


| Basic Information | |
|---|---|
| Family ID | F084170 |
| Family Type | Metagenome |
| Number of Sequences | 112 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MFAKWTDDMVREYFDTHWNATLHEICALSGRTKADVKRVLMGG |
| Number of Associated Samples | 87 |
| Number of Associated Scaffolds | 112 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 89.38 % |
| % of genes near scaffold ends (potentially truncated) | 22.32 % |
| % of genes from short scaffolds (< 2000 bps) | 75.00 % |
| Associated GOLD sequencing projects | 68 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.70 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (41.071 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (43.750 % of family members) |
| Environment Ontology (ENVO) | Unclassified (61.607 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (78.571 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.03% β-sheet: 0.00% Coil/Unstructured: 61.97% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.70 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 112 Family Scaffolds |
|---|---|---|
| PF03237 | Terminase_6N | 3.57 |
| PF14090 | HTH_39 | 1.79 |
| PF00589 | Phage_integrase | 1.79 |
| PF05367 | Phage_endo_I | 0.89 |
| PF02511 | Thy1 | 0.89 |
| PF01381 | HTH_3 | 0.89 |
| PF07486 | Hydrolase_2 | 0.89 |
| PF13884 | Peptidase_S74 | 0.89 |
| PF06067 | DUF932 | 0.89 |
| PF05127 | Helicase_RecD | 0.89 |
| COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
|---|---|---|---|
| COG1351 | Thymidylate synthase ThyX, FAD-dependent family | Nucleotide transport and metabolism [F] | 0.89 |
| COG1444 | tRNA(Met) C34 N-acetyltransferase TmcA | Translation, ribosomal structure and biogenesis [J] | 0.89 |
| COG3773 | Cell wall hydrolase CwlJ, involved in spore germination | Cell cycle control, cell division, chromosome partitioning [D] | 0.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 58.93 % |
| Unclassified | root | N/A | 41.07 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000949|BBAY94_10039559 | All Organisms → Viruses → Predicted Viral | 1317 | Open in IMG/M |
| 3300000949|BBAY94_10115672 | Not Available | 733 | Open in IMG/M |
| 3300003617|JGI26082J51739_10108760 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-13 | 686 | Open in IMG/M |
| 3300003908|JGI26085J52751_1024145 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Zobellviridae → Cobavirinae → Siovirus | 862 | Open in IMG/M |
| 3300004829|Ga0068515_118500 | Not Available | 871 | Open in IMG/M |
| 3300004829|Ga0068515_121093 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon | 814 | Open in IMG/M |
| 3300005588|Ga0070728_10038772 | All Organisms → cellular organisms → Bacteria | 3206 | Open in IMG/M |
| 3300005590|Ga0070727_10096322 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1705 | Open in IMG/M |
| 3300005747|Ga0076924_1066043 | All Organisms → Viruses → Predicted Viral | 1324 | Open in IMG/M |
| 3300005941|Ga0070743_10100452 | Not Available | 972 | Open in IMG/M |
| 3300006025|Ga0075474_10010392 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3563 | Open in IMG/M |
| 3300006025|Ga0075474_10041712 | All Organisms → Viruses → Predicted Viral | 1576 | Open in IMG/M |
| 3300006025|Ga0075474_10087154 | Not Available | 1018 | Open in IMG/M |
| 3300006025|Ga0075474_10228464 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-2 | 564 | Open in IMG/M |
| 3300006027|Ga0075462_10082738 | All Organisms → Viruses → Predicted Viral | 1005 | Open in IMG/M |
| 3300006029|Ga0075466_1130363 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 660 | Open in IMG/M |
| 3300006029|Ga0075466_1167114 | Not Available | 559 | Open in IMG/M |
| 3300006637|Ga0075461_10083556 | Not Available | 1013 | Open in IMG/M |
