


| Basic Information | |
|---|---|
| Family ID | F084357 |
| Family Type | Metagenome |
| Number of Sequences | 112 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MKNYLSKPKDEYLVKDPNLNIHFKIINGVRYWLTPPPSDYKK |
| Number of Associated Samples | 68 |
| Number of Associated Scaffolds | 112 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 77.68 % |
| % of genes near scaffold ends (potentially truncated) | 14.29 % |
| % of genes from short scaffolds (< 2000 bps) | 68.75 % |
| Associated GOLD sequencing projects | 61 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (50.893 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine (31.250 % of family members) |
| Environment Ontology (ENVO) | Unclassified (86.607 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (93.750 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 22.86% Coil/Unstructured: 77.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 112 Family Scaffolds |
|---|---|---|
| PF04404 | ERF | 20.54 |
| PF01402 | RHH_1 | 1.79 |
| PF01555 | N6_N4_Mtase | 0.89 |
| PF13550 | Phage-tail_3 | 0.89 |
| PF13884 | Peptidase_S74 | 0.89 |
| PF00386 | C1q | 0.89 |
| COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
|---|---|---|---|
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.89 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.89 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 77.68 % |
| Unclassified | root | N/A | 22.32 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000947|BBAY92_10036020 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1352 | Open in IMG/M |
| 3300000947|BBAY92_10098233 | Not Available | 780 | Open in IMG/M |
| 3300000973|BBAY93_10187363 | Not Available | 518 | Open in IMG/M |
| 3300000973|BBAY93_10187625 | Not Available | 517 | Open in IMG/M |
| 3300001829|ACM55_1022485 | Not Available | 575 | Open in IMG/M |
| 3300001832|ACM6_1009293 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1054 | Open in IMG/M |
| 3300001832|ACM6_1026426 | All Organisms → Viruses | 983 | Open in IMG/M |
| 3300001955|GOS2237_1045723 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 1590 | Open in IMG/M |
| 3300001961|GOS2240_1003252 | All Organisms → Viruses | 1914 | Open in IMG/M |
| 3300001969|GOS2233_1059829 | Not Available | 1828 | Open in IMG/M |
| 3300002482|JGI25127J35165_1001327 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7113 | Open in IMG/M |
| 3300002482|JGI25127J35165_1015962 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1867 | Open in IMG/M |
| 3300002482|JGI25127J35165_1021996 | All Organisms → Viruses | 1525 | Open in IMG/M |
| 3300002482|JGI25127J35165_1127105 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 502 | Open in IMG/M |
| 3300002483|JGI25132J35274_1080585 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 673 | Open in IMG/M |
| 3300002488|JGI25128J35275_1037195 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1104 | Open in IMG/M |
| 3300005057|Ga0068511_1051086 | Not Available | 679 | Open in IMG/M |
| 3300005057|Ga0068511_1063672 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 622 | Open in IMG/M |
| 3300005608|Ga0066840_10087112 | Not Available | 645 | Open in IMG/M |
| 3300005837|Ga0078893_13586898 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1245 | Open in IMG/M |
| 3300006027|Ga0075462_10176287 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 648 | Open in IMG/M |
| 3300006305|Ga0068468_1024177 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1284 | Open in IMG/M |
| 3300006735|Ga0098038_1180390 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 691 | Open in IMG/M |
