


| Basic Information | |
|---|---|
| Family ID | F084296 |
| Family Type | Metagenome |
| Number of Sequences | 112 |
| Average Sequence Length | 43 residues |
| Representative Sequence | YQRGVVQTDYGLSTAMGVVLLVLAFAVTYFSLRYSRGALVE |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 112 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 94.64 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.321 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (14.286 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.571 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (40.179 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.07% β-sheet: 0.00% Coil/Unstructured: 44.93% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 112 Family Scaffolds |
|---|---|---|
| PF00528 | BPD_transp_1 | 44.64 |
| PF00005 | ABC_tran | 8.93 |
| PF08402 | TOBE_2 | 3.57 |
| PF00296 | Bac_luciferase | 0.89 |
| PF00171 | Aldedh | 0.89 |
| PF02878 | PGM_PMM_I | 0.89 |
| PF03949 | Malic_M | 0.89 |
| PF13660 | DUF4147 | 0.89 |
| COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
|---|---|---|---|
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.89 |
| COG0033 | Phosphoglucomutase/phosphomannomutase | Carbohydrate transport and metabolism [G] | 0.89 |
| COG0281 | Malic enzyme | Energy production and conversion [C] | 0.89 |
| COG0686 | Alanine dehydrogenase (includes sporulation protein SpoVN) | Amino acid transport and metabolism [E] | 0.89 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.89 |
| COG1109 | Phosphomannomutase | Carbohydrate transport and metabolism [G] | 0.89 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.89 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.32 % |
| Unclassified | root | N/A | 2.68 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_101622755 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 661 | Open in IMG/M |
| 3300000955|JGI1027J12803_104628560 | Not Available | 532 | Open in IMG/M |
| 3300000955|JGI1027J12803_107040160 | Not Available | 507 | Open in IMG/M |
| 3300003319|soilL2_10180050 | All Organisms → cellular organisms → Bacteria | 1260 | Open in IMG/M |
| 3300003321|soilH1_10216084 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1115 | Open in IMG/M |
| 3300003324|soilH2_10142100 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3288 | Open in IMG/M |
| 3300003324|soilH2_10326680 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
| 3300004114|Ga0062593_101679093 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300004479|Ga0062595_102637437 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300004480|Ga0062592_100935352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 785 | Open in IMG/M |
| 3300005330|Ga0070690_100549870 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300005336|Ga0070680_100837900 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300005338|Ga0068868_100446976 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
| 3300005339|Ga0070660_101256990 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300005466|Ga0070685_11621492 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300005518|Ga0070699_101683455 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300005546|Ga0070696_101475564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 581 | Open in IMG/M |
