


| Basic Information | |
|---|---|
| Family ID | F084373 |
| Family Type | Metagenome |
| Number of Sequences | 112 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MDEPEAPKGDKYVETARDRRIANALLLFFLIVVVGGGIWLANAMF |
| Number of Associated Samples | 102 |
| Number of Associated Scaffolds | 112 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 12.50 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 90.18 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (54.464 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (26.786 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.679 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.857 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.73% β-sheet: 0.00% Coil/Unstructured: 60.27% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 112 Family Scaffolds |
|---|---|---|
| PF00072 | Response_reg | 41.07 |
| PF02518 | HATPase_c | 33.04 |
| PF08448 | PAS_4 | 8.93 |
| PF03401 | TctC | 1.79 |
| PF04347 | FliO | 1.79 |
| PF07883 | Cupin_2 | 0.89 |
| PF13578 | Methyltransf_24 | 0.89 |
| PF00440 | TetR_N | 0.89 |
| COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
|---|---|---|---|
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 1.79 |
| COG3190 | Flagellar biogenesis protein FliO | Cell motility [N] | 1.79 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 54.46 % |
| All Organisms | root | All Organisms | 45.54 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002077|JGI24744J21845_10015999 | Not Available | 1495 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100081384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3007 | Open in IMG/M |
| 3300002906|JGI25614J43888_10171438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 584 | Open in IMG/M |
| 3300004281|Ga0066397_10133615 | Not Available | 553 | Open in IMG/M |
| 3300004633|Ga0066395_10881869 | Not Available | 541 | Open in IMG/M |
| 3300005175|Ga0066673_10713787 | Not Available | 577 | Open in IMG/M |
| 3300005177|Ga0066690_10351775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 999 | Open in IMG/M |
| 3300005332|Ga0066388_102018941 | Not Available | 1034 | Open in IMG/M |
| 3300005332|Ga0066388_108460963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 512 | Open in IMG/M |
| 3300005332|Ga0066388_108669871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 505 | Open in IMG/M |
| 3300005466|Ga0070685_10924240 | Not Available | 650 | Open in IMG/M |
| 3300005530|Ga0070679_102131987 | Not Available | 510 | Open in IMG/M |
| 3300005549|Ga0070704_101803258 | Not Available | 566 | Open in IMG/M |
| 3300005554|Ga0066661_10092082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1800 | Open in IMG/M |
| 3300005713|Ga0066905_100901057 | Not Available | 774 | Open in IMG/M |
| 3300005764|Ga0066903_101146056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1438 | Open in IMG/M |
| 3300005842|Ga0068858_101969049 | Not Available | 578 | Open in IMG/M |
| 3300005937|Ga0081455_10490931 | Not Available | 827 | Open in IMG/M |
| 3300006028|Ga0070717_12129234 | Not Available | 504 | Open in IMG/M |