| 3300006737|Ga0098037_1125636 | Not Available | 875 | Open in IMG/M |
| 3300006749|Ga0098042_1002655 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6439 | Open in IMG/M |
| 3300006749|Ga0098042_1139288 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 599 | Open in IMG/M |
| 3300006919|Ga0070746_10076593 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1697 | Open in IMG/M |
| 3300006919|Ga0070746_10085488 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1590 | Open in IMG/M |
| 3300007113|Ga0101666_1010699 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1497 | Open in IMG/M |
| 3300007114|Ga0101668_1008629 | All Organisms → Viruses | 1788 | Open in IMG/M |
| 3300009790|Ga0115012_12011207 | Not Available | 512 | Open in IMG/M |
| 3300012919|Ga0160422_10023656 | All Organisms → Viruses | 3563 | Open in IMG/M |
| 3300012919|Ga0160422_10050947 | All Organisms → cellular organisms → Bacteria | 2406 | Open in IMG/M |
| 3300012919|Ga0160422_10116759 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1582 | Open in IMG/M |
| 3300012919|Ga0160422_10325731 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 948 | Open in IMG/M |
| 3300012919|Ga0160422_10821904 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 597 | Open in IMG/M |
| 3300012919|Ga0160422_10878266 | Not Available | 577 | Open in IMG/M |
| 3300012920|Ga0160423_10059053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 2766 | Open in IMG/M |
| 3300012920|Ga0160423_10078202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 2357 | Open in IMG/M |
| 3300012920|Ga0160423_10084235 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 2260 | Open in IMG/M |
| 3300012920|Ga0160423_10221596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 1314 | Open in IMG/M |
| 3300012920|Ga0160423_10328562 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1050 | Open in IMG/M |
| 3300012920|Ga0160423_10368923 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 983 | Open in IMG/M |
| 3300012920|Ga0160423_10468197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 858 | Open in IMG/M |
| 3300012920|Ga0160423_10572171 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 766 | Open in IMG/M |
| 3300012920|Ga0160423_10600359 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 746 | Open in IMG/M |
| 3300012952|Ga0163180_10001781 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 12191 | Open in IMG/M |
| 3300012953|Ga0163179_10540480 | Not Available | 969 | Open in IMG/M |
| 3300012954|Ga0163111_10795897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium REDSEA-S02_B3 | 900 | Open in IMG/M |
| 3300017710|Ga0181403_1084750 | Not Available | 659 | Open in IMG/M |
| 3300017720|Ga0181383_1067531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 960 | Open in IMG/M |
| 3300017731|Ga0181416_1091274 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 725 | Open in IMG/M |
| 3300017733|Ga0181426_1028130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 1104 | Open in IMG/M |
| 3300017734|Ga0187222_1000760 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 9943 | Open in IMG/M |
| 3300017745|Ga0181427_1050298 | Not Available | 1030 | Open in IMG/M |
| 3300017756|Ga0181382_1157312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 589 | Open in IMG/M |
| 3300017758|Ga0181409_1155230 | Not Available | 668 | Open in IMG/M |
| 3300017759|Ga0181414_1093116 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 794 | Open in IMG/M |
| 3300020242|Ga0211701_1000128 | All Organisms → Viruses | 2851 | Open in IMG/M |
| 3300020248|Ga0211584_1000431 | All Organisms → Viruses | 5956 | Open in IMG/M |