| 3300006802|Ga0070749_10017879 | All Organisms → Viruses → Predicted Viral | 4516 | Open in IMG/M |
| 3300006802|Ga0070749_10178402 | All Organisms → Viruses → Predicted Viral | 1224 | Open in IMG/M |
| 3300006802|Ga0070749_10404747 | Not Available | 752 | Open in IMG/M |
| 3300006802|Ga0070749_10490051 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-9 | 670 | Open in IMG/M |
| 3300006810|Ga0070754_10145894 | Not Available | 1135 | Open in IMG/M |
| 3300006810|Ga0070754_10160698 | Not Available | 1068 | Open in IMG/M |
| 3300006810|Ga0070754_10266769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 777 | Open in IMG/M |
| 3300006810|Ga0070754_10329970 | Not Available | 679 | Open in IMG/M |
| 3300006868|Ga0075481_10180922 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-2 | 759 | Open in IMG/M |
| 3300007023|Ga0080109_105232 | Not Available | 1000 | Open in IMG/M |
| 3300007344|Ga0070745_1112203 | All Organisms → Viruses → Predicted Viral | 1057 | Open in IMG/M |
| 3300007345|Ga0070752_1004945 | Not Available | 7789 | Open in IMG/M |
| 3300007537|Ga0102934_1056838 | Not Available | 2002 | Open in IMG/M |
| 3300007538|Ga0099851_1044640 | All Organisms → Viruses → Predicted Viral | 1749 | Open in IMG/M |
| 3300007538|Ga0099851_1107011 | All Organisms → Viruses → Predicted Viral | 1063 | Open in IMG/M |
| 3300007538|Ga0099851_1358067 | Not Available | 508 | Open in IMG/M |
| 3300007541|Ga0099848_1041348 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1885 | Open in IMG/M |
| 3300007541|Ga0099848_1312866 | Not Available | 537 | Open in IMG/M |
| 3300007541|Ga0099848_1340850 | Not Available | 507 | Open in IMG/M |
| 3300007542|Ga0099846_1015999 | All Organisms → Viruses → Predicted Viral | 2933 | Open in IMG/M |
| 3300007609|Ga0102945_1011612 | All Organisms → Viruses → Predicted Viral | 2089 | Open in IMG/M |
| 3300008012|Ga0075480_10520773 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-2 | 570 | Open in IMG/M |
| 3300008996|Ga0102831_1222462 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Zobellviridae → Cobavirinae → Siovirus | 623 | Open in IMG/M |
| 3300009079|Ga0102814_10148961 | All Organisms → Viruses → Predicted Viral | 1279 | Open in IMG/M |
| 3300009080|Ga0102815_10035456 | All Organisms → Viruses → Predicted Viral | 2748 | Open in IMG/M |
| 3300009149|Ga0114918_10599466 | Not Available | 583 | Open in IMG/M |
| 3300009428|Ga0114915_1029487 | All Organisms → cellular organisms → Bacteria | 1887 | Open in IMG/M |
| 3300009434|Ga0115562_1053711 | All Organisms → Viruses → Predicted Viral | 1771 | Open in IMG/M |
| 3300009438|Ga0115559_1098837 | All Organisms → Viruses → Predicted Viral | 1142 | Open in IMG/M |
| 3300010368|Ga0129324_10180278 | Not Available | 866 | Open in IMG/M |
| 3300010368|Ga0129324_10410962 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Zobellviridae → Cobavirinae → Siovirus → Siovirus germanense | 522 | Open in IMG/M |
| 3300011188|Ga0136587_1056294 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 963 | Open in IMG/M |
| 3300011188|Ga0136587_1194656 | Not Available | 530 | Open in IMG/M |
| 3300012269|Ga0136560_1069425 | Not Available | 667 | Open in IMG/M |
| 3300012920|Ga0160423_10485459 | Not Available | 841 | Open in IMG/M |
| 3300013010|Ga0129327_10112185 | All Organisms → Viruses → Predicted Viral | 1347 | Open in IMG/M |
| 3300017818|Ga0181565_10363176 | Not Available | 961 | Open in IMG/M |
| 3300017951|Ga0181577_10126325 | Not Available | 1753 | Open in IMG/M |
| 3300018413|Ga0181560_10109377 | All Organisms → Viruses → Predicted Viral | 1459 | Open in IMG/M |
| 3300018415|Ga0181559_10143266 | All Organisms → Viruses → Predicted Viral | 1413 | Open in IMG/M |
| 3300018420|Ga0181563_10012132 | Not Available | 7138 | Open in IMG/M |