| 3300005556|Ga0066707_10457128 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300005578|Ga0068854_100137496 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1872 | Open in IMG/M |
| 3300005615|Ga0070702_101581113 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300006038|Ga0075365_11062488 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300006358|Ga0068871_100524189 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
| 3300006794|Ga0066658_10404311 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300006797|Ga0066659_10804414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 778 | Open in IMG/M |
| 3300006845|Ga0075421_101722233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 677 | Open in IMG/M |
| 3300006854|Ga0075425_101573188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 741 | Open in IMG/M |
| 3300006903|Ga0075426_10321408 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
| 3300006904|Ga0075424_102849866 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300009094|Ga0111539_10858993 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
| 3300009098|Ga0105245_11492494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 727 | Open in IMG/M |
| 3300009098|Ga0105245_12329190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 589 | Open in IMG/M |
| 3300009100|Ga0075418_11104308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 859 | Open in IMG/M |
| 3300009101|Ga0105247_10254347 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1202 | Open in IMG/M |
| 3300009137|Ga0066709_101104519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1166 | Open in IMG/M |
| 3300009162|Ga0075423_11673524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 685 | Open in IMG/M |
| 3300009174|Ga0105241_10963245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 796 | Open in IMG/M |
| 3300009540|Ga0073899_11049692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 572 | Open in IMG/M |
| 3300009553|Ga0105249_10193577 | All Organisms → cellular organisms → Bacteria | 1986 | Open in IMG/M |
| 3300009553|Ga0105249_11784572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 688 | Open in IMG/M |
| 3300009553|Ga0105249_12364404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 604 | Open in IMG/M |
| 3300009691|Ga0114944_1223866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 757 | Open in IMG/M |
| 3300009702|Ga0114931_10054044 | All Organisms → cellular organisms → Bacteria | 3883 | Open in IMG/M |
| 3300009870|Ga0131092_11404373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 536 | Open in IMG/M |
| 3300010044|Ga0126310_11565745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 543 | Open in IMG/M |
| 3300010323|Ga0134086_10096212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1043 | Open in IMG/M |
| 3300010371|Ga0134125_11901071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 647 | Open in IMG/M |
| 3300010373|Ga0134128_11089919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 882 | Open in IMG/M |
| 3300010397|Ga0134124_12718568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 538 | Open in IMG/M |
| 3300010399|Ga0134127_10366032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1414 | Open in IMG/M |
| 3300012210|Ga0137378_10507737 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1113 | Open in IMG/M |
| 3300012285|Ga0137370_10888131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 551 | Open in IMG/M |