| 3300006038|Ga0075365_10150087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1621 | Open in IMG/M |
| 3300006237|Ga0097621_101215843 | Not Available | 710 | Open in IMG/M |
| 3300006796|Ga0066665_10958364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 659 | Open in IMG/M |
| 3300006847|Ga0075431_100102824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → environmental samples → uncultured Microvirga sp. | 2949 | Open in IMG/M |
| 3300006854|Ga0075425_100499571 | Not Available | 1400 | Open in IMG/M |
| 3300006854|Ga0075425_102014070 | Not Available | 645 | Open in IMG/M |
| 3300006871|Ga0075434_101896102 | Not Available | 602 | Open in IMG/M |
| 3300009012|Ga0066710_100234402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2643 | Open in IMG/M |
| 3300009088|Ga0099830_10539313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 954 | Open in IMG/M |
| 3300009101|Ga0105247_10440988 | Not Available | 936 | Open in IMG/M |
| 3300009162|Ga0075423_10464844 | Not Available | 1330 | Open in IMG/M |
| 3300010043|Ga0126380_10889993 | Not Available | 738 | Open in IMG/M |
| 3300010046|Ga0126384_11958374 | Not Available | 560 | Open in IMG/M |
| 3300010048|Ga0126373_11047797 | Not Available | 881 | Open in IMG/M |
| 3300010358|Ga0126370_10746248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → environmental samples → uncultured Microvirga sp. | 866 | Open in IMG/M |
| 3300010359|Ga0126376_10821578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → environmental samples → uncultured Microvirga sp. | 910 | Open in IMG/M |
| 3300010360|Ga0126372_12788365 | Not Available | 541 | Open in IMG/M |
| 3300010360|Ga0126372_12946186 | Not Available | 528 | Open in IMG/M |
| 3300010361|Ga0126378_10651858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → environmental samples → uncultured Microvirga sp. | 1166 | Open in IMG/M |
| 3300010366|Ga0126379_13503278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 526 | Open in IMG/M |
| 3300010398|Ga0126383_11313872 | Not Available | 813 | Open in IMG/M |
| 3300010401|Ga0134121_10788757 | Not Available | 911 | Open in IMG/M |
| 3300011270|Ga0137391_11181422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 613 | Open in IMG/M |
| 3300012208|Ga0137376_10136667 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2102 | Open in IMG/M |
| 3300012209|Ga0137379_11123001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 692 | Open in IMG/M |
| 3300012351|Ga0137386_10262989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1241 | Open in IMG/M |
| 3300012360|Ga0137375_10088117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3208 | Open in IMG/M |
| 3300012941|Ga0162652_100059493 | Not Available | 635 | Open in IMG/M |
| 3300012971|Ga0126369_11772877 | Not Available | 706 | Open in IMG/M |
| 3300012984|Ga0164309_10244790 | Not Available | 1261 | Open in IMG/M |
| 3300012985|Ga0164308_10796792 | Not Available | 823 | Open in IMG/M |
| 3300013307|Ga0157372_10594977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1289 | Open in IMG/M |
