


| Basic Information | |
|---|---|
| Family ID | F084313 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 112 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MTPETRPQAPTAGFQTLWVQRQLKKLKERTEALKAQYIKPTDIL |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 112 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 54.46 % |
| % of genes near scaffold ends (potentially truncated) | 42.86 % |
| % of genes from short scaffolds (< 2000 bps) | 91.07 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Predicted Viral (31.250 % of family members) |
| NCBI Taxonomy ID | 10239 (predicted) |
| Taxonomy | All Organisms → Viruses → Predicted Viral |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater (25.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (68.750 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (80.357 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.27% β-sheet: 0.00% Coil/Unstructured: 47.73% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 112 Family Scaffolds |
|---|---|---|
| PF14700 | RPOL_N | 11.61 |
| PF13619 | KTSC | 3.57 |
| PF00805 | Pentapeptide | 0.89 |
| PF05367 | Phage_endo_I | 0.89 |
| COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
|---|---|---|---|
| COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 0.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.21 % |
| Unclassified | root | N/A | 26.79 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000116|DelMOSpr2010_c10195072 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 653 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10226348 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 583 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10246309 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED88 | 525 | Open in IMG/M |
| 3300000265|LP_A_09_P04_10DRAFT_1022048 | Not Available | 1158 | Open in IMG/M |
| 3300001450|JGI24006J15134_10171524 | Not Available | 689 | Open in IMG/M |
| 3300001939|GOS2225_1031433 | Not Available | 995 | Open in IMG/M |
| 3300001940|GOS2222_1006306 | All Organisms → Viruses → Predicted Viral | 1807 | Open in IMG/M |
| 3300001947|GOS2218_1027758 | All Organisms → Viruses → Predicted Viral | 1770 | Open in IMG/M |
| 3300004097|Ga0055584_100950630 | Not Available | 899 | Open in IMG/M |
| 3300004460|Ga0066222_1008463 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300004951|Ga0068513_1034318 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 555 | Open in IMG/M |
| 3300005731|Ga0076919_1045586 | Not Available | 583 | Open in IMG/M |
| 3300005733|Ga0076921_139122 | Not Available | 729 | Open in IMG/M |
| 3300005738|Ga0076926_100728 | Not Available | 941 | Open in IMG/M |
| 3300005942|Ga0070742_10206730 | All Organisms → Viruses | 549 | Open in IMG/M |
| 3300006025|Ga0075474_10180237 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pekhitvirus → Pekhitvirus S04C24 | 654 | Open in IMG/M |
| 3300006026|Ga0075478_10207181 | Not Available | 597 | Open in IMG/M |
| 3300006356|Ga0075487_1519599 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 646 | Open in IMG/M |
| 3300006484|Ga0070744_10086483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 908 | Open in IMG/M |
| 3300006484|Ga0070744_10087876 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 900 | Open in IMG/M |
| 3300006752|Ga0098048_1022594 | All Organisms → Viruses → Predicted Viral | 2099 | Open in IMG/M |
| 3300006752|Ga0098048_1194984 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pekhitvirus → Pekhitvirus S04C24 | 598 | Open in IMG/M |
| 3300006789|Ga0098054_1053726 | All Organisms → Viruses → Predicted Viral | 1539 | Open in IMG/M |