| 3300018420|Ga0181563_10043479 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3231 | Open in IMG/M |
| 3300018424|Ga0181591_10869649 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-2 | 621 | Open in IMG/M |
| 3300021085|Ga0206677_10258377 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Zobellviridae → Cobavirinae → Siovirus → unclassified Siovirus → Lentibacter virus vB_LenP_ICBM2 | 715 | Open in IMG/M |
| 3300021378|Ga0213861_10066316 | Not Available | 2255 | Open in IMG/M |
| 3300021958|Ga0222718_10040384 | All Organisms → Viruses → Predicted Viral | 3039 | Open in IMG/M |
| 3300021958|Ga0222718_10053721 | All Organisms → Viruses → Predicted Viral | 2543 | Open in IMG/M |
| 3300021960|Ga0222715_10570457 | Not Available | 589 | Open in IMG/M |
| 3300021964|Ga0222719_10654067 | Not Available | 602 | Open in IMG/M |
| 3300022050|Ga0196883_1037317 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 592 | Open in IMG/M |
| 3300022061|Ga0212023_1005230 | All Organisms → Viruses → Predicted Viral | 1545 | Open in IMG/M |
| 3300022169|Ga0196903_1024500 | Not Available | 723 | Open in IMG/M |
| 3300022176|Ga0212031_1019224 | All Organisms → Viruses → Predicted Viral | 1052 | Open in IMG/M |
| 3300022183|Ga0196891_1002010 | All Organisms → Viruses → Predicted Viral | 4438 | Open in IMG/M |
| 3300022198|Ga0196905_1023351 | All Organisms → Viruses → Predicted Viral | 1915 | Open in IMG/M |
| 3300022200|Ga0196901_1020987 | All Organisms → Viruses → Predicted Viral | 2632 | Open in IMG/M |
| 3300022200|Ga0196901_1090710 | Not Available | 1077 | Open in IMG/M |
| 3300022200|Ga0196901_1136928 | Not Available | 826 | Open in IMG/M |
| 3300022308|Ga0224504_10056362 | All Organisms → Viruses → Predicted Viral | 1566 | Open in IMG/M |
| 3300024319|Ga0228670_1026710 | All Organisms → Viruses → Predicted Viral | 1446 | Open in IMG/M |
| 3300024346|Ga0244775_10046100 | Not Available | 3815 | Open in IMG/M |
| 3300024346|Ga0244775_10293268 | All Organisms → Viruses → Predicted Viral | 1349 | Open in IMG/M |
| (restricted) 3300024520|Ga0255047_10014581 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-6 | 4282 | Open in IMG/M |
| 3300025276|Ga0208814_1015320 | All Organisms → Viruses → Predicted Viral | 2645 | Open in IMG/M |
| 3300025543|Ga0208303_1001511 | Not Available | 9075 | Open in IMG/M |
| 3300025610|Ga0208149_1019060 | All Organisms → Viruses → Predicted Viral | 1975 | Open in IMG/M |
| 3300025610|Ga0208149_1117419 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-2 | 628 | Open in IMG/M |
| 3300025620|Ga0209405_1113206 | Not Available | 756 | Open in IMG/M |
| 3300025645|Ga0208643_1071509 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1008 | Open in IMG/M |
| 3300025652|Ga0208134_1166564 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Zobellviridae → Cobavirinae → Veravirus | 541 | Open in IMG/M |
| 3300025653|Ga0208428_1109152 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-2 | 773 | Open in IMG/M |
| 3300025671|Ga0208898_1008466 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5353 | Open in IMG/M |
| 3300025687|Ga0208019_1198655 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Zobellviridae → Cobavirinae → Siovirus | 526 | Open in IMG/M |
| 3300025759|Ga0208899_1023195 | Not Available | 3055 | Open in IMG/M |
| 3300025759|Ga0208899_1216080 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Zobellviridae → Cobavirinae → Siovirus | 597 | Open in IMG/M |
| 3300025767|Ga0209137_1035988 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-13 | 2558 | Open in IMG/M |
| 3300025853|Ga0208645_1085285 | Not Available | 1355 | Open in IMG/M |
| 3300025889|Ga0208644_1040809 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Zobellviridae → Cobavirinae → Siovirus | 2668 | Open in IMG/M |