| 3300015374|Ga0132255_105898959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 518 | Open in IMG/M |
| 3300016357|Ga0182032_10611338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Hankyongella → Hankyongella ginsenosidimutans | 908 | Open in IMG/M |
| 3300016387|Ga0182040_10552256 | Not Available | 927 | Open in IMG/M |
| 3300018476|Ga0190274_11013530 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 905 | Open in IMG/M |
| 3300019361|Ga0173482_10062792 | Not Available | 1246 | Open in IMG/M |
| 3300019869|Ga0193705_1009832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2091 | Open in IMG/M |
| 3300020001|Ga0193731_1003317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4134 | Open in IMG/M |
| 3300020016|Ga0193696_1004071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4154 | Open in IMG/M |
| 3300021344|Ga0193719_10065421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1578 | Open in IMG/M |
| 3300021405|Ga0210387_11471154 | Not Available | 584 | Open in IMG/M |
| 3300021560|Ga0126371_13716734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 515 | Open in IMG/M |
| 3300022694|Ga0222623_10028428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → environmental samples → uncultured Microvirga sp. | 2113 | Open in IMG/M |
| 3300022694|Ga0222623_10354694 | Not Available | 560 | Open in IMG/M |
| 3300025898|Ga0207692_10137081 | Not Available | 1388 | Open in IMG/M |
| 3300025898|Ga0207692_10146663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1347 | Open in IMG/M |
| 3300025934|Ga0207686_11776616 | Not Available | 510 | Open in IMG/M |
| 3300026361|Ga0257176_1026016 | Not Available | 866 | Open in IMG/M |
| 3300026508|Ga0257161_1078059 | Not Available | 682 | Open in IMG/M |
| 3300026538|Ga0209056_10499422 | Not Available | 639 | Open in IMG/M |
| 3300027633|Ga0208988_1029273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → environmental samples → uncultured Microvirga sp. | 1418 | Open in IMG/M |
| 3300027846|Ga0209180_10595362 | Not Available | 611 | Open in IMG/M |
| 3300028536|Ga0137415_10965991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 663 | Open in IMG/M |
| 3300028714|Ga0307309_10134378 | Not Available | 615 | Open in IMG/M |
| 3300028719|Ga0307301_10033848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1539 | Open in IMG/M |
| 3300028720|Ga0307317_10140044 | Not Available | 810 | Open in IMG/M |
| 3300028744|Ga0307318_10316807 | Not Available | 547 | Open in IMG/M |
| 3300028778|Ga0307288_10019447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → environmental samples → uncultured Microvirga sp. | 2166 | Open in IMG/M |
| 3300028782|Ga0307306_10120007 | Not Available | 713 | Open in IMG/M |
| 3300028803|Ga0307281_10336179 | Not Available | 569 | Open in IMG/M |
| 3300028814|Ga0307302_10153609 | Not Available | 1116 | Open in IMG/M |
| 3300028824|Ga0307310_10499807 | Not Available | 612 | Open in IMG/M |
| 3300031231|Ga0170824_104115481 | Not Available | 566 | Open in IMG/M |
| 3300031546|Ga0318538_10380187 | Not Available | 763 | Open in IMG/M |
| 3300031681|Ga0318572_10699211 | Not Available | 603 | Open in IMG/M |