| 3300006810|Ga0070754_10321079 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 690 | Open in IMG/M |
| 3300006919|Ga0070746_10197533 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 959 | Open in IMG/M |
| 3300006920|Ga0070748_1332134 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 538 | Open in IMG/M |
| 3300006922|Ga0098045_1022993 | All Organisms → Viruses → Predicted Viral | 1650 | Open in IMG/M |
| 3300006924|Ga0098051_1109440 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 739 | Open in IMG/M |
| 3300007542|Ga0099846_1185611 | Not Available | 738 | Open in IMG/M |
| 3300007543|Ga0102853_1015551 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pekhitvirus → Pekhitvirus S04C24 | 1224 | Open in IMG/M |
| 3300007862|Ga0105737_1015577 | All Organisms → Viruses → Predicted Viral | 1725 | Open in IMG/M |
| 3300007862|Ga0105737_1020510 | All Organisms → Viruses → Predicted Viral | 1523 | Open in IMG/M |
| 3300007863|Ga0105744_1146810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 588 | Open in IMG/M |
| 3300007956|Ga0105741_1034396 | All Organisms → Viruses → Predicted Viral | 1259 | Open in IMG/M |
| 3300007972|Ga0105745_1099186 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 855 | Open in IMG/M |
| 3300007974|Ga0105747_1272221 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pekhitvirus → Pekhitvirus S04C24 | 570 | Open in IMG/M |
| 3300008012|Ga0075480_10350507 | Not Available | 737 | Open in IMG/M |
| 3300009056|Ga0102860_1068412 | Not Available | 968 | Open in IMG/M |
| 3300009508|Ga0115567_10870001 | Not Available | 535 | Open in IMG/M |
| 3300010150|Ga0098056_1037621 | All Organisms → Viruses → Predicted Viral | 1691 | Open in IMG/M |
| 3300010150|Ga0098056_1192467 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED88 | 682 | Open in IMG/M |
| 3300010150|Ga0098056_1288969 | Not Available | 541 | Open in IMG/M |
| 3300010296|Ga0129348_1153148 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300010392|Ga0118731_104105382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 521 | Open in IMG/M |
| 3300010430|Ga0118733_103825958 | Not Available | 811 | Open in IMG/M |
| 3300010430|Ga0118733_108833548 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Synechococcus phage S-CBM2 | 520 | Open in IMG/M |
| 3300011118|Ga0114922_10720281 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pekhitvirus → Pekhitvirus S04C24 | 817 | Open in IMG/M |
| 3300017708|Ga0181369_1017856 | All Organisms → Viruses → Predicted Viral | 1749 | Open in IMG/M |
| 3300017709|Ga0181387_1015917 | All Organisms → Viruses → Predicted Viral | 1453 | Open in IMG/M |
| 3300017713|Ga0181391_1057880 | Not Available | 906 | Open in IMG/M |
| 3300017714|Ga0181412_1028435 | All Organisms → Viruses → Predicted Viral | 1516 | Open in IMG/M |
| 3300017714|Ga0181412_1039580 | Not Available | 1233 | Open in IMG/M |
| 3300017714|Ga0181412_1060203 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED88 | 944 | Open in IMG/M |
| 3300017719|Ga0181390_1009047 | All Organisms → Viruses → Predicted Viral | 3567 | Open in IMG/M |
| 3300017719|Ga0181390_1048762 | All Organisms → Viruses → Predicted Viral | 1250 | Open in IMG/M |
| 3300017720|Ga0181383_1097373 | Not Available | 790 | Open in IMG/M |
| 3300017725|Ga0181398_1032286 | Not Available | 1286 | Open in IMG/M |
| 3300017727|Ga0181401_1084926 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pekhitvirus → Pekhitvirus S04C24 | 819 | Open in IMG/M |
| 3300017730|Ga0181417_1048870 | All Organisms → Viruses → Predicted Viral | 1035 | Open in IMG/M |
