733 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | LILFGVWGAIKLACWVLLIALAVALIVGFLGRGLFGSRGGAI |
| Ga0224712_104848871 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | LLILAILVFGVIGAIKLALWVLLLAVLVAVVAGFLGRGLFTRTN |
| Ga0224712_106527702 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | LLLILAVLIFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSY |
| Ga0207656_102486851 | 3300025321 | Corn Rhizosphere | LLILALILFGVWGAIKLAFWVLLIALAVALIVGFLGRGLFGSRRGAI |
| Ga0207656_105871972 | 3300025321 | Corn Rhizosphere | MWLLLLLILAVLIFGIWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSF |
| Ga0210120_10120312 | 3300025556 | Natural And Restored Wetlands | MWLLLLLILAVLIFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFTRRSAL |
| Ga0207692_101408392 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MWFLILLILALIVFGVWGAIKLAFWVLLIALAVAVVAGFLGRGLFTGRRGAL |
| Ga0207710_107012142 | 3300025900 | Switchgrass Rhizosphere | GVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSY |
| Ga0207688_105469001 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MWLLLLLILAVLIFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRR |
| Ga0207647_101811053 | 3300025904 | Corn Rhizosphere | MWLLLLLILAVLIFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSY |
| Ga0207671_100218357 | 3300025914 | Corn Rhizosphere | LFGVWGAIKLAFWVLLIALAVALIVGFLGRGLFGSRGGAI |
| Ga0207681_106657722 | 3300025923 | Switchgrass Rhizosphere | MWLLLLLILAVLIFGIWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSY |
| Ga0207644_109902582 | 3300025931 | Switchgrass Rhizosphere | AVLIFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSF |
| Ga0207686_102502522 | 3300025934 | Miscanthus Rhizosphere | MWLLLLLILAVLIFGVWGAVKVAFWVLLIALAVAVVAAFLGRGLFVRRSSL |
| Ga0207658_106662891 | 3300025986 | Switchgrass Rhizosphere | LVFGVIGAIKLALWVLLLAVLIAVVAGFLGRGLFTRTN |
| Ga0208284_10026722 | 3300026003 | Rice Paddy Soil | LRMWLLLLLILAVLIFGVWGAVKVAFWVLLIALVVAVVAGFLGRGLFVRRSSF |
| Ga0207703_114893223 | 3300026035 | Switchgrass Rhizosphere | LLLILAVLIFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSF |
| Ga0208761_10306752 | 3300026995 | Soil | PMWLLLLLILAVLIFGVWGAVKVAFWVLLIALAVAIVAGFLGRGLFVRRSSL |
| Ga0209073_102524232 | 3300027765 | Agricultural Soil | MRASAVLIFGVWGAVKVAFWVLWIALAVAVVAGFLGRGLFVRRSSF |
| Ga0209074_103339382 | 3300027787 | Agricultural Soil | MWLLLLFILALILFGIWGAIKLTFWVLLIALAVAVVAGFLGRGLFGTRGTV |
| Ga0268265_111676441 | 3300028380 | Switchgrass Rhizosphere | VFGVIGAIKLALWVLLLAVLIAVVAGFLGRGLFTRTN |
| Ga0307295_101663471 | 3300028708 | Soil | LRMWLLLLLILAVLVFGIWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSL |
| Ga0307293_100125192 | 3300028711 | Soil | MWLLLLLILAVLVFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSL |
| Ga0307293_102526022 | 3300028711 | Soil | MTIRMWLLLLLILAVLVFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSL |
| Ga0307302_100860994 | 3300028814 | Soil | LLLLILAVLVFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSL |
| Ga0307312_103908292 | 3300028828 | Soil | MRIRMWLLLLLILAVLVFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSL |
| Ga0308205_10293751 | 3300030830 | Soil | LVFGVWGAVKIAFWVLLIALAVALIAGFLGRGLFVRRSSL |
| Ga0102759_19135462 | 3300030858 | Soil | LILALILFGVWGAIKLAFWVLLIALVVALIVGFLGRGLFGTRRGAL |
| Ga0308202_11028982 | 3300030902 | Soil | FGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSL |
| Ga0308202_11173081 | 3300030902 | Soil | LVFGVWGAVKIAFWVLLIALAVALIAGFLGRGLFVRRSSF |
| Ga0308201_102333351 | 3300031091 | Soil | FGVWGAVKIAFWVLLIALAVALIAGFLGRGLFVRRSSL |
| Ga0308204_103463382 | 3300031092 | Soil | LLILLVLLVGVWGAIKIAFWVLVIALLVALVAGFLGRSLFAR |
| Ga0307498_102940622 | 3300031170 | Soil | MWLLLLLILAVLIFGVWGAVKIAFWVLLIALAVAVVAGFLGRGLFVRRSSL |
| Ga0307499_101258632 | 3300031184 | Soil | MWLLLLLILAVLIFGVWGAVKVAFWVLLIALAVAIVAGFLGRGLFVRRSSF |
| Ga0308194_103959652 | 3300031421 | Soil | LILAVLVFGVWGAVKVAFWVLLIALAVAVVAGFLGRGLFVRRSSL |
| Ga0318534_102586162 | 3300031544 | Soil | VLGIWGAIKLAFWVLLIALLVALVAAFLGRGMFTRSGY |
| Ga0308175_1000847663 | 3300031938 | Soil | MWLLLLLILAVLIFGVWGAVKIAFWVLLIALAVAIVAGFLGRGLFVRRSSL |
| Ga0308175_1005830363 | 3300031938 | Soil | MWLLLLLILAVLLFGIWGAVKVAFWVLLIALAVAVIAGFLGRGLLTRRSAL |
| Ga0308175_1018384273 | 3300031938 | Soil | VLILALILCGVWGAIKLAFWVLLIALVVALIVGFLGRGLFGTRRGAL |
| Ga0308176_117969501 | 3300031996 | Soil | LILALILFGVWGAIKVAFWVLLIALAVALIVGFLGRGLFGGRRGAI |
| Ga0326726_101656963 | 3300033433 | Peat Soil | MWLLLLLILAVLVLGVWGAVKVAFWVLLIALAVAVVAGFLGRGLLGRRSSF |
| Ga0326723_0022312_2434_2586 | 3300034090 | Peat Soil | MWLLLLLILAVLVLGVWGAVKVAFWVLLIALAVAVVAGFLGRGLVRRSSL |
| ⦗Top⦘ |