| 3300031713|Ga0318496_10323576 | Not Available | 851 | Open in IMG/M |
| 3300031736|Ga0318501_10529684 | Not Available | 644 | Open in IMG/M |
| 3300031763|Ga0318537_10129501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 938 | Open in IMG/M |
| 3300031770|Ga0318521_10315976 | Not Available | 921 | Open in IMG/M |
| 3300031770|Ga0318521_10519316 | Not Available | 716 | Open in IMG/M |
| 3300031771|Ga0318546_10167236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1489 | Open in IMG/M |
| 3300031778|Ga0318498_10288884 | Not Available | 736 | Open in IMG/M |
| 3300031778|Ga0318498_10533113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 516 | Open in IMG/M |
| 3300031778|Ga0318498_10537768 | Not Available | 513 | Open in IMG/M |
| 3300031779|Ga0318566_10603197 | Not Available | 534 | Open in IMG/M |
| 3300031782|Ga0318552_10383446 | Not Available | 716 | Open in IMG/M |
| 3300031792|Ga0318529_10456473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 594 | Open in IMG/M |
| 3300031796|Ga0318576_10070423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1553 | Open in IMG/M |
| 3300031845|Ga0318511_10065446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1490 | Open in IMG/M |
| 3300031859|Ga0318527_10305361 | Not Available | 677 | Open in IMG/M |
| 3300031893|Ga0318536_10234813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 932 | Open in IMG/M |
| 3300031894|Ga0318522_10034313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1732 | Open in IMG/M |
| 3300031945|Ga0310913_11128420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 547 | Open in IMG/M |
| 3300032001|Ga0306922_10573721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1197 | Open in IMG/M |
| 3300032025|Ga0318507_10161017 | Not Available | 962 | Open in IMG/M |
| 3300032035|Ga0310911_10270141 | Not Available | 975 | Open in IMG/M |
| 3300032041|Ga0318549_10218253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 857 | Open in IMG/M |
| 3300032060|Ga0318505_10048259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1816 | Open in IMG/M |
| 3300032065|Ga0318513_10096627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1378 | Open in IMG/M |
| 3300032065|Ga0318513_10402213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 668 | Open in IMG/M |
| 3300032067|Ga0318524_10700148 | Not Available | 534 | Open in IMG/M |
| 3300032076|Ga0306924_10097455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3320 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 26.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 15.18% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.71% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.14% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.25% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.46% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.57% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.57% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.79% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.79% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.79% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.89% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.89% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.89% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.89% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Host-Associated | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002906 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm | Environmental | Open in IMG/M |