| 3300017738|Ga0181428_1000766 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 7544 | Open in IMG/M |
| 3300017742|Ga0181399_1046576 | All Organisms → Viruses → Predicted Viral | 1140 | Open in IMG/M |
| 3300017742|Ga0181399_1090365 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 764 | Open in IMG/M |
| 3300017746|Ga0181389_1088796 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED88 | 861 | Open in IMG/M |
| 3300017749|Ga0181392_1133883 | Not Available | 730 | Open in IMG/M |
| 3300017752|Ga0181400_1218488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 521 | Open in IMG/M |
| 3300017757|Ga0181420_1085789 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED88 | 978 | Open in IMG/M |
| 3300017768|Ga0187220_1091907 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pekhitvirus → Pekhitvirus S04C24 | 916 | Open in IMG/M |
| 3300017768|Ga0187220_1105741 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 851 | Open in IMG/M |
| 3300017770|Ga0187217_1007179 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Kajamvirus → Synechococcus virus SRIP1 → Synechococcus phage S-RIP1 | 4185 | Open in IMG/M |
| 3300017770|Ga0187217_1175936 | Not Available | 711 | Open in IMG/M |
| 3300017779|Ga0181395_1150361 | Not Available | 734 | Open in IMG/M |
| 3300019751|Ga0194029_1085361 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 546 | Open in IMG/M |
| 3300020347|Ga0211504_1019796 | All Organisms → Viruses → Predicted Viral | 1817 | Open in IMG/M |
| 3300020428|Ga0211521_10052509 | All Organisms → Viruses → Predicted Viral | 2099 | Open in IMG/M |
| 3300020431|Ga0211554_10074729 | All Organisms → Viruses → Predicted Viral | 1780 | Open in IMG/M |
| 3300021371|Ga0213863_10005397 | Not Available | 8447 | Open in IMG/M |
| 3300021958|Ga0222718_10020066 | All Organisms → Viruses → Predicted Viral | 4665 | Open in IMG/M |
| 3300021958|Ga0222718_10540590 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 556 | Open in IMG/M |
| 3300021964|Ga0222719_10270329 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Kajamvirus → Synechococcus virus SRIP1 → Synechococcus phage S-RIP1 | 1118 | Open in IMG/M |
| 3300022050|Ga0196883_1036951 | Not Available | 594 | Open in IMG/M |
| 3300022065|Ga0212024_1000767 | All Organisms → Viruses → Predicted Viral | 2870 | Open in IMG/M |
| 3300022067|Ga0196895_1006719 | All Organisms → Viruses → Predicted Viral | 1218 | Open in IMG/M |
| 3300022149|Ga0196907_100031 | All Organisms → Viruses | 5613 | Open in IMG/M |
| 3300022187|Ga0196899_1040518 | All Organisms → Viruses → Predicted Viral | 1579 | Open in IMG/M |
| (restricted) 3300023210|Ga0233412_10038759 | All Organisms → Viruses → Predicted Viral | 1923 | Open in IMG/M |
| (restricted) 3300023210|Ga0233412_10054854 | All Organisms → Viruses → Predicted Viral | 1627 | Open in IMG/M |
| (restricted) 3300024059|Ga0255040_10077782 | Not Available | 1264 | Open in IMG/M |
| (restricted) 3300024062|Ga0255039_10114644 | All Organisms → Viruses → Predicted Viral | 1084 | Open in IMG/M |
| (restricted) 3300024340|Ga0255042_10248146 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 571 | Open in IMG/M |
| (restricted) 3300024519|Ga0255046_10069245 | Not Available | 1434 | Open in IMG/M |
| (restricted) 3300024519|Ga0255046_10418685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 637 | Open in IMG/M |
| 3300025070|Ga0208667_1012989 | All Organisms → Viruses → Predicted Viral | 1822 | Open in IMG/M |
| 3300025084|Ga0208298_1004001 | All Organisms → Viruses → Predicted Viral | 4421 | Open in IMG/M |
| 3300025084|Ga0208298_1034233 | All Organisms → Viruses → Predicted Viral | 1050 | Open in IMG/M |