| 3300020251|Ga0211700_1012203 | Not Available | 980 | Open in IMG/M |
| 3300020367|Ga0211703_10156486 | Not Available | 591 | Open in IMG/M |
| 3300020380|Ga0211498_10009814 | Not Available | 3485 | Open in IMG/M |
| 3300020393|Ga0211618_10028389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 2316 | Open in IMG/M |
| 3300020403|Ga0211532_10043620 | All Organisms → cellular organisms → Bacteria | 2169 | Open in IMG/M |
| 3300020405|Ga0211496_10120842 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 960 | Open in IMG/M |
| 3300020406|Ga0211668_10009166 | All Organisms → Viruses | 5194 | Open in IMG/M |
| 3300020410|Ga0211699_10235957 | Not Available | 704 | Open in IMG/M |
| 3300020410|Ga0211699_10348815 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 582 | Open in IMG/M |
| 3300020411|Ga0211587_10466942 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 506 | Open in IMG/M |
| 3300020417|Ga0211528_10023244 | All Organisms → Viruses | 3044 | Open in IMG/M |
| 3300020420|Ga0211580_10005950 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5688 | Open in IMG/M |
| 3300020420|Ga0211580_10170453 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 904 | Open in IMG/M |
| 3300020420|Ga0211580_10283404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 681 | Open in IMG/M |
| 3300020433|Ga0211565_10009820 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4073 | Open in IMG/M |
| 3300020436|Ga0211708_10002540 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6822 | Open in IMG/M |
| 3300020436|Ga0211708_10085326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 1229 | Open in IMG/M |
| 3300020436|Ga0211708_10104746 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1109 | Open in IMG/M |
| 3300020436|Ga0211708_10441576 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 534 | Open in IMG/M |
| 3300020438|Ga0211576_10078516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 1844 | Open in IMG/M |
| 3300020448|Ga0211638_10300788 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 745 | Open in IMG/M |
| 3300020461|Ga0211535_10380059 | Not Available | 639 | Open in IMG/M |
| 3300020470|Ga0211543_10002208 | Not Available | 12862 | Open in IMG/M |
| 3300020471|Ga0211614_10002885 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7366 | Open in IMG/M |
| 3300022066|Ga0224902_100142 | All Organisms → Viruses | 3375 | Open in IMG/M |
| 3300022074|Ga0224906_1058935 | All Organisms → Viruses | 1208 | Open in IMG/M |
| 3300025086|Ga0208157_1054523 | Not Available | 1063 | Open in IMG/M |
| 3300025101|Ga0208159_1002640 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6139 | Open in IMG/M |
| 3300025101|Ga0208159_1013994 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2069 | Open in IMG/M |
| 3300025127|Ga0209348_1005483 | All Organisms → Viruses | 5474 | Open in IMG/M |
| 3300025127|Ga0209348_1005631 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5391 | Open in IMG/M |
| 3300025127|Ga0209348_1006163 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5101 | Open in IMG/M |
| 3300025127|Ga0209348_1026019 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2138 | Open in IMG/M |
| 3300025127|Ga0209348_1050991 | All Organisms → Viruses → Predicted Viral | 1397 | Open in IMG/M |
| 3300025127|Ga0209348_1089299 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 972 | Open in IMG/M |
| 3300025132|Ga0209232_1007408 | All Organisms → Viruses | 4698 | Open in IMG/M |
| 3300025132|Ga0209232_1046611 | All Organisms → Viruses | 1600 | Open in IMG/M |
| 3300025132|Ga0209232_1207440 | Not Available | 595 | Open in IMG/M |