| 3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012941 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019869 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2 | Environmental | Open in IMG/M |
| 3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
| 3300020016 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1 | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026361 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-B | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028714 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24744J21845_100159991 | 3300002077 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEQPGPDKYVETPRDRRIANAVLLLFLVLIVGGGIWLAN |
| JGIcombinedJ26739_1000813842 | 3300002245 | Forest Soil | MNEPEQRKEDRYVETARDRRIANALLLFFVIVVVGGGIWLANAMFEQ |
| JGI25614J43888_101714382 | 3300002906 | Grasslands Soil | MDNLDESKEEKYVETARERRIANAVLLFFLLVVVGGGIWLANA |
| Ga0066397_101336151 | 3300004281 | Tropical Forest Soil | MDEPEAPRGDKYVETARDRRIANALLLFFLIVVVGGGIWLAN |
| Ga0066395_108818691 | 3300004633 | Tropical Forest Soil | MTEPEQTRQDKYVETARERRIANAVLLFFLLVVVGGGIWLANAMFEQR |
| Ga0066673_107137871 | 3300005175 | Soil | MNEPEPPNGDKYVETARERRIANVVLLLFLVLIVGGGIWLANAMF |
| Ga0066690_103517751 | 3300005177 | Soil | MDGSEQPRQEKYVETARDRRIANALLLFFVIVVVGGGIWL |
| Ga0066388_1020189411 | 3300005332 | Tropical Forest Soil | MNEQEPLRPDDYVETPRDRRIANAVLLFFLILVVGGGIWLA |
| Ga0066388_1084609632 | 3300005332 | Tropical Forest Soil | VIEPEQPQQDKYVETARDRRIANALLLFFLIVVVGGGIWLANAMFEQRR |
| Ga0066388_1086698712 | 3300005332 | Tropical Forest Soil | MEDSPPPKQDEYVETERDRRIANAVLVTFLVVLVGGGIWLANAMFDQRRIDDCVAQ |
| Ga0070685_109242402 | 3300005466 | Switchgrass Rhizosphere | MSEQPGPDKYVETPRDRRIANAVLLLFLVLIVGGGIWLANA |
| Ga0070679_1021319872 | 3300005530 | Corn Rhizosphere | MIRSMSEPGPDKYVETPRDRWVANAVLLFFLLLVVGGGIWLANAMFEQR |
| Ga0070704_1018032582 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MNEPEPSNGDRYVETARERRIANAVLLLFLVLIVGGGIWLANAMF |
| Ga0066661_100920821 | 3300005554 | Soil | MDGSEQPRQEKYVETARDRRIANALLLFFVIVVVGGGIW |
| Ga0066905_1009010571 | 3300005713 | Tropical Forest Soil | MNEPEPPNGDKYVETARERRIANAVLLLFLVLIVGGGIWLANAMFDQR |
| Ga0066903_1011460561 | 3300005764 | Tropical Forest Soil | MFARYHAGMNEPEPPNGDKYVETARERRIANAVLLLFLVLIV |
| Ga0068858_1019690491 | 3300005842 | Switchgrass Rhizosphere | MIRSMSEPGPDKYVETPRDRWVANAVLLFFLLLVVGGGIWLAN |
| Ga0081455_104909311 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MSEPEQHGPDDYVETPRDRRIANALLLFFLIVVVGGGI |
| Ga0070717_121292341 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MDEPETPKGDKYVETARDRRIANALLLFFVIVVVGGGIWLAN |