| 3300012353|Ga0137367_10249351 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1277 | Open in IMG/M |
| 3300012354|Ga0137366_10227949 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1386 | Open in IMG/M |
| 3300012519|Ga0157352_1023153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 770 | Open in IMG/M |
| 3300012901|Ga0157288_10021994 | All Organisms → cellular organisms → Bacteria | 1231 | Open in IMG/M |
| 3300012903|Ga0157289_10067892 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300012906|Ga0157295_10262465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 585 | Open in IMG/M |
| 3300012912|Ga0157306_10246077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 628 | Open in IMG/M |
| 3300012943|Ga0164241_10997947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Yinghuangia → unclassified Yinghuangia → Yinghuangia sp. KLBMP8922 | 614 | Open in IMG/M |
| 3300012951|Ga0164300_10457640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 718 | Open in IMG/M |
| 3300012951|Ga0164300_10697667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 614 | Open in IMG/M |
| 3300012957|Ga0164303_10042212 | All Organisms → cellular organisms → Bacteria | 1965 | Open in IMG/M |
| 3300012957|Ga0164303_10556101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 746 | Open in IMG/M |
| 3300012958|Ga0164299_10364974 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
| 3300012958|Ga0164299_11351016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 548 | Open in IMG/M |
| 3300012961|Ga0164302_10550209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 826 | Open in IMG/M |
| 3300012989|Ga0164305_11093743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 684 | Open in IMG/M |
| 3300013297|Ga0157378_13224216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 507 | Open in IMG/M |
| 3300013308|Ga0157375_11669932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 754 | Open in IMG/M |
| 3300014325|Ga0163163_10944840 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300014827|Ga0120171_1101467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 726 | Open in IMG/M |
| 3300014968|Ga0157379_10977441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 806 | Open in IMG/M |
| 3300015200|Ga0173480_10912553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 571 | Open in IMG/M |
| 3300018028|Ga0184608_10246166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 786 | Open in IMG/M |
| 3300018028|Ga0184608_10306990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 697 | Open in IMG/M |
| 3300018029|Ga0187787_10028195 | All Organisms → cellular organisms → Bacteria | 1551 | Open in IMG/M |
| 3300018053|Ga0184626_10014188 | All Organisms → cellular organisms → Bacteria | 3161 | Open in IMG/M |
| 3300018054|Ga0184621_10331734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 535 | Open in IMG/M |
| 3300018071|Ga0184618_10382632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 597 | Open in IMG/M |
| 3300018074|Ga0184640_10263094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 783 | Open in IMG/M |
| 3300018076|Ga0184609_10458299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 585 | Open in IMG/M |
| 3300018079|Ga0184627_10144794 | All Organisms → cellular organisms → Bacteria | 1259 | Open in IMG/M |
| 3300021081|Ga0210379_10463567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 562 | Open in IMG/M |
| 3300021339|Ga0193706_1164040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 605 | Open in IMG/M |