| 3300026097|Ga0209953_1026592 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Zobellviridae → Cobavirinae → Siovirus | 957 | Open in IMG/M |
| 3300026197|Ga0209925_1242393 | Not Available | 511 | Open in IMG/M |
| 3300027215|Ga0208166_1030227 | Not Available | 626 | Open in IMG/M |
| 3300027219|Ga0208167_1057377 | Not Available | 653 | Open in IMG/M |
| 3300027612|Ga0209037_1008655 | All Organisms → Viruses → Predicted Viral | 2615 | Open in IMG/M |
| 3300027753|Ga0208305_10119622 | Not Available | 978 | Open in IMG/M |
| 3300027758|Ga0209379_10032411 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2085 | Open in IMG/M |
| 3300027828|Ga0209692_10007058 | Not Available | 9105 | Open in IMG/M |
| 3300027845|Ga0209271_10296372 | Not Available | 647 | Open in IMG/M |
| 3300027917|Ga0209536_102139329 | Not Available | 668 | Open in IMG/M |
| 3300028361|Ga0306872_117703 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 971 | Open in IMG/M |
| 3300028370|Ga0306871_1061068 | Not Available | 602 | Open in IMG/M |
| 3300031589|Ga0307996_1001603 | Not Available | 6161 | Open in IMG/M |
| 3300031700|Ga0302130_1003393 | Not Available | 6818 | Open in IMG/M |
| 3300032277|Ga0316202_10123106 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1202 | Open in IMG/M |
| 3300034374|Ga0348335_117589 | Not Available | 795 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 43.75% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 6.25% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 5.36% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 4.46% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 4.46% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 3.57% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.57% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.68% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.68% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 2.68% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 1.79% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.79% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.79% |
| Marine Water | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Water | 1.79% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 1.79% |
| Pond Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Pond Soil | 1.79% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 1.79% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.89% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.89% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.89% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.89% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.89% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.89% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.89% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.89% |
| Hypersaline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline Water | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000949 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94 | Host-Associated | Open in IMG/M |
| 3300003617 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNA | Environmental | Open in IMG/M |
| 3300003908 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_125SG_5_DNA | Environmental | Open in IMG/M |
| 3300004829 | Marine water microbial communities from the Pohang Bay, Korea with extracellular vesicles - Pohang-EVs | Environmental | Open in IMG/M |
| 3300005588 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.1 | Environmental | Open in IMG/M |
| 3300005590 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 | Environmental | Open in IMG/M |