| Ga0075365_101500871 | 3300006038 | Populus Endosphere | MNEQEPLRPDDYVETPRDRRIANAVLLLFLVLIVGGGIWLAN |
| Ga0097621_1012158432 | 3300006237 | Miscanthus Rhizosphere | MIRSMSEPGPDKYVETPRDRWVANAVLLFFLLQVVGGGIWLANA |
| Ga0066665_109583641 | 3300006796 | Soil | MDEARPPNEYRETARERRIANLVLLVLLVVLVGGGLWLANAMFEQRMIDDCV |
| Ga0075431_1001028242 | 3300006847 | Populus Rhizosphere | MSEQPGPEKYVETPRDRRIANAVLLLFLIIIVGGGIWLANA |
| Ga0075425_1004995712 | 3300006854 | Populus Rhizosphere | MNEPEPPNGDKYVETARERRIANVVLLLFLVVIVGGGIWLANAMFEQRRL |
| Ga0075425_1020140702 | 3300006854 | Populus Rhizosphere | MDEPEATKGDKYVETARDRRIANALLLFFVIVVVGGGIWLANAMFE |
| Ga0075434_1018961022 | 3300006871 | Populus Rhizosphere | MSEPEQRRPDDYVETPRDRRIANALLLFFLIVVVGGGIWLAN |
| Ga0066710_1002344022 | 3300009012 | Grasslands Soil | MDGSEQPRQEKYVETARDRRIANALLLFFVIVVVGGGIWLA |
| Ga0099830_105393131 | 3300009088 | Vadose Zone Soil | MDEPKSPKQDEYVESERDRRIANAVLLVFFIVVVGAGIWLANAMLDQRKLDD |
| Ga0105247_104409881 | 3300009101 | Switchgrass Rhizosphere | MSEQTGPDKYVETPRDRRIANAVLLLFLVLIVGGGIW |
| Ga0075423_104648441 | 3300009162 | Populus Rhizosphere | MDGSEQPRQEKYVETARDRRIANALLLFFVIVVVGGGIWLANAMFEQ |
| Ga0126380_108899931 | 3300010043 | Tropical Forest Soil | MDDPEQPRQDKYVETARDRRIANAVLLFFLIVVVGGGIWLANAMFEQRRLDDCLAQ |
| Ga0126384_119583741 | 3300010046 | Tropical Forest Soil | MDEPEAPRGDKYVETARDRRIANAVLLFFLIVVVGG |
| Ga0126373_110477972 | 3300010048 | Tropical Forest Soil | MDEPEAPKGDKYVETARDRRIANALLLFFLIVVVGGGIWLANAMFE |
| Ga0126370_107462481 | 3300010358 | Tropical Forest Soil | MDEPETPKDDKYVETARDRRIANAVLLFFLIVVVGG |
| Ga0126376_108215782 | 3300010359 | Tropical Forest Soil | MDEPETPKDDKYVETARDRRIANAVLLFFLIVVVGGGIWLANAMFEQRRLDDC |
| Ga0126372_127883652 | 3300010360 | Tropical Forest Soil | MNEPEPANGDKYVETARERRIANVVLLLFLVLIVGG |
| Ga0126372_129461862 | 3300010360 | Tropical Forest Soil | MDEPEAPKGDNYVETARDRRIANALLLFFVIVVVGGGIWLANAMFEQRQLD |
| Ga0126378_106518581 | 3300010361 | Tropical Forest Soil | MDEPETPKDDKYVETARDRRIANAVLLFFLIVVVGGGIWLANAMFEQRRLDDCLAQGG |
| Ga0126379_135032782 | 3300010366 | Tropical Forest Soil | MDEPEAPKGDKYVETARDRRIANALLLFFLIVVVGGGIWLANAMFEQR |
| Ga0126383_113138721 | 3300010398 | Tropical Forest Soil | LSGYDRAVIEPEQPQQDKYVETARDRRIANALLLFFLIVVVGGGIWLANAM |
| Ga0134121_107887572 | 3300010401 | Terrestrial Soil | MSEQPGPDKYVETPRDRRIANAVLLLFLVLIVGGGIWLANAMFDQRALD |
| Ga0137391_111814222 | 3300011270 | Vadose Zone Soil | MDNLEESKEEKYVETARERRIANAVLLFFLLVVVGGGIWLANAIFEQHRLDDYIALGRRN |
| Ga0137376_101366671 | 3300012208 | Vadose Zone Soil | MNEPEPSNGDRYVETARERRIANAVLLLFLVLIVGGGI |
| Ga0137379_111230012 | 3300012209 | Vadose Zone Soil | MDDPGQPNDDKYVETARERRIANALLLFFLILVVGGGIWLANAMFE |
| Ga0137386_102629891 | 3300012351 | Vadose Zone Soil | MDEPEAPKGDKYVETARDRRIANALLLFFLIVVVGGGIWLANAMFEQRRLDDCMAQ |
| Ga0137375_100881171 | 3300012360 | Vadose Zone Soil | MDEPEAPKGDKYVETARDRRIANALLLFFLIVVVG |
| Ga0162652_1000594931 | 3300012941 | Soil | LTGYDRAVNEPEQPNGDKYVETARDRRIANALLLFFLIVVVGGGIWLANAMFEQRR |
| Ga0126369_117728772 | 3300012971 | Tropical Forest Soil | MDEPEAPRGDKYVETARDRRIANAILLFFLIVVVGGGIWLANAMFEQ |