| 3300025120|Ga0209535_1076080 | All Organisms → Viruses → Predicted Viral | 1294 | Open in IMG/M |
| 3300025120|Ga0209535_1095934 | Not Available | 1076 | Open in IMG/M |
| 3300025168|Ga0209337_1115596 | All Organisms → Viruses → Predicted Viral | 1220 | Open in IMG/M |
| 3300025168|Ga0209337_1162733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium | 951 | Open in IMG/M |
| 3300025647|Ga0208160_1040867 | All Organisms → Viruses → Predicted Viral | 1360 | Open in IMG/M |
| 3300025889|Ga0208644_1159276 | All Organisms → Viruses → Predicted Viral | 1025 | Open in IMG/M |
| 3300027206|Ga0208023_1048818 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pekhitvirus → Pekhitvirus S04C24 | 700 | Open in IMG/M |
| 3300027320|Ga0208923_1050649 | Not Available | 738 | Open in IMG/M |
| (restricted) 3300028045|Ga0233414_10496916 | Not Available | 574 | Open in IMG/M |
| 3300031519|Ga0307488_10488590 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pekhitvirus → Pekhitvirus S04C24 | 738 | Open in IMG/M |
| 3300031519|Ga0307488_10723171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 560 | Open in IMG/M |
| 3300031539|Ga0307380_10552244 | All Organisms → Viruses → Predicted Viral | 1001 | Open in IMG/M |
| 3300031566|Ga0307378_10887808 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED88 | 739 | Open in IMG/M |
| 3300031566|Ga0307378_10981798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 690 | Open in IMG/M |
| 3300031569|Ga0307489_10776837 | Not Available | 673 | Open in IMG/M |
| 3300031578|Ga0307376_10237022 | All Organisms → Viruses → Predicted Viral | 1234 | Open in IMG/M |
| 3300031578|Ga0307376_10831213 | Not Available | 568 | Open in IMG/M |
| 3300031669|Ga0307375_10547809 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED88 | 689 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 25.00% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 15.18% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 13.39% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 5.36% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 5.36% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.57% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 2.68% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 2.68% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 2.68% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.68% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.68% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.68% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 2.68% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 1.79% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.79% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.89% |
| Marine Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water | 0.89% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.89% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.89% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.89% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.89% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.89% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.89% |
| M | Environmental → Aquatic → Marine → Unclassified → Unclassified → M | 0.89% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.89% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000265 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_A_09_P04_10 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001939 | Marine microbial communities from Block Island, New York, USA - GS009 | Environmental | Open in IMG/M |
| 3300001940 | Marine microbial communities from Bay of Fundy, Nova Scotia, Canada - GS006 | Environmental | Open in IMG/M |