| 3300022898|Ga0247745_1006958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1480 | Open in IMG/M |
| 3300025313|Ga0209431_10703899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 746 | Open in IMG/M |
| 3300025885|Ga0207653_10339177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 586 | Open in IMG/M |
| 3300025910|Ga0207684_10031607 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4502 | Open in IMG/M |
| 3300025912|Ga0207707_10057123 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3397 | Open in IMG/M |
| 3300025925|Ga0207650_10207784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1571 | Open in IMG/M |
| 3300025933|Ga0207706_10859342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 768 | Open in IMG/M |
| 3300025935|Ga0207709_10230666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Halomonadaceae → Halotalea → Halotalea alkalilenta | 1341 | Open in IMG/M |
| 3300025961|Ga0207712_11923193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 530 | Open in IMG/M |
| 3300026121|Ga0207683_10055347 | All Organisms → cellular organisms → Bacteria | 3478 | Open in IMG/M |
| 3300026142|Ga0207698_10875673 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300027909|Ga0209382_11278745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 745 | Open in IMG/M |
| 3300028536|Ga0137415_11053195 | Not Available | 626 | Open in IMG/M |
| 3300028587|Ga0247828_10382834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 804 | Open in IMG/M |
| 3300028885|Ga0307304_10366049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 646 | Open in IMG/M |
| 3300031547|Ga0310887_10869865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 569 | Open in IMG/M |
| 3300031820|Ga0307473_11490081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 513 | Open in IMG/M |
| 3300031858|Ga0310892_10830092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 643 | Open in IMG/M |
| 3300031858|Ga0310892_11131021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 556 | Open in IMG/M |
| 3300031873|Ga0315297_10225484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae | 1549 | Open in IMG/M |
| 3300031918|Ga0311367_10613628 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
| 3300032000|Ga0310903_10116407 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
| 3300032000|Ga0310903_10586371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 592 | Open in IMG/M |
| 3300032003|Ga0310897_10609279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 540 | Open in IMG/M |
| 3300032075|Ga0310890_11766203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 514 | Open in IMG/M |
| 3300032174|Ga0307470_10385741 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300032205|Ga0307472_102364892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 539 | Open in IMG/M |
| 3300033500|Ga0326730_1064132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 695 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 14.29% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 7.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 7.14% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.36% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.46% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.46% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 4.46% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.57% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 3.