| 3300005747 | Seawater microbial communities from Vineyard Sound, MA, USA - control T14 | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007023 | Non-marine hypersaline water viral communities from Mallorca, Spain, 2014 - E1 T9 | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007537 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_A_D1_MG | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007609 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_H2O_MG | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
| 3300009080 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
| 3300009434 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 | Environmental | Open in IMG/M |
| 3300009438 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300011188 | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 1 #563 | Environmental | Open in IMG/M |
| 3300012269 | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Hop E1 #497 | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018413 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018415 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
| 3300021378 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131 | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022050 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v3) | Environmental | Open in IMG/M |
| 3300022061 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2) | Environmental | Open in IMG/M |
| 3300022169 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022176 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022183 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3) | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022308 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300024319 | Seawater microbial communities from Monterey Bay, California, United States - 85D | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024520 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_1 | Environmental | Open in IMG/M |
| 3300025276 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025620 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025767 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300026097 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026197 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_A_D1_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300027215 | Estuarine microbial communities from the Columbia River estuary - metaG 1546C-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027219 | Estuarine microbial communities from the Columbia River estuary - metaG 1546A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027612 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_125SG_5_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027753 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 (SPAdes) | Environmental | Open in IMG/M |
| 3300027758 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027828 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027845 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300028361 | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Hop E1 #498 (v2) | Environmental | Open in IMG/M |
| 3300028370 | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Hop E1 #497 (v2) | Environmental | Open in IMG/M |
| 3300031589 | Marine microbial communities from David Island wharf, Antarctic Ocean - #35 | Environmental | Open in IMG/M |
| 3300031700 | Marine microbial communities from Western Arctic Ocean, Canada - CB9_surface | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| BBAY94_100395596 | 3300000949 | Macroalgal Surface | MKWTDDMIREYFDSHWSATLHEICALSGRTKKEVK |
| BBAY94_101156721 | 3300000949 | Macroalgal Surface | MKAWTDEMVKEYFDTHWDVTIHQLCALSMRSKDDIKRILMER* |