| 3300025151|Ga0209645_1007373 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4607 | Open in IMG/M |
| 3300025151|Ga0209645_1064899 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1245 | Open in IMG/M |
| 3300029318|Ga0185543_1116170 | Not Available | 502 | Open in IMG/M |
| 3300029319|Ga0183748_1000998 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 17868 | Open in IMG/M |
| 3300029319|Ga0183748_1014292 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3090 | Open in IMG/M |
| 3300029319|Ga0183748_1073985 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 864 | Open in IMG/M |
| 3300029792|Ga0183826_1003639 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2855 | Open in IMG/M |
| 3300029792|Ga0183826_1004634 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 2477 | Open in IMG/M |
| 3300029792|Ga0183826_1024295 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 968 | Open in IMG/M |
| 3300029792|Ga0183826_1031808 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 832 | Open in IMG/M |
| 3300029792|Ga0183826_1054967 | Not Available | 609 | Open in IMG/M |
| 3300031785|Ga0310343_10000093 | Not Available | 36321 | Open in IMG/M |
| 3300031785|Ga0310343_10168833 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1473 | Open in IMG/M |
| 3300032073|Ga0315315_11522049 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 579 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 31.25% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 24.11% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 9.82% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 8.93% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 5.36% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 3.57% |
| Marine Plankton | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton | 2.68% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.68% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.79% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.79% |
| Marine Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water | 1.79% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.79% |
| Volcanic Co2 Seep Seawater | Environmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seep Seawater | 1.79% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.89% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.89% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000947 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92 | Host-Associated | Open in IMG/M |
| 3300000973 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY93 | Host-Associated | Open in IMG/M |
| 3300001829 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM55, ROCA_DNA132_0.2um_27g | Environmental | Open in IMG/M |
| 3300001832 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM6, ROCA_DNA131_0.2um_27b | Environmental | Open in IMG/M |
| 3300001955 | Marine microbial communities from Gulf of Panama, Panama - GS021 | Environmental | Open in IMG/M |
| 3300001961 | Marine microbial communities from Dirty Rock, Cocos Island, Costa Rica - GS025 | Environmental | Open in IMG/M |
| 3300001969 | Marine microbial communities from Yucatan Channel, Mexico - GS017 | Environmental | Open in IMG/M |
| 3300002482 | Marine viral communities from the Pacific Ocean - ETNP_2_30 | Environmental | Open in IMG/M |
| 3300002483 | Marine viral communities from the Pacific Ocean - ETNP_6_30 | Environmental | Open in IMG/M |
| 3300002488 | Marine viral communities from the Pacific Ocean - ETNP_2_60 | Environmental | Open in IMG/M |
| 3300005057 | Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-0.2um | Environmental | Open in IMG/M |