| 3300001947 | Marine microbial communities from the Gulf of Maine, Canada - GS002 | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300004460 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004951 | Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-EVs | Environmental | Open in IMG/M |
| 3300005731 | Seawater microbial communities from Vineyard Sound, MA, USA - succinate ammended T14 | Environmental | Open in IMG/M |
| 3300005733 | Seawater microbial communities from Vineyard Sound, MA, USA - crude oil ammended T14 | Environmental | Open in IMG/M |
| 3300005738 | Seawater microbial communities from Vineyard Sound, MA, USA - sterilised with crude oil T0 | Environmental | Open in IMG/M |
| 3300005942 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757 | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006356 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007543 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-3 | Environmental | Open in IMG/M |
| 3300007862 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_0.2um | Environmental | Open in IMG/M |
| 3300007863 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459B_0.2um | Environmental | Open in IMG/M |
| 3300007956 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459A_0.2um | Environmental | Open in IMG/M |
| 3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009056 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 | Environmental | Open in IMG/M |
| 3300009508 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300011118 | Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017725 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29 | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017730 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13 | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017742 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
| 3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300019751 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MG | Environmental | Open in IMG/M |
| 3300020347 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994) | Environmental | Open in IMG/M |
| 3300020428 | Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556032-ERR599094) | Environmental | Open in IMG/M |
| 3300020431 | Marine microbial communities from Tara Oceans - TARA_B100001142 (ERX556101-ERR598983) | Environmental | Open in IMG/M |
| 3300021371 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497 | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022050 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v3) | Environmental | Open in IMG/M |
| 3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
| 3300022067 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v3) | Environmental | Open in IMG/M |
| 3300022149 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
| 3300024059 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2 | Environmental | Open in IMG/M |
| 3300024062 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1 | Environmental | Open in IMG/M |
| 3300024340 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_5 | Environmental | Open in IMG/M |
| 3300024519 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27 | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300027206 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027320 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 (SPAdes) | Environmental | Open in IMG/M |
| 3300028045 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_10_MG | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