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.68% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.68% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.79% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.79% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.79% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.79% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.89% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.89% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.89% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.89% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.89% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.89% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.89% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.89% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.89% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.89% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009540 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB5-Ph | Engineered | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009691 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2 | Environmental | Open in IMG/M |
| 3300009702 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV14_V59a metaG | Environmental | Open in IMG/M |
| 3300009870 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant | Engineered | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012519 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610 | Environmental | Open in IMG/M |
| 3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
| 3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
| 3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014827 | Permafrost microbial communities from Nunavut, Canada - A3_80cm_18M | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021339 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c1 | Environmental | Open in IMG/M |
| 3300022898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5 | Environmental | Open in IMG/M |
| 3300025313 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033500 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF7AN SIP fraction | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1016227552 | 3300000364 | Soil | YQRGVISTDYGVSATMGIVLLVVAFVVTYFSLRFSRGALIE* |
| JGI1027J12803_1046285601 | 3300000955 | Soil | AWTLYQRGVISTDYGVSATMGIVLLVVAFVVTYFSLRFSRGALIE* |
| JGI1027J12803_1070401601 | 3300000955 | Soil | GVISTDYGVSATMGIVLLLVAFVVTYFSLRFSRGALVE* |
| soilL2_101800503 | 3300003319 | Sugarcane Root And Bulk Soil | TLYQRGVVQTDYGLSTAMGVVLLILAFTVTYFSLRYSRGALVE* |
| soilH1_102160843 | 3300003321 | Sugarcane Root And Bulk Soil | YQRGVVQTDYGLASAMSVVLLVIAVVGGYFSLRYSRGALVD* |
| soilH2_101421001 | 3300003324 | Sugarcane Root And Bulk Soil | RGVVQTDYGLSTAMGVVLLGVAFVVTYLSLRYSRGALVE* |
| soilH2_103266801 | 3300003324 | Sugarcane Root And Bulk Soil | RGVVQTDYGLSSAMSVLLLVIAFVVSYVSLRYSRGALFQ* |
| Ga0062593_1016790931 | 3300004114 | Soil | WTLYQRGVVQTDYGLSTTMGVILLILAFTVTYFSLRYSRGALLE* |
| Ga0062595_1026374371 | 3300004479 | Soil | WTLYQRGVISTDYGVSATMGIVLLLVAFVVTYFSLRFSRGALVE* |
| Ga0062592_1009353522 | 3300004480 | Soil | QRGVVQTDYGLSTTMGVILLILAFTVTYFSLRYSRGALLE* |
| Ga0070690_1005498702 | 3300005330 | Switchgrass Rhizosphere | TLAWTLYQRGVISTDYGVSATMGIVLLVVAFVVTYFSLRFSRGALVE* |