| Ga0164309_102447901 | 3300012984 | Soil | MIRSMSEPGPDKYVETPRDRWVANAVLLFFLLLVVGGGIWLANAMFEQRALDD |
| Ga0164308_107967922 | 3300012985 | Soil | MIRSMSEPGPDKYVETPRDRWVANAVLLFFLLLVVGGGIWLANA |
| Ga0157372_105949771 | 3300013307 | Corn Rhizosphere | VETPRDRRIANAVLLLFLVLIVGGGIWLAHAMFDQRALDNCMAQ |
| Ga0132255_1058989591 | 3300015374 | Arabidopsis Rhizosphere | MNEQEPLRPDDYVETPRDRRIANAVLLFFLILVVGGGIWLANAMFEQRALDNC |
| Ga0182032_106113382 | 3300016357 | Soil | MDEPEQPQEDKYVETARDRRIANALILFFLVLVVGGGIWLAN |
| Ga0182040_105522561 | 3300016387 | Soil | MDEPEAPKGDKYVETARDRRIANALLLFFVIVVVGGGIWLANAMFEQRQLDDCLAQG |
| Ga0190274_110135302 | 3300018476 | Soil | MNEQEPLRPDDYVETPRDRRIANAVLLLFLVLIVGGGIWLANAMFDQRALDNC |
| Ga0173482_100627921 | 3300019361 | Soil | MSEQPGPDKYVETPRDRRIANAVLLLFLVLIVGGGIWLANAM |
| Ga0193705_10098323 | 3300019869 | Soil | MMRRMSEQPGPDKYVETARDRRIANAVLLLFLVLIVGGG |
| Ga0193731_10033174 | 3300020001 | Soil | MMRRMSEQPGPDRYVETARDRRIANAVLLLFLVLIVGGGIWLANAMFDQRALDDCM |
| Ga0193696_10040711 | 3300020016 | Soil | MSEQPGPDKYVETPRDRRIANAVLLLFLVLIVGGGIWLA |
| Ga0193719_100654211 | 3300021344 | Soil | MMRRMSEQPGPDKYVETARDRRIANAVLLLFLVLIV |
| Ga0210387_114711541 | 3300021405 | Soil | MNEPEQRKEDRYVETARDRRIANALLLFFVIVVVGG |
| Ga0126371_137167341 | 3300021560 | Tropical Forest Soil | MDEPEAPKGDKYVETARDRRIANALLLFFLIVVVGGGIWLANAMF |
| Ga0222623_100284281 | 3300022694 | Groundwater Sediment | MMRRMSEQPGPDKYVETARDRRIANAVLLLFLVLIVGGGIWLANAMFD |
| Ga0222623_103546941 | 3300022694 | Groundwater Sediment | MMRRMSEQPGPDKYVETARDRRIANAVLLLFLVLIVGGGIWLANA |
| Ga0207692_101370811 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MNEPEPSNGDRYVETARERRIANAVLLLFLVLIVGG |
| Ga0207692_101466632 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEQPGPDKYVETPRDRRIANAVLLLFLVLIVGGGI |
| Ga0207686_117766161 | 3300025934 | Miscanthus Rhizosphere | MSEQPGPDKYVETPRDRRIANAVLLLFLVLIVVGGIWLANAMFDQRALDNCMAQ |
| Ga0257176_10260161 | 3300026361 | Soil | MNEPEQRKEDRYVETARDRRIANALLLFFVIVVVGGGIWLANAMFEQRQLDDC |
| Ga0257161_10780592 | 3300026508 | Soil | MNEPEAHKGDKYVETARDRRIANALLLFFVIVVVGGGIWLANAM |
| Ga0209056_104994222 | 3300026538 | Soil | MDGSEQPRQEKYVETARDRRIANALLLFFVIVVVGGGIWLANAMFEQRLLD |
| Ga0208988_10292731 | 3300027633 | Forest Soil | MIARMSEQPGPDKYVETARDRWIANAVLLFFLVLI |
| Ga0209180_105953622 | 3300027846 | Vadose Zone Soil | MDDPTSPTPGERKPDDYVESDRDRRIANAVLLIFILVLVGGGIWL |
| Ga0137415_109659911 | 3300028536 | Vadose Zone Soil | MDEPNATGPEKYIETPRDRRVANIILLLILAAVVGGGIWLANAMFEQRALD |
| Ga0307309_101343783 | 3300028714 | Soil | MSEQPGPDKYVETPRDRRIANAVLLLLMILIVGGG |
| Ga0307301_100338481 | 3300028719 | Soil | MMRRMSEQPGPDKYVETARDRRIANAVLLLFLVLIVGGGIWL |
| Ga0307317_101400441 | 3300028720 | Soil | MSEQPGPDKYVETARDRRIANAVLLLFLVLIVGGGIWLANAMFDQRALD |
| Ga0307318_103168071 | 3300028744 | Soil | MMRRMSEQPGPDKYVETARDRRIANAVLLLFLVLIVGGGIWLA |
| Ga0307288_100194472 | 3300028778 | Soil | MMRRMSEQPGPDKYVETARDRRIANAVLLLFLVLIVGGGI |
| Ga0307306_101200072 | 3300028782 | Soil | MSEQPGPDKYVETPRDRRIANAVLLLFLVLIVGGGIWLANAMFDQRAL |