| 3300031569 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSpr2010_101950724 | 3300000116 | Marine | MTPETRPQAPTAGFQTLWVQRQLKKLRERTEALKAQYIKPTDIL* |
| DelMOSpr2010_102263482 | 3300000116 | Marine | MTPETRPEAPTASFQTLWVQRQLKKLKERTEALKAQYIKPNDII* |
| DelMOWin2010_102463091 | 3300000117 | Marine | IVSPHVTMPNETRPSVRPTDAPQAPTAGFQTLWVQRQLKKLKERTEALKAQYIKPDDII* |
| LP_A_09_P04_10DRAFT_10220485 | 3300000265 | Marine | MTPETRPHAPTAGFQTLWVQRQLKKLKDRTEALKAQYIKPNDII* |
| JGI24006J15134_101715244 | 3300001450 | Marine | SQAPTAGFQTVWVQRQLTKLKKRAEALKAQYIKPTEIL* |
| GOS2225_10314333 | 3300001939 | Marine | MTPETRPQAPTAGFQTLWVQRQLKKLKERTEALKAQYIKPDDII* |
| GOS2222_10063064 | 3300001940 | Marine | MTPETRPSVRPTDAPQAPTAGFQTLWVQRQLKKLKERTEALKAQYIKPTD |
| GOS2218_10277584 | 3300001947 | Marine | LPRQQYINVLIVSPHATMPNETRPQAPTAGFQTLWVQRQLKKLKERTEALKAQYIKPDDII* |
| Ga0055584_1009506304 | 3300004097 | Pelagic Marine | MTPETRPHAPTAGFQTLWVQRQLKKLKERTEALKAQHIKPTDIL* |
| Ga0066222_10084631 | 3300004460 | Marine | MTPETRPSVRPTDAPQAPTAGFQTLWVQRQLKKLKERTEALKAQYIKPDDII* |
| Ga0068513_10343181 | 3300004951 | Marine Water | MTPETRPHAPTAGFQTLWVQRQLKKLKERTEALKAQYIKPDEII* |
| Ga0076919_10455863 | 3300005731 | M | ETRPQAPTAGFQTLWVQRQLKKLKERTEALKAQYIKPTDIL* |
| Ga0076921_1391221 | 3300005733 | Marine | MPNETRPQAPTAGFQTLWVQRQLKKLKERTEALKAQYIKPTDIL* |
| Ga0076926_1007282 | 3300005738 | Marine | MTPETRPQAPTAGFQTLWVQRQLKKLKERTEALKAQYIKPTDIL* |
| Ga0070742_102067302 | 3300005942 | Estuarine | PTAGFQTLWVQRQLKKLKERTEALKAQYIKPDDII* |
| Ga0075474_101802372 | 3300006025 | Aqueous | MTPETRPHAPTAGFQTLWVQRQLKKLKERTEALKAQYIKPNEII* |
| Ga0075478_102071813 | 3300006026 | Aqueous | MTPETRPEAPTASFQTLWVQRQLKKLRERTEALKAQYIKPDDII* |
| Ga0075487_15195993 | 3300006356 | Aqueous | MTPETRPSVRPTDAPQAPTAGFQTLWVQRQLKKLRERTEALKAQYIK |
| Ga0070744_100864833 | 3300006484 | Estuarine | MTPETRPHAPTAGFQTLWVQRQLTKLKKRAEALKAQYIKPTEIL* |
| Ga0070744_100878762 | 3300006484 | Estuarine | MTPETRPQAPTAGFQTLWVQRQLTKLKKRAEALKAQYIKPTEIL* |
| Ga0098048_10225944 | 3300006752 | Marine | MTPETRPQAPTAGFQTLWVQRQLKKLKERAEALKAQYIKPTDIL* |
| Ga0098048_11949843 | 3300006752 | Marine | MTPETRPSVRPTDAPQAPTAGFQTLWVQRQLKKLKERTEALKAQYIKPTDIL* |
| Ga0098054_10537263 | 3300006789 | Marine | MTPETRPHAPTAGFQTLWVQRQLKKLKERTEALKAQYIKPNDIL* |
| Ga0070754_103210791 | 3300006810 | Aqueous | MTPETRPHAPTAGFQTLWVQRQLKKLKERTEALKAQYIKPTDIL* |
| Ga0070746_101975334 | 3300006919 | Aqueous | MTPETRPHAPTAGFQTLWVQRQLKKLRERTEALKAQYIKPTDIL* |
| Ga0070748_13321342 | 3300006920 | Aqueous | MTPETRPHAPTAGFQTLWVQRQLKKLRERAEALKAQYIKPDDII* |
| Ga0098045_10229934 | 3300006922 | Marine | PTAGFQTLWVQRQLKKLKERAEALKAQYIKPTDIL* |
| Ga0098051_11094404 | 3300006924 | Marine | ETRPHAPTAGFQTLWVQRQLKKLKERTEALKAQYIKPNDIL* |
| Ga0099846_11856114 | 3300007542 | Aqueous | RSEPSPQAPTAGFQTLWVQRQIKKLRERTEALKAQYIKPDDII* |
| Ga0102853_10155512 | 3300007543 | Estuarine | MTPETRPHAPTAGFQTLWVQRQLKKLKDRAEALKAQYIKPTDIL* |
| Ga0105737_10155777 | 3300007862 | Estuary Water | MTPETRPHAPTAGFQTLWVQRQLKKLKDRTEALKAQYIKPTDIL* |
| Ga0105737_10205104 | 3300007862 | Estuary Water | MTPETRPQAPTAGFQTLWVQRQLKKLKERTEALKAQFIKPTDII* |
| Ga0105744_11468103 | 3300007863 | Estuary Water | LSSYHQMTPETRPQAPTAGFQTLWVQRQLKKLKERTEALKAQFIKPNDII* |
| Ga0105741_10343963 | 3300007956 | Estuary Water | MTPETRPQAPTAGFQTLWVQRQLKKLKERTEALKAQFIKPNDII* |
| Ga0105745_10991863 | 3300007972 | Estuary Water | MTPETRPHAPTAGFQTLWVQRQLKKLKDRAEALKAQYIKPDDII* |
| Ga0105747_12722212 | 3300007974 | Estuary Water | MTPETRPQAHTAGFQTLWVQRQLKKLKERTEALKAQFIKPNDII* |
| Ga0075480_103505073 | 3300008012 | Aqueous | IPQAPTAGFQTLWVQRQLKKLRERTEALKAQYIKPDDII* |