| Ga0070680_1008379001 | 3300005336 | Corn Rhizosphere | YDRGVVQNDYGLASAMGMVLLAVAFVVTYFSLRYSRGALAE* |
| Ga0068868_1004469763 | 3300005338 | Miscanthus Rhizosphere | RGVVQTDYGLSTAMGVVLLIVAFVVTYLSLRYSRGALVE* |
| Ga0070660_1012569902 | 3300005339 | Corn Rhizosphere | VTIYDRGVVQNDYGLASAMGVLLLAIAFVVTYFSLRYSRGALAE* |
| Ga0070685_116214922 | 3300005466 | Switchgrass Rhizosphere | TIYDRGVVQNDYGLGSAMGVVLLAIAFIVTYFSLRYSRGALAE* |
| Ga0070699_1016834551 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | EQRSLAWTVYQNAVVENDYGIASAMGIVLLALAFAVTYFSLRYSRGALVE* |
| Ga0070696_1014755642 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | QRGVVQTDYGLSSAMSVVLLIIAFIVSYFSLRYSRGALVE* |
| Ga0066707_104571282 | 3300005556 | Soil | EQRALAWTVYQRGVVQTDYGLSTAMGTVLLIIAFAVTYLSLRYSRGALVE* |
| Ga0068854_1001374963 | 3300005578 | Corn Rhizosphere | DRGVVQNDYGLASAMGMVLLAIAFVVTYFSLRYSRGALAE* |
| Ga0070702_1015811132 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | YQRGVVQTDYGLSSAMSVVLLVIAFVVSYFSLRYSRGALVE* |
| Ga0075365_110624881 | 3300006038 | Populus Endosphere | YQRGVVQTDYGLSSAMGIVLLVIALLVSYFSLRYSRGALIE* |
| Ga0068871_1005241893 | 3300006358 | Miscanthus Rhizosphere | QRGVVQTDYGLSSAMGIVLLVIALLVSYFSLRYSRGALIE* |
| Ga0066658_104043111 | 3300006794 | Soil | RSLAWTVYQNAVVENAYGIASAMGIVLLALAFVVTYFSLRYSRGALVE* |
| Ga0066659_108044141 | 3300006797 | Soil | TDYGLATTMGVVLLAFAFVVTYFSLRYSRGALIE* |
| Ga0075421_1017222332 | 3300006845 | Populus Rhizosphere | YQRGVVQTDYGLSTTMGVVLLILAFTVTYFSLRYSRGALVE* |
| Ga0075425_1015731881 | 3300006854 | Populus Rhizosphere | RGVVQSDYGLASTMGIVLLAIAFVVTYFSLRYTRGALAE* |
| Ga0075426_103214083 | 3300006903 | Populus Rhizosphere | AWTVYQRGVVQTDYGLSTAMGVVLLLVAFVVTYLSLRYSRGALVE* |
| Ga0075424_1028498661 | 3300006904 | Populus Rhizosphere | WTVYQRGVVQTDYGLSTAMGVVLLLVAFVVTYLSLRYSRGALVE* |
| Ga0111539_108589933 | 3300009094 | Populus Rhizosphere | ALAWTLYQRGVVQTDYGLASAMSVVLLIIAVVVSYFSLRYSRGALVD* |
| Ga0105245_114924942 | 3300009098 | Miscanthus Rhizosphere | LYQRGVVQTDYGLASAMSVVLLIITVVVSYFSLRYSRGALVD* |
| Ga0105245_123291902 | 3300009098 | Miscanthus Rhizosphere | VQTDYGLSTAMGVVLLLVAFVVTYLSLRYSRGALVE* |
| Ga0075418_111043081 | 3300009100 | Populus Rhizosphere | GVVQTDYGLSSAMSVVLLVIAFIVSYFSLRYSRGALVS* |
| Ga0105247_102543473 | 3300009101 | Switchgrass Rhizosphere | EQKSLAWTLYQRGVVQTDYGLATTMGVVLLVLAFTVTYFSLRYSRGALIE* |
| Ga0066709_1011045193 | 3300009137 | Grasslands Soil | ALAWTVYQRGVVQTDYGLSTAMGVVLLGVAFVVTYLSLRYSRGALVA* |
| Ga0075423_116735242 | 3300009162 | Populus Rhizosphere | GVVQSDYGISSAMSVVLLVVAFAVSYFALRYSRGALVQ* |
| Ga0105241_109632452 | 3300009174 | Corn Rhizosphere | LYQRGVVQTDYGLSTAMGVVLLILAFAVTYFSLRYLRGALVE* |
| Ga0073899_110496921 | 3300009540 | Activated Sludge | NEQRTLAWTLYQRGVVQTDYGLSTAMGIMLLIMAFLVTYASLRFSKGALVE* |
| Ga0105249_101935771 | 3300009553 | Switchgrass Rhizosphere | VVQTDYGLSSAMGIVLLVIALLVSYFSLRYSRGALIE* |
| Ga0105249_117845721 | 3300009553 | Switchgrass Rhizosphere | QKSLAWTLYQRGVVQTDYGLSTAMGVVLLILAFAVTYFSLRYSRGALVE* |
| Ga0105249_123644041 | 3300009553 | Switchgrass Rhizosphere | TIYDRGVVQNDYGLASAMGMVLLAIAFVVTYFSLRYSRGALAE* |
| Ga0114944_12238661 | 3300009691 | Thermal Springs | VVQTDYGLSTTMGVVLLVLAFTVTYFSLRYSRGALVE* |
| Ga0114931_100540441 | 3300009702 | Deep Subsurface | QRAMAWTLYQRGVVQLDYGLGTTMGVVLMVLAFTVNYVSLRYSRGALVQ* |
| Ga0131092_114043732 | 3300009870 | Activated Sludge | MALTLYNRGIVLFDYGTSATMGVVLMVIAFSVTYFSLRYSRGALVD* |