| Ga0307281_103361791 | 3300028803 | Soil | MSEQPGPDKYVETARDRRIANAVLLLFLVLIVGGGIWLANAMFDQR |
| Ga0307302_101536092 | 3300028814 | Soil | LTGYDRAVNEPEQPNGDKYVETARDRRIANALLLFFLIVVVGGGIW |
| Ga0307310_104998072 | 3300028824 | Soil | MSEQPGPDKYVETPRDRRIANAVLLLFLVLIVGGGIWL |
| Ga0170824_1041154811 | 3300031231 | Forest Soil | MSEQPGPDKYVETPRDRRIANAVLLLFLVLIVGGGIWLANAMFDQRALDN |
| Ga0318538_103801872 | 3300031546 | Soil | MDEPEQPQEDKYVETARDRRIANALILFFLVLVVGGGIWLANALFEQRR |
| Ga0318572_106992111 | 3300031681 | Soil | MDEPEAPKGDKYVETARDRRIANALLLFFVIVVVGGGIWLANAMFEQRQ |
| Ga0318496_103235762 | 3300031713 | Soil | MDEPEAPKGDKYVETARDRRIANALLLFFVIVVVGGGIWLANAMFEQRQLDD |
| Ga0318501_105296842 | 3300031736 | Soil | MDEPEQPQEDKYVETARDRRIANALILFFLVLVVGGGIWLANAL |
| Ga0318537_101295012 | 3300031763 | Soil | MDEPEAPRGDKYVETARDRRIANAVLLFFLVVVVGGGIW |
| Ga0318521_103159761 | 3300031770 | Soil | MDEPEAPRGDKYVETARDRRIANAVLLFFLVVVVGGGIWLANAMFEQRRLDDCLAQ |
| Ga0318521_105193162 | 3300031770 | Soil | MDGSEQPKQEKYVETARDRRIANALLLFFLIVVVGGGIWLANAMFEQRQLDD |
| Ga0318546_101672362 | 3300031771 | Soil | MDEPEAPKGDKYVETARDRRIANALLLFFVIVVVGGGIWLANAMFEQRQLDDCLALGGRY |
| Ga0318498_102888841 | 3300031778 | Soil | MDDPEQPGQDKYVETARDRRIANALLLFFLVVVVGGGIWLANAMFE |
| Ga0318498_105331132 | 3300031778 | Soil | MDQPQPPRPDEYRETPRDRRIANLVLLVLLVILVGGGIWLANAMFE |
| Ga0318498_105377681 | 3300031778 | Soil | MDEPEQPQEDKYVETARDRRIANALILFFLVLVVGGGIWLANALFEQRRL |
| Ga0318566_106031972 | 3300031779 | Soil | MDGSEQPKQEKYVETARDRRIANALLLFFLIVVVGGGIW |
| Ga0318552_103834462 | 3300031782 | Soil | MDGSEQPKQEKYVETARDRRIANALLLFFLIVVVGGGIWLANAMFEQRQLDDCLAQGGR |
| Ga0318529_104564731 | 3300031792 | Soil | MDQPQPPRPDEYRETPRDRRIANLVLLVLLVILVGGGIWLANA |
| Ga0318576_100704232 | 3300031796 | Soil | MDEPEAPKGDNYVETARDRRIANALLLFFLIVVVGGGIWLANAMFEQRQLDDCL |
| Ga0318511_100654462 | 3300031845 | Soil | MDDPEQPRQDKYVETARDRRIANALLLFFLVVVVG |
| Ga0318527_103053612 | 3300031859 | Soil | MDGSEQPKQEKYVETARDRRIANALLLFFLIVVVGGGIWLA |
| Ga0318536_102348132 | 3300031893 | Soil | MDPRQDEYVETARDRRIANALLLFFLVVVVGGGIWLANAMFEQR |
| Ga0318522_100343132 | 3300031894 | Soil | MDEPEAPRGDKYVETARDRRIANAVLLFFLVVVVGGGIWLANA |
| Ga0310913_111284201 | 3300031945 | Soil | MDEPEAPKGDKYVETARDRRIANALLLFFVIVVVGGGIWLANAMFEQ |
| Ga0306922_105737211 | 3300032001 | Soil | MDGSEQPKQEKYVETARDRRIANALLLFFLIVVVGGGIWLANAMFEQRQ |
| Ga0318507_101610172 | 3300032025 | Soil | MDGSEQPKQEKYVETARDRRIANALLLFFLIVVVGGGIWLANAMFEQRQLDDCLAQG |
| Ga0310911_102701412 | 3300032035 | Soil | MDGSEQPKQEKYVETARDRRIANALLLFFLIVVVGGGIWLANAMFEQRQLDDCL |
| Ga0318549_102182531 | 3300032041 | Soil | MDEPEAPKGDKYVETARDRRIANALLLFFVIVVVGGGIWLA |
| Ga0318505_100482591 | 3300032060 | Soil | MDEPEAPRGDKYVETARDRRIANAVLLFFLVVVVGGGIWLANAMFEQRQLDD |
| Ga0318513_100966272 | 3300032065 | Soil | MDEPEAPRGDKYVETARDRRIANAVLLFFLIVVVGGGIWLANAMFEQ |
| Ga0318513_104022132 | 3300032065 | Soil | MDQPQPPRPDEYRETPRDRRIANLVLLVLLVILVGGGIWLANAMFEQRMLDDCVA |
| Ga0318524_107001482 | 3300032067 | Soil | MDEPEAPKGDKYVETARDRRIANALLLFFVIVVVGGGIWL |
| Ga0306924_100974553 | 3300032076 | Soil | MDDPEQPRQDKYVETARDRRIANALLLFFLVVVVGGGIWLA |
| ⦗Top⦘ |