| Ga0102860_10684124 | 3300009056 | Estuarine | PTAGFQTLWVQRQLKKLRERTEALKAQYIKPNDII* |
| Ga0115567_108700013 | 3300009508 | Pelagic Marine | MTPETRPEAPTASFQTLWVQRQLKKLKERTEALKAQYI |
| Ga0098056_10376211 | 3300010150 | Marine | MTPETRPSVRPTDAPQAPTAGFQTLWVQRQLKKLKERTEAL |
| Ga0098056_11924671 | 3300010150 | Marine | MTPETRPQAPTAGFQTLWVQRQLKKLKERTEALKAQYIKPTD |
| Ga0098056_12889691 | 3300010150 | Marine | MTPETRPQAPTAGFQTLWVQRQLKKLKERAEALKAQYIKPTD |
| Ga0129348_11531483 | 3300010296 | Freshwater To Marine Saline Gradient | MTPETRPSVRPTDAPQAPTAGFQTLWVQRQLKKLRERTEALKAQYIKPDDII* |
| Ga0118731_1041053821 | 3300010392 | Marine | APQAPTAGFQTLWVQRQLKKLKERTEALKAQYIKPTDIL* |
| Ga0118733_1038259581 | 3300010430 | Marine Sediment | VPIVSPHVTMPNETRPQAPTAGFQTLWVQRQLKNLKERTEALKAQYIKPTDIL* |
| Ga0118733_1088335481 | 3300010430 | Marine Sediment | AQAPTAGFQTLWVQRQLKKLKERTEALKAQYIKPDDII* |
| Ga0114922_107202814 | 3300011118 | Deep Subsurface | EPTPQAPTAGFQTLWVQRQLKKLKERTEALKAQYIKPTDIL* |
| Ga0181369_10178566 | 3300017708 | Marine | MTPETRPSVRPTDAPQAPTAGFQTLWVQRQLKKLRERTEALKAQYIKPNDIL |
| Ga0181387_10159171 | 3300017709 | Seawater | MTPETRPQAPTAGFQTLWVQRQLKKLKERAEALKAQYIKPNDIL |
| Ga0181391_10578801 | 3300017713 | Seawater | PHVTMPNETRPQAPTAGFQTLWVQRQLKKLKERAEALKAQYIKPTDIL |
| Ga0181412_10284357 | 3300017714 | Seawater | MTPETRPSIRPTDAPQAPTAGFQTLWVQKQLKKLRERAEALKAQYIKPDDII |
| Ga0181412_10395802 | 3300017714 | Seawater | MPNETRPQAPTAGFQTLWVQRQLKKLKERAEALKAQYIKPTDIL |
| Ga0181412_10602034 | 3300017714 | Seawater | MAPETRPQAPTAGFQTLWVQKQLKKLKERAEALKAQYIKPDDII |
| Ga0181390_10090474 | 3300017719 | Seawater | MTPETRPQAPTAGFKTLWVKKQLKKLKERTEALKAQFIKPTDII |
| Ga0181390_10487622 | 3300017719 | Seawater | MPNETRPQAPTAGFQTLWVQKQLKKLKERAEALKAQYIKPDDII |
| Ga0181383_10973734 | 3300017720 | Seawater | PTAGFQTLWVQRQLKKLKERAEALKAQYIKPTDIL |
| Ga0181398_10322861 | 3300017725 | Seawater | MPNETRPHAPTAGFQTLWVQRQLKKLKERAEALKAQYIKPDDIL |
| Ga0181401_10849264 | 3300017727 | Seawater | ETRPQAPTAGFQTLWVQRQLKKLKERAEALKAQYIKPTDIL |
| Ga0181417_10488702 | 3300017730 | Seawater | MTPETPSQSPRAGFQTVWVQKQLKKLKAKAAALKAQFIKPNEII |
| Ga0181428_100076611 | 3300017738 | Seawater | MTPETRPHAPTAGFQTLWVQKQLKKLKERTEALKAQFIKPTDIL |
| Ga0181399_10465765 | 3300017742 | Seawater | MPNETRPHAPTAGFQTLWVQRQLKKLKERAEALKAQYIKPDDII |
| Ga0181399_10903652 | 3300017742 | Seawater | MTPETRQSVRPTDAPQAPTAGFQTLWVQRQLKKLRERAEALKAQYIKPDDII |
| Ga0181389_10887961 | 3300017746 | Seawater | INVLTVSPHATMPNETRPQAPTAGFQTLWVQKQLKKLKERAEALKAQYIKPDDII |
| Ga0181392_11338832 | 3300017749 | Seawater | MTPETRPQAPTAGFQTLWVQKQLKKLKERAEALKAQYIKPTDILXLPXETNQNV |
| Ga0181400_12184881 | 3300017752 | Seawater | QAPTAGFQTLWVQRQLKKLKERAEALKAQYIKPNDIL |
| Ga0181420_10857892 | 3300017757 | Seawater | MTPETRPHAPTAGFQTLWVQRQLKKLKERAEALKAQYIKPNDIL |
| Ga0187220_10919074 | 3300017768 | Seawater | PTAGFQTLWVQRQLKKLKERAEALKAQYIKPNDIL |
| Ga0187220_11057413 | 3300017768 | Seawater | MTPETRPQAPTAGFQTLWVQRQIKKLRERAEALKAQYIKPDDII |
| Ga0187217_10071795 | 3300017770 | Seawater | MPNETRPQAPTAGFQTLWVQRQLKKLKERAEALKAQYIKPNDIL |
| Ga0187217_11759362 | 3300017770 | Seawater | MTPETRPQAPTAGFQTLWVQKQLKKLKERAEALKAQYIKPTDILXLP |
| Ga0181395_11503614 | 3300017779 | Seawater | AYLPRQQCINVPIVSPHATMPNETRPHAPTAGFQTLWVQRQLKKLKERAEALKAQYIKPTDIL |
| Ga0194029_10853612 | 3300019751 | Freshwater | MTPETRPHAPTAGFQTLWVQRQLKKLKERTEALKAQYIKPDDIL |
| Ga0211504_10197963 | 3300020347 | Marine | MTPETRPSVRPTDAPQAPTAGFQTLWVQRQLKKLKERTEALKAQYIKPTDIL |
| Ga0211521_100525094 | 3300020428 | Marine | MTPETRPQAPTAGFQTLWVQRQLKKLKERTEALKAQFIKPTDII |
| Ga0211554_100747291 | 3300020431 | Marine | PETRPQAPTAGFQTLWVQRQLKKLRERTEALKAQYIKPTDIL |