| Ga0126310_115657451 | 3300010044 | Serpentine Soil | QKSLAWTLYQRGVVQTDYGLSTTMGVVLLILAFTVTYFSLRYSGGALVE* |
| Ga0134086_100962121 | 3300010323 | Grasslands Soil | VVQTDYGLATTMGVVLLAFAFVVTYFSLRYSRGALIE* |
| Ga0134125_119010712 | 3300010371 | Terrestrial Soil | YDRGVVQNDYGLASAMGVLLLAIAFVVTYFSLRYSRGALAE* |
| Ga0134128_110899191 | 3300010373 | Terrestrial Soil | EQHSLAVTIYDRGVVQNDYGLASAMGVVLLAVAFVVTYFSLRYSRGALAE* |
| Ga0134124_127185682 | 3300010397 | Terrestrial Soil | VQTDYGLSTAMGVVLLGVAFVVTYLSLRYSRGALVE* |
| Ga0134127_103660323 | 3300010399 | Terrestrial Soil | LYQRGVVQTDYGLSSAMSVVLLVIAFIVSYFSLRYSRGALVE* |
| Ga0137378_105077371 | 3300012210 | Vadose Zone Soil | TVYQNAVVENDSGIASAMGIVLLALAFVVTYFSLRYSRGALVE* |
| Ga0137370_108881311 | 3300012285 | Vadose Zone Soil | DQRSLAWTVYQNAVVENDYGIASAMGIVLLALAFVVTYFSLRYSRGALVE* |
| Ga0137367_102493511 | 3300012353 | Vadose Zone Soil | NDYGLSSTMGIVLLSIAFIVTYFSLRYSRGALIE* |
| Ga0137366_102279493 | 3300012354 | Vadose Zone Soil | AVQNDYGLSSTMGIVLLSIAFAVTYFSLRYSRGALVE* |
| Ga0157352_10231531 | 3300012519 | Unplanted Soil | QRGVVQTDYGLSTAMGVVLLIVAFVVTYLSLRYSRGALVE* |
| Ga0157288_100219943 | 3300012901 | Soil | STDYGVSATMGIVLLLVAFVVTYFSLRFSRGALVE* |
| Ga0157289_100678921 | 3300012903 | Soil | QRTLAWTLYQRGVISTDYGVSATMGIVLLLVAFVVTYFSLRFSRGALVE* |
| Ga0157295_102624652 | 3300012906 | Soil | VQNDYGLASAMGMVLLAIAFVVTYFSLRYSRGALAE* |
| Ga0157306_102460771 | 3300012912 | Soil | RSLAWTLYQRGVVQTDYGLSTTMGVILLILAFTVTYFSLRYSRGALLE* |
| Ga0164241_109979471 | 3300012943 | Soil | VVQSDYGLSSAMSIVLMVLAVVVSYTSLRYSRNALV* |
| Ga0164300_104576401 | 3300012951 | Soil | QRGVVQTDYGLSSAMSVVLLVIAFVVSYFSLRYSRGALIE* |
| Ga0164300_106976672 | 3300012951 | Soil | NEQRSLALTIYERGVVQNDYGLSSTMGIVLLLLAFLVTYFSLRYSRGALAE* |
| Ga0164303_100422123 | 3300012957 | Soil | STVYQRGVVQTDYGLSTAMGDVLLLVAFVVTSLSLRYSRGALVE* |
| Ga0164303_105561012 | 3300012957 | Soil | ALTLYQRGVVQTDYGLSSAMGIVLLVIALLVSYFSLRYSRGALIE* |
| Ga0164299_103649741 | 3300012958 | Soil | QRALAWTLFQRGVVQTDYGLASAMSVVLLVIAVVVSYFSLRYSRGALVD* |
| Ga0164299_113510161 | 3300012958 | Soil | GVVQTDYGLSSAMSVVLLVIAFVVSYFSLRYSRGALVE* |
| Ga0164302_105502091 | 3300012961 | Soil | LYQRGVVQTDYGLSSAMGIVLLVIALLVSYFSLRYSRGALIE* |
| Ga0164305_110937432 | 3300012989 | Soil | RSLAWTVYQRGVISTDYGVSATMGIVLLVVAFVVTYFSLRYSRGGLVE* |
| Ga0157378_132242162 | 3300013297 | Miscanthus Rhizosphere | LYQRGVVQTDYGLSSAMSVVLLVIAFVVSYFSLRYSRGALVE* |
| Ga0157375_116699321 | 3300013308 | Miscanthus Rhizosphere | EQRSLAVTIYDRGVVQNDYGLASAMGMVLLAVAFVVTYFSLRYSRGALAE* |
| Ga0163163_109448402 | 3300014325 | Switchgrass Rhizosphere | VVQNDYGLASAMGMVLLAIAFVVTYFSLRYSRGALAE* |
| Ga0120171_11014672 | 3300014827 | Permafrost | LYQHGIVQSDYGASAAMAVLLLLIAFVVTYFSLRYSRGALVQ* |
| Ga0157379_109774411 | 3300014968 | Switchgrass Rhizosphere | QRGVISTDYGVSATMGIVLLVLAFVVTYFSLRFSRGALVE* |
| Ga0173480_109125532 | 3300015200 | Soil | QNDYGLASAMGMVLLAIAFVVTYFSLRYSRGALAE* |
| Ga0184608_102461661 | 3300018028 | Groundwater Sediment | RALAWTLYQRGVVQGDYGIASTMSVVLLVIAFAVSYFALRYSRGALVQ |
| Ga0184608_103069901 | 3300018028 | Groundwater Sediment | SLAWTLYQRGVVQTDYGLSTAMGVVLLILAFAVTYFSLRYSRGALVE |
| Ga0187787_100281951 | 3300018029 | Tropical Peatland | QKGVVQNDYGLSTTMGIVLLVIAFVVSWGSLRYSRGALVD |
| Ga0184626_100141881 | 3300018053 | Groundwater Sediment | NEQRSLAWTVYQRGVVQNDYGLSSTMGIVLLGIAFLVTYISLRYSRGALVE |
| Ga0184621_103317341 | 3300018054 | Groundwater Sediment | RALAWTLYQRGVVQTDYGLSSAMSVVLLAIAFAVSYFSLRYSRGALVA |