| 3300005608 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302PF84A | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006305 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_1_0025m | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300007113 | Seawater microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'bubble' site, Water-is | Environmental | Open in IMG/M |
| 3300007114 | Seawater microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'bubble', waterEBis4 | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300012919 | Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012952 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017733 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23 | Environmental | Open in IMG/M |
| 3300017734 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 (version 2) | Environmental | Open in IMG/M |
| 3300017745 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15 | Environmental | Open in IMG/M |
| 3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
| 3300020242 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_076 - TARA_B100000513 (ERX555995-ERR599010) | Environmental | Open in IMG/M |
| 3300020248 | Marine microbial communities from Tara Oceans - TARA_B100000123 (ERX556118-ERR599141) | Environmental | Open in IMG/M |
| 3300020251 | Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555940-ERR599040) | Environmental | Open in IMG/M |
| 3300020367 | Marine microbial communities from Tara Oceans - TARA_B100000508 (ERX556112-ERR599005) | Environmental | Open in IMG/M |
| 3300020380 | Marine microbial communities from Tara Oceans - TARA_B000000565 (ERX555945-ERR599058) | Environmental | Open in IMG/M |
| 3300020393 | Marine microbial communities from Tara Oceans - TARA_B100000161 (ERX556105-ERR599054) | Environmental | Open in IMG/M |
| 3300020403 | Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145) | Environmental | Open in IMG/M |
| 3300020405 | Marine microbial communities from Tara Oceans - TARA_B000000532 (ERX556129-ERR599012) | Environmental | Open in IMG/M |
| 3300020406 | Marine microbial communities from Tara Oceans - TARA_B100000886 (ERX555926-ERR599024) | Environmental | Open in IMG/M |
| 3300020410 | Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148) | Environmental | Open in IMG/M |
| 3300020411 | Marine microbial communities from Tara Oceans - TARA_B100000131 (ERX556098-ERR599130) | Environmental | Open in IMG/M |
| 3300020417 | Marine microbial communities from Tara Oceans - TARA_B100000073 (ERX556034-ERR599082) | Environmental | Open in IMG/M |
| 3300020420 | Marine microbial communities from Tara Oceans - TARA_B100001248 (ERX556094-ERR599142) | Environmental | Open in IMG/M |
| 3300020433 | Marine microbial communities from Tara Oceans - TARA_B100001989 (ERX556106-ERR599030) | Environmental | Open in IMG/M |
| 3300020436 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020448 | Marine microbial communities from Tara Oceans - TARA_B100000941 (ERX555919-ERR598954) | Environmental | Open in IMG/M |
| 3300020461 | Marine microbial communities from Tara Oceans - TARA_B100000401 (ERX556127-ERR599150) | Environmental | Open in IMG/M |
| 3300020470 | Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX555976-ERR599053) | Environmental | Open in IMG/M |
| 3300020471 | Marine microbial communities from Tara Oceans - TARA_B100000214 (ERX556063-ERR599002) | Environmental | Open in IMG/M |
| 3300022066 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 (v2) | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025101 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300029318 | Marine giant viral communities collected during Tara Oceans survey from station TARA_038 - TARA_Y100000289 | Environmental | Open in IMG/M |