| Ga0213863_100053978 | 3300021371 | Seawater | MTPETRPHAPTAGFQTLWVQRQLKKLKERTEALKAQYIKPNDIL |
| Ga0222718_100200666 | 3300021958 | Estuarine Water | MTPETHPHAPTAGFQTLWVQRQLKKLKERTEALKAQYIKPTDIL |
| Ga0222718_105405902 | 3300021958 | Estuarine Water | MTPETRPHAPTAGFQTLWVQRQLKKLRERTEALKAQYIKPDDII |
| Ga0222719_102703295 | 3300021964 | Estuarine Water | TFIKSYSMTPETRPSVRPTDAPQAPTAGFQTLWVQRQLKKLKERTEALKAQYIKPDDII |
| Ga0196883_10369511 | 3300022050 | Aqueous | KKSYSMTPETRPSVRPTDAPQAPTAGFQTLWVQRQLKKLRERTEALKAQYIKPDDII |
| Ga0212024_10007675 | 3300022065 | Aqueous | MTPETRPHAPTAGFQTLWVQRQLKKLKERTEALKAQYIKPNEII |
| Ga0196895_10067192 | 3300022067 | Aqueous | MTPETRPHAPTAGFQTLWVQRQLKKLKERTEALKAQYIKPDEII |
| Ga0196907_10003111 | 3300022149 | Aqueous | PSPQAPTAGFQTLWVQRQLKKLRERTEALKAQYIKPDDII |
| Ga0196899_10405182 | 3300022187 | Aqueous | MTPETRPEAPTASFQTLWVQRQLKKLRERTEALKAQYIKPDDII |
| (restricted) Ga0233412_100387594 | 3300023210 | Seawater | MTPETRPSVRPTDAPQAPTAGFQTLWVQRQLKKLKERTEALKAQYIKPNDII |
| (restricted) Ga0233412_100548542 | 3300023210 | Seawater | MTPETRPQAPTAGFQTLWVQRQLKKLKERTEALKAQYIKPNDII |
| (restricted) Ga0255040_100777822 | 3300024059 | Seawater | MTPETRPHAPTAGFQTLWVQRQLKKLKERTEALKAQYIKPNDII |
| (restricted) Ga0255039_101146442 | 3300024062 | Seawater | MTPETRPHAPTAGFQTLWVQRQLKKLKERAEALKAQYIKPTDIL |
| (restricted) Ga0255042_102481462 | 3300024340 | Seawater | MTPETRPQAPTAGFQTLWVQRQLKKLKERTEALKAQYIKPDDII |
| (restricted) Ga0255046_100692454 | 3300024519 | Seawater | MTPETRPQAPTAGFQTLWVQRQLKKLKERAEALKAQYIKPDDII |
| (restricted) Ga0255046_104186851 | 3300024519 | Seawater | PTAGFQTLWVQRQLKKLKERAEALKAQYIKPDDII |
| Ga0208667_10129894 | 3300025070 | Marine | MTPETRPQAPTAGFQTLWVQRQLKKLKERAEALKAQYIKPTDIL |
| Ga0208298_10040014 | 3300025084 | Marine | MTPETRPQAPTAGFQTLWVQRQLKKLKERTEALKAQYIKPTDIL |
| Ga0208298_10342332 | 3300025084 | Marine | MTPETRPSVRPTDAPQAPTAGFQTLWVQRQLKKLKERTEALKAQYIKPTDILXLLCVKKL |
| Ga0209535_10760806 | 3300025120 | Marine | MSSETRPQAPTAGFQTLWVQRQLKKLKDRTEALKAQYIKPTDIL |
| Ga0209535_10959345 | 3300025120 | Marine | MTPETRPHAPTAGFQTLWVQRQLTKLKKRAEALKAQYIKPTEIL |
| Ga0209337_11155964 | 3300025168 | Marine | QAPTAGFQTLWVQRQLTKLKKRAEALKAQYIKPTEIL |
| Ga0209337_11627334 | 3300025168 | Marine | INVPIVSPHVTMPNETRPQAPTAGFQTLWVQRQLKKLKDRTEALKAQYIKPTDIL |
| Ga0208160_10408673 | 3300025647 | Aqueous | MTPETRPSVRPTDAPQAPTAGFQTLWVQRQLKKLRERTEALKAQYIKPDDII |
| Ga0208644_11592763 | 3300025889 | Aqueous | PQAPTAGFQTLWVQRQLKKLRERTEALKAQYIKPDDII |
| Ga0208023_10488184 | 3300027206 | Estuarine | APTAGFQTLWVQRQLKKLKDRTEALKAQYIKPTDIL |
| Ga0208923_10506494 | 3300027320 | Estuarine | MTPETRPQAPTAGFQTLWVQRQLTKLKKRAEALKAQYIKPTEIL |
| (restricted) Ga0233414_104969161 | 3300028045 | Seawater | PQAPTAGFQTLWVQRQLKKLKERTEALKAQYIKPTDIL |
| Ga0307488_104885903 | 3300031519 | Sackhole Brine | MTPETRPHAPTAGFQTLWVQRQLKKLKERTEALKAQYIKPTDIL |
| Ga0307488_107231711 | 3300031519 | Sackhole Brine | TQYTLSRYHPMTPETRPQAPTAGFQTLWVQRQLKKLKERTEALKAQYIKPTDIL |
| Ga0307380_105522445 | 3300031539 | Soil | MTPETRPHAPTAGFQTLWVQRQLKKLKERTEALKAQYIKPHDII |
| Ga0307378_108878085 | 3300031566 | Soil | MTPETRPHAPTAGFQTLWVQRQLKKLKERTEALKAQYIKPNE |
| Ga0307378_109817984 | 3300031566 | Soil | RPHAPTAGFQTLWVQRQLKKLKERTEALKAQYIKPHDII |
| Ga0307489_107768373 | 3300031569 | Sackhole Brine | SQAPTAGFQTLWVQRQLKKLKERTEALKAQYIKPTDII |
| Ga0307376_102370224 | 3300031578 | Soil | SYSMTPETRPHAPTAGFQTLWVQRQLKKLKERTEALKAQYIKPNEII |
| Ga0307376_108312133 | 3300031578 | Soil | MTPETRPHAPTAGFQTLWVQRQLKKLKERTEALKAQYIK |
| Ga0307375_105478091 | 3300031669 | Soil | MTPETRPHAPTAGFQTLWVQRQLKKLKERTEALKA |
| ⦗Top⦘ |