| Ga0184618_103826321 | 3300018071 | Groundwater Sediment | NEQKSLAWTLYQRGVVQTDYGLSTAMGVVLLILAFAVTYFSLRYSRGALVE |
| Ga0184640_102630942 | 3300018074 | Groundwater Sediment | YQRGVVQTDYGLSTAMGVVLLVLAFAVTYFSLRYSRGALVE |
| Ga0184609_104582992 | 3300018076 | Groundwater Sediment | DRGVVQNDYGLASAMGMVLLAIAFVVTYFSLRYSRGALIE |
| Ga0184627_101447941 | 3300018079 | Groundwater Sediment | AEQRTLAWTLYQRGVVQLDYGLATAMGVILMILAFTVNYASLRYSRGGLV |
| Ga0210379_104635672 | 3300021081 | Groundwater Sediment | LFQRGVVQTDYGLSTTMGVVLLILAFVVTYLSLRYSRGALVE |
| Ga0193706_11640401 | 3300021339 | Soil | NRGVVQADYGLSSAMAIVLLVLAFGVSYVSIRYSRGALV |
| Ga0247745_10069581 | 3300022898 | Soil | RGVISTDYGVSATMGIVLLVVAFVVTYFSLRFSRGALVE |
| Ga0209431_107038991 | 3300025313 | Soil | SLAWTLYQRGVVQTDYGLSTAMGVVLLIFAFIVSYLSLRYSRNALVD |
| Ga0207653_103391772 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | QRGVVQTDYGLSSAMSVVLLVIAFIVSYFSLRYSRGALVE |
| Ga0207684_100316076 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | RGVVQTDYGLSTAMGVVLLGVAFVVTYLSLRYSRGALVE |
| Ga0207707_100571231 | 3300025912 | Corn Rhizosphere | EQRALAWTLYQRGVVQTDYGLSSAMSVVLLIIAFIVSYFSLRYSRGALVE |
| Ga0207650_102077841 | 3300025925 | Switchgrass Rhizosphere | LYQRGVVQTDYGLSSAMGIVLLVIALLVSYFSLRYSRGALIE |
| Ga0207706_108593421 | 3300025933 | Corn Rhizosphere | SLAVTIYDRGVVQNDYGLASAMGMVLLAIAFVVTYFSLRYSRGALAE |
| Ga0207709_102306663 | 3300025935 | Miscanthus Rhizosphere | GVVQTDYGLSTAMGVVLLILAFAVTYFSLRYSRGALVE |
| Ga0207712_119231932 | 3300025961 | Switchgrass Rhizosphere | VQTDYGLSTAMGVVLLILAFAVTYFSLRYSHGALVE |
| Ga0207683_100553471 | 3300026121 | Miscanthus Rhizosphere | NEQRSLAVTIYDRGVVQNDYGLASAMGVVLLAIAFVVTYFSLRYSRGALAE |
| Ga0207698_108756732 | 3300026142 | Corn Rhizosphere | GVVQTDYGLSSAMGIVLLVIALLVSYFSLRYSRGALIE |
| Ga0209382_112787452 | 3300027909 | Populus Rhizosphere | YQRGVVQTDYGLSTTMGVVLLILAFTVTYFSLRYSRGALVE |
| Ga0137415_110531951 | 3300028536 | Vadose Zone Soil | NEQRALAWTLYQRGVVQTDYGLSTAMGTVLLVIAFAVTYLSLRYSRGALVE |
| Ga0247828_103828342 | 3300028587 | Soil | AWTLFQRGVVQTDYGLASAMSVVLLVIAVVVSYFSLRYSRGALVD |
| Ga0307304_103660492 | 3300028885 | Soil | AYTLYQRGVVQSDYGLSSAMSIVLLVLAFAVSYLSLRHSRRALI |
| Ga0310887_108698651 | 3300031547 | Soil | RSLAVTIYDRGVVQNDYGLASAMGMVLLAVAFVVTYFSLRYSRGALAE |
| Ga0307473_114900812 | 3300031820 | Hardwood Forest Soil | TLYQRGVVQTDYGLSTTMGVVLLVIAFVVTYFSLRFSRGALVE |
| Ga0310892_108300921 | 3300031858 | Soil | VQNDYGLASAMGMVLLAIAFVVTYFSLRYSRGALAE |
| Ga0310892_111310211 | 3300031858 | Soil | QRGVISTDYGVSATMGIVLLVVAFVVTYFSLRFSRGALIE |
| Ga0315297_102254843 | 3300031873 | Sediment | LYKRGVVENDYGLSSMMGVVLLSVAFVVTYFSLRFSRGALVD |
| Ga0311367_106136281 | 3300031918 | Fen | GVVQSDYGLSSAMSIVLLVLAVVVSYVSLRYSRNALV |
| Ga0310903_101164073 | 3300032000 | Soil | EQRSLAVTIYDRGVVQNDYGLASAMGMVLLAIAFVVTYFSLRYSRGALAE |
| Ga0310903_105863712 | 3300032000 | Soil | FQRGVVQTDYGLASAMSVVLLVIAVVVSYFSLRYSRGALVD |
| Ga0310897_106092792 | 3300032003 | Soil | GVVQNDYGLGSAMGVVLLAIAFIVTYFSLRYSRGALAE |
| Ga0310890_117662031 | 3300032075 | Soil | LYQRGVISTDYGVSATMGIVLLVVAFVVTYFSLRFSRGALVE |
| Ga0307470_103857412 | 3300032174 | Hardwood Forest Soil | WTLYQRGVVQTDYGLASAMSVVLLIIAVLVSYFSLRYSRGALVD |
| Ga0307472_1023648921 | 3300032205 | Hardwood Forest Soil | VVQNDYGLASAMGMVLLAIAFVVTYFSLRYSRGALAE |
| Ga0326730_10641321 | 3300033500 | Peat Soil | VVENDYGLSSMMGVVLLSLAFTVTYFSLRYSRGALVE |
| ⦗Top⦘ |