| 3300029319 | Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516 | Environmental | Open in IMG/M |
| 3300029792 | Marine giant viral communities collected during Tara Oceans survey from station TARA_041 - TARA_Y100000052 | Environmental | Open in IMG/M |
| 3300031785 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-25_MG | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| BBAY92_100360203 | 3300000947 | Macroalgal Surface | MKNYLSRNKDEYLIKDPNLNIHFKIINGVRYWLTPPPSSYKK* |
| BBAY92_100982334 | 3300000947 | Macroalgal Surface | MKNYLSNSKQNEYLKLDPNLKIHFKIIDGVRYWLTPPPTGYQK* |
| BBAY93_101873632 | 3300000973 | Macroalgal Surface | MKSYLSKPKDEYLVKDPNLNVHFKIINGVRYWLTPPPSDYKK* |
| BBAY93_101876252 | 3300000973 | Macroalgal Surface | MTCLSKDKDEYLVKDPNLNVHFKIINGVRYWLTPPPSSYKK* |
| ACM55_10224852 | 3300001829 | Marine Plankton | MKNYLSKPKDEYLVKDPNLNIHFKIINGVRYWLTPPPSDYKK* |
| ACM6_10092934 | 3300001832 | Marine Plankton | MKSYLSKPKDEYLVKDPNLNVHFKIINGVRYWLTPPPTGYQK* |
| ACM6_10264264 | 3300001832 | Marine Plankton | MKNYLSKPKDEYLVKDPNLNIHFKIINGVRYWLTPPPLDYKK* |
| GOS2237_10457232 | 3300001955 | Marine | MKSYLSKTKDEYLVKDPNLNIHFKIINGVRYWLTPPPSDYKK* |
| GOS2240_10032525 | 3300001961 | Marine | MKNYLSNSKQNEYLKLDPNLKIHFKIINGVRYWLTPPPTDYQK* |
| GOS2233_10598291 | 3300001969 | Marine | MKSYLSKSKDEYLVKDPNLNIHFKIINGVRYWLTPPPSGYQK* |
| JGI25127J35165_100132714 | 3300002482 | Marine | MKNYLSNSKQNEYLKLDPNXXIHFKIIDGVRYWLTPPPTGYLK* |
| JGI25127J35165_10159625 | 3300002482 | Marine | MKSYLSKPKDEYLVKDPNLNVHFKIINGVRYWLTPPPLDYKK* |
| JGI25127J35165_10219962 | 3300002482 | Marine | MKSYLSKPKDEYLVKDPNLNVHFKIINGVRYWLTPPPSNYKK* |
| JGI25127J35165_11271051 | 3300002482 | Marine | MKSYLSKPKNEYLVKDPNLNVHFKIINGVRYWLTPLPSGYQK* |
| JGI25132J35274_10805851 | 3300002483 | Marine | MKSYLSKSKPKKYLVKDPLLNIHFKIEDGVRYWLTPPPSDYKK* |
| JGI25128J35275_10371953 | 3300002488 | Marine | MKNYLSRSKDGYLIKDPNLNIHFKIINGVRYWLTPPPSSYKK* |
| Ga0068511_10510863 | 3300005057 | Marine Water | MKNYLSNSKQNEYLKLDPNLKIHFKIINGVRYWLTPPPLDYQK* |
| Ga0068511_10636722 | 3300005057 | Marine Water | MKSYLSKPKNEYLVKDPNLNIHFKIINGVRYWLTPPPSDYKK* |
| Ga0066840_100871122 | 3300005608 | Marine | MKNYLSNSKQNEYLKLDPNLKIHFKIINGVRYWLTPPPSDYKK* |
| Ga0078893_135868984 | 3300005837 | Marine Surface Water | MNYLSKNKQKEYLILDPNLNIHFKIINGVRFWLAPPPTGYQK* |
| Ga0075462_101762873 | 3300006027 | Aqueous | MKSYLSKPKDEYLVKDPNLNIHFKIINGVRYWLTPPPSDYKK* |
| Ga0068468_10241775 | 3300006305 | Marine | QMNYLSKNKQKEYLILDPNLNIHFKIINGVRFWLAPPPTGYQK* |
| Ga0098038_11803903 | 3300006735 | Marine | MKNYLSRSKDEYLIKDPNLNIHFKIINGVRYWLTPPPSSYKK* |
| Ga0098037_11256364 | 3300006737 | Marine | MNYLSRHTRSNKYLVKDPNLNIHFQIINGVRFWLTPP |
| Ga0098042_10026557 | 3300006749 | Marine | MKNCPSKCKDEYLVKDPNLNIHFKIINGVRYWLTPPPASYGK* |
| Ga0098042_11392883 | 3300006749 | Marine | MKNYLSNSKQNEYLKLDPNLNIHFKIINGVRYWLTPPPPDYEK* |
| Ga0070746_100765934 | 3300006919 | Aqueous | MKNFPSEPKNEYLVKDPNLNIHFKIINGVRYWLTPPPSDYKK* |
| Ga0070746_100854884 | 3300006919 | Aqueous | MKNYLSNSKQNEYLKLDPNLKIHFKIINGVRYWLTPPPTGYQK* |
| Ga0101666_10106994 | 3300007113 | Volcanic Co2 Seep Seawater | MKSYLSKRKDEYLVKDPNLNIHFKIINGVRYWLTPPPLDYQK* |
| Ga0101668_10086292 | 3300007114 | Volcanic Co2 Seep Seawater | MKSYLSKRKDEYLVKDPNLNIHFKIINGVRYWLTPPPSDYKK* |
| Ga0115012_120112072 | 3300009790 | Marine | MKNFPSKCKDEYLVKDPNLNIHFKIINGVRYWLTPPPAGYEK* |
| Ga0160422_100236565 | 3300012919 | Seawater | MKTYLSEPKDEYLVKDPNLNIHFKIINGVRYWLTPPPSDYKK* |
| Ga0160422_100509474 | 3300012919 | Seawater | MNYLSKFKIEYLVKDPNLNIHFKIINGVRYWLTPPPSGYQK* |
| Ga0160422_101167593 | 3300012919 | Seawater | MNYLSKSKDEYLVKDPNLNIYFKIINGVRYWLTPPPSDYQK* |
| Ga0160422_103257313 | 3300012919 | Seawater | MKSYLSKPKDEYIVKDPNLNIHFKIINGVRYWLTPPPLDYKK* |
| Ga0160422_108219042 | 3300012919 | Seawater | MKNYLSKPKDEYLVKDPNLNIHFKIINGVRYWLTPPPSDYQK* |
| Ga0160422_108782662 | 3300012919 | Seawater | MNYLSKTKHEYLVKDPNLNIHFKIINGVRYWLTPP |
| Ga0160423_100590534 | 3300012920 | Surface Seawater | MKNYLSNTKQNQYLKLDPNLNIHFKIINGVRYWLTPPPSTYEK* |
| Ga0160423_100782023 | 3300012920 | Surface Seawater | MKSYLSKPKDEYLVKDPNLNVHFKIINGVRYWLTPPPSGYQK* |
| Ga0160423_100842353 | 3300012920 | Surface Seawater | MKSYLSKSKNQYLVKDPNLNIHFKIINGVRYWLTPPPSGYQK* |
| Ga0160423_102215963 | 3300012920 | Surface Seawater | MKNFPSKTKDEYIVKDPNLNIHFKIINGVRYWLTPPPSDYQR* |
| Ga0160423_103285623 | 3300012920 | Surface Seawater | MKNFPSKTKDEYLVKDPNLNIHFKIINGVRYWLTPPPLDYKK* |
| Ga0160423_103689233 | 3300012920 | Surface Seawater | MKNFPSKTKDEYIVKDPNLNIHFKIINGVRYWLTPPPSDYKK* |
| Ga0160423_104681972 | 3300012920 | Surface Seawater | MKSYLSKPKDEYLVKDPNLNIHFKIINGVRYWLTPPPLDYKK* |
| Ga0160423_105721713 | 3300012920 | Surface Seawater | MNYLSKSKDEYLVKDPNLNIHFKIINGVRYWLAPPPSTYEK* |
| Ga0160423_106003592 | 3300012920 | Surface Seawater | MKSYPSNHKQNEYLILDPNLNIHFKIVNGVRYWLAPPPSGYQK* |
| Ga0163180_1000178113 | 3300012952 | Seawater | MNYLSKRKDEYLIRDPNLNIHFKIKNGVRYWLTPPPSGYQK* |
| Ga0163179_105404804 | 3300012953 | Seawater | MKNYLSKSKNEYLIKDPNLNIHFKIINGVRYWLTPPPSSYKE* |
| Ga0163111_107958971 | 3300012954 | Surface Seawater | PSKTKDEYLVKDPNLNIHFKIINGVRYWLTPPPSDYQR* |
| Ga0181403_10847501 | 3300017710 | Seawater | MTCLSKNKDEYLVKDPNLNVHFKIINGVRYWLTPPPS |
| Ga0181383_10675314 | 3300017720 | Seawater | MTCLSKDKDEYLVKDPNLNIHFKIINGVRYWLTPPPSSYKK |
| Ga0181416_10912742 | 3300017731 | Seawater | MTCLSKDKDEYLVKDPNLNVHFKIINGVRYWLTPPPPGYKK |
| Ga0181426_10281304 | 3300017733 | Seawater | MTCLSKNKDEYLVKDPNLNVHFKIINGVRYWLTPPPSSYKK |
| Ga0187222_100076019 | 3300017734 | Seawater | MTCLSKDKDEYLVKDPNLNVHFKIINGVRYWLTPPPSSYKQ |
| Ga0181427_10502984 | 3300017745 | Seawater | MTCLSKDKDEYLVKDPNLNVHFKIINGVRYWLTPPPSDYK |
| Ga0181382_11573121 | 3300017756 | Seawater | DKDEYLVKDPNLNVHFKIINGVRYWLTPPPSSYKQ |
| Ga0181409_11552303 | 3300017758 | Seawater | MKNYLSRSKDEYLIKDPNLNIHFKIINGVRYWLTTP |
| Ga0181414_10931162 | 3300017759 | Seawater | MTGLSKDKDEYLVKDPNLNVHFKIINGVRYWLTPPPPGYKK |
| Ga0211701_10001286 | 3300020242 | Marine | MNYLSKNKQKEYLILDPNLNIHFKIINGVRFWLAPPPTGYQK |
| Ga0211584_100043110 | 3300020248 | Marine | MNQMKFLSKPKDEYLVKDPNLNIHFKIINGVRYWLTPPPSDYKK |
| Ga0211700_10122031 | 3300020251 | Marine | MKSYLSKPKDEYLVKDPNLNIHFKIINGVRYWLTPPPSGYQK |
| Ga0211703_101564861 | 3300020367 | Marine | MKFLSKPKDEYLVKDPNLNIHFKIINGVRYWLTPPPL |
| Ga0211498_100098148 | 3300020380 | Marine | MKSYLFKPKDEYLVKDPNLNIHFKIINGVRYWLTPPPSDYKK |
| Ga0211618_100283895 | 3300020393 | Marine | MNYPSKRKDEYLIRDPNLNIHFKIINGVRYWLTPPPSGYQK |
| Ga0211532_100436203 | 3300020403 | Marine | MNYLSKSKQKEYLILDPNLNIHFKIINGVRFWLTPPPTGYQK |
| Ga0211496_101208424 | 3300020405 | Marine | YLSKPKDEYLVKDPNLNVHFKIINGVRYWLTPPPSGYQK |
| Ga0211668_1000916614 | 3300020406 | Marine | MNYLSKTKDEYLIRDPNLNIHFKIKNGVRYWLTPPPSSYRK |
| Ga0211699_102359572 | 3300020410 | Marine | MKSYLFKPKDEYLVKDPNLNVHFKIINGVRYWLTPPPSGYQK |
| Ga0211699_103488151 | 3300020410 | Marine | MKSYLSKPKDEYLVKDPNLNIHFKIINGVRYWLTPPPLNYKK |
| Ga0211587_104669423 | 3300020411 | Marine | MHQQQMNYPSKRKDEYLIRDPNLNIHFKIINGVRYWLTPPPSGYQK |
| Ga0211528_100232441 | 3300020417 | Marine | MKIYPSKSKQNEYLKLDPNLKIHFKIINGVRYWLTPPP |
| Ga0211580_100059503 | 3300020420 | Marine | MNYLSKSKQKEYLILDPNLNIHFKIINGVRFWLAPPPTGYQK |
| Ga0211580_101704533 | 3300020420 | Marine | MKSYLSKPKAEYLVKDPNLNIHFKIINGVRYWLTPPPSGYQK |
| Ga0211580_102834041 | 3300020420 | Marine | MKSCLSKPKDEYLVKDPNLNIHFKIINGVRYWLTPPPSNYKK |
| Ga0211565_100098206 | 3300020433 | Marine | MKNYLSKPKDEYLVKDPNLNIHFKIINGVRYWLTPPPSDYQK |
| Ga0211708_100025409 | 3300020436 | Marine | MKNFPSKCKDEYLVKDPNLNIHFKIVNGVRYWLTPPPSDYKK |
| Ga0211708_100853265 | 3300020436 | Marine | MKSYLSKPKDEYLVKDPNLNVHFKIINGVRYWLTPLPSGYQK |
| Ga0211708_101047463 | 3300020436 | Marine | MKNYLSKSKDEYLVKDPNLNIHFKIINGVRYWLTPPPSGYQK |
| Ga0211708_104415762 | 3300020436 | Marine | MKFLSKPKDEYLVKDPNLNIHFKIINGVRYWLTPPPSNYQK |
| Ga0211576_100785166 | 3300020438 | Marine | MTCLSKNKDEYLVKDPNLNVHFKIINGVRYWLTPPPSGYKQ |
| Ga0211638_103007882 | 3300020448 | Marine | MKFLSKHKDEYLVKDPNLNIHFRIINGVRYWLTPPPLNYKK |
| Ga0211535_103800593 | 3300020461 | Marine | MNFPSKRKDEYLIRDPNLNIHFKIINGVRYWLTPPPSGY |
| Ga0211543_1000220825 | 3300020470 | Marine | MKISRSRLKDEYLVKDPNLNIHFKIINGVRYWLTPPPLGYKK |
| Ga0211614_1000288518 | 3300020471 | Marine | MNYLFKSKQKEYLILDPNLNIHFKIINGVRFWLAPPPTGYQK |
| Ga0224902_1001428 | 3300022066 | Seawater | MTCLSKDKDEYLVKDPNLNVHFKIINGVRYWLTPPPSSYKK |
| Ga0224906_10589351 | 3300022074 | Seawater | MKNYLSRSKDEYFIKDPNLNIHFKIINGVRYWLTP |
| Ga0208157_10545234 | 3300025086 | Marine | MKNYLSRSKDEYLIKDPNLNIHFKIINGVRYWLTPPPSSYK |
| Ga0208159_100264015 | 3300025101 | Marine | MKNCPSKCKDEYLVKDPNLNIHFKIINGVRYWLTPPPASYGK |
| Ga0208159_10139943 | 3300025101 | Marine | MKNYLSNSKQNEYLKLDPNLNIHFKIINGVRYWLTPPPPDYEK |
| Ga0209348_100548310 | 3300025127 | Marine | MKSYLSKTKDEYLVKDPNLNIHFKIINGVRYWLTPPPSDYKK |
| Ga0209348_10056316 | 3300025127 | Marine | MKSYLSKPKDEYLVKDPNLNVHFKIINGVRYWLTPPPSNYKK |
| Ga0209348_10061638 | 3300025127 | Marine | MKSYLSKPKDEYLVKDPNLNVHFKIINGVRYWLTPPPLDYKK |
| Ga0209348_10260193 | 3300025127 | Marine | MKNYLSNSKQNEYLKLDPNLKIHFKIIDGVRYWLTPPPTGYLK |
| Ga0209348_10509914 | 3300025127 | Marine | MKSYLSKSKDEYLVKDPNLNIHFKIINGVRYWLTPPPSGYQK |
| Ga0209348_10892994 | 3300025127 | Marine | MKSYLSKPKNEYLVKDPNLNVHFKIINGVRYWLTPLPSGYQK |
| Ga0209232_10074089 | 3300025132 | Marine | MKSCLSKPKDGYLVKDPNLNIHFKIINGVRYWLTPPPLDYKK |
| Ga0209232_10466114 | 3300025132 | Marine | MKSYLSKPKDEYLVKDPNLNIHFKIINGVRYWLTPPPLDYKK |
| Ga0209232_12074402 | 3300025132 | Marine | MTCLSKDKDEYLVKDPNLNVHFKIINGVRYWLTPPPSGYKQ |
| Ga0209645_100737310 | 3300025151 | Marine | MKSFPSKCKDEYLVKDPNLNIHFKIINGVRYWLTPPPLDYKK |
| Ga0209645_10648992 | 3300025151 | Marine | MKSYLSKSKPKKYLVKDPLLNIHFKIEDGVRYWLTPPPSDYKK |
| Ga0185543_11161701 | 3300029318 | Marine | MKSYLSKRKDEYLVKDPNLNIHFKIINGVRYWLTPPP |
| Ga0183748_100099813 | 3300029319 | Marine | MKSYRSKSKSKYLVKDPNLNIHFEIINGVRYWLTPPPSGYQK |
| Ga0183748_10142926 | 3300029319 | Marine | MKSYLFKAKDGYLVKDPNLNVHFKIINGVRYWLTPLPSGYQK |
| Ga0183748_10739854 | 3300029319 | Marine | KPKDEYLVKDPNLNIHFKIINGVRYWLTPPPSDYKK |
| Ga0183826_10036393 | 3300029792 | Marine | MKFLSKPKDEYLVKDPNLNVHFKIINGVRYWLTPPPLDYKK |
| Ga0183826_10046347 | 3300029792 | Marine | MKSYLSKPKDEYLVKDPNLNIHFKIINGVRYWLTPPPSEYKK |
| Ga0183826_10242952 | 3300029792 | Marine | MKFLSKPKDEYLVKDPNLNIHFKIINGVRYWLTPPPSDYKK |
| Ga0183826_10318082 | 3300029792 | Marine | MKSYLSKSKDEYLVKDPNLNVHFKIINGVRYWLTPPPSGYQK |
| Ga0183826_10549672 | 3300029792 | Marine | MNYLSKRKDEYLVKDPNLNIHFKIINGVRYWLTPPPSGYQK |
| Ga0310343_1000009334 | 3300031785 | Seawater | MKNYLSKSKDEYLVKDPNLNIHFKIINGVRYWLTPPPSNYQK |
| Ga0310343_101688336 | 3300031785 | Seawater | MKFPSKPKDEYLVKDPNLNIHFKIINGVRYWLTPPPLNYKK |
| Ga0315315_115220493 | 3300032073 | Seawater | MYQQQMNYLFKRKDEYLIRDPNLNIHFKIKNGVRYWLTPPPSGYQK |
| ⦗Top⦘ |