| JGI26082J51739_101087601 | 3300003617 | Marine | MFAKWTDDMVRDYFDTRWNATLHEICALSGRTKADVKRVLMGG* |
| JGI26085J52751_10241452 | 3300003908 | Marine | MTFAKWTDDMVRDYFDTHWNATLHEICALSGRTKADLKRVLMEG* |
| Ga0068515_1185002 | 3300004829 | Marine Water | MTFAKWSDDMIREYFDTHWNATIHEISALSGRTKADIKRVLMGES* |
| Ga0068515_1210932 | 3300004829 | Marine Water | MALEDETMKPWTDDMVREYFDTHWDVTIHQICALSMRSKADVKRILMEG* |
| Ga0070728_100387726 | 3300005588 | Marine Sediment | MKWSDDMIREYFDTHWNATLHEICALSGRTKAEVKRALMRESA* |
| Ga0070727_100963224 | 3300005590 | Marine Sediment | MKWSDDMIREYFDTHWNATLHEICALSGRTRADVKRALMRGNA* |
| Ga0076924_10660434 | 3300005747 | Marine | MLIWTDDMVREYFDTHLNATLHEICALSGRNKADVKRVLMEE* |
| Ga0070743_101004524 | 3300005941 | Estuarine | MFAKWTDDMVRDYFDTHWNATLHEVCALSGRSKADVKQVLMEG* |
| Ga0075474_100103923 | 3300006025 | Aqueous | MFAKWTDEMIREYFDSHWDATIHEVCALSGRTKAEVKRALMQGSKT* |
| Ga0075474_100417124 | 3300006025 | Aqueous | MKRWTDEMVREYFDTHWNATIHEICALSGRTKADVKRVLMEQE* |
| Ga0075474_100871545 | 3300006025 | Aqueous | MKRWTDEMVREYFDTHWNATIHEICALSGRTKADVKRILMEQE* |
| Ga0075474_102284643 | 3300006025 | Aqueous | MKRWTDEMVREYFDTHWNATIHEICALSGRTKADVKRIL |
| Ga0075462_100827382 | 3300006027 | Aqueous | MLIWTDDMVREYFDTHLNATLHEICALSGRNRADVKRVLMEE* |
| Ga0075466_11303632 | 3300006029 | Aqueous | MTMATWTDDMIIEYFDTHINATIHEICALSGRRRADVKRVLMGG* |
| Ga0075466_11671142 | 3300006029 | Aqueous | MFAKWTDDMVRDYFDTHWNATLHEVCALSGRNKSDVKRALMEG* |
| Ga0075461_100835561 | 3300006637 | Aqueous | MFAKWTDEMIREYFDSHWDATIHEVCALSGRTKAEVK |
| Ga0070749_100178793 | 3300006802 | Aqueous | MFAKWTDEMVREYFDTHWNATLHEICALSGRTKADVKRVLMEG* |
| Ga0070749_101784024 | 3300006802 | Aqueous | MFAKWTDEMVREYFDTHWNATLHEICALSGRTKADVQ |
| Ga0070749_104047472 | 3300006802 | Aqueous | MKAWTDEMVKEYFDTHWDVTIHQLCALSMRSKADVKRILMER* |
| Ga0070749_104900512 | 3300006802 | Aqueous | MAKWTDDMVREYFDTHWNATIHQICALSGRSKADVKRVLMEG* |
| Ga0070754_101458943 | 3300006810 | Aqueous | MFAKWTDDMIREYFDSHWDATIHEVCALSGRTKAEVKRALMQGSKT* |
| Ga0070754_101606982 | 3300006810 | Aqueous | MFAKWTDDMIREYFDTHLNATIHEICALSGRTKAEVKRALMQGSKT* |
| Ga0070754_102667692 | 3300006810 | Aqueous | MFAKWTDEMIREYFDSHWNATIHEICALSGRTKADVKRALMVQSK* |
| Ga0070754_103299701 | 3300006810 | Aqueous | MFAKWTDEMVREYFDTHWNATLHEICALSGRTKADVKRVLMGG* |
| Ga0075481_101809222 | 3300006868 | Aqueous | MKRWTDEMVREYFDTHWNATIHEICALSGRTKADVKRILMEQG* |
| Ga0080109_1052322 | 3300007023 | Hypersaline Water | MSHWTDDMIREYFDTHWNATIHEICALSGRSKAEVKRALMQK* |
| Ga0070745_11122033 | 3300007344 | Aqueous | MFAKWTDEMVREYFDTHWNATLHEICALSGRTKADVKRVLMGD* |
| Ga0070752_10049451 | 3300007345 | Aqueous | NVMFAKWTDEMVREYFDTHWNATLHEICALSGRTKADVKRVLMGG* |
| Ga0102934_10568382 | 3300007537 | Pond Soil | MNRWTDDMIREYFDTHWNATIHEICALSGRTKAEVKRALMQGAG* |
| Ga0099851_10446405 | 3300007538 | Aqueous | MKKWTDDMVREYFDTHWNVTIHTLCALSGRSKADVKAILLEA* |
| Ga0099851_11070114 | 3300007538 | Aqueous | MFAKWTDDMVRDYFDTHWNATLHEVCALSGRNKTDVKSVLMEGTDT* |
| Ga0099851_13580672 | 3300007538 | Aqueous | MFAKWTDDMVRDYFDTHWNATLHEVCALSGRNKLDVKSVLMEGADT* |
| Ga0099848_10413484 | 3300007541 | Aqueous | MFAKWNDDMIREYFDTHWNATIHEICALSGRTKADVKRALMVQSK* |
| Ga0099848_13128661 | 3300007541 | Aqueous | MTFVKWTDDMVRDYFDTHWNATLHEICALSGRTKADVKRV |
| Ga0099848_13408502 | 3300007541 | Aqueous | MTFAKWTDDMVRDYFDTHWNATLHEICALSGRTKADVKRVLMEG* |
| Ga0099846_10159992 | 3300007542 | Aqueous | MNIWTDDMIREYFDSNWNVTIHQICALSGRTKADVKAVLMGGK* |
| Ga0102945_10116123 | 3300007609 | Pond Water | MTFAKWTDDMVREYFDTHWNATLHEICALSGRTKVDIKRVLMEG* |
| Ga0075480_105207733 | 3300008012 | Aqueous | MKRWTDEMVREYFDTHWNATIHEICALSGRTKADVKRILM |
| Ga0102831_12224622 | 3300008996 | Estuarine | MKVWTDEMVREYFDTHWNATLHDICALSGRTKADVKRVLMGG* |
| Ga0102814_101489612 | 3300009079 | Estuarine | MFAKWTDDMIIEYFDTRPFCKWEATIHEICALSGRARTDVKRVLMKG* |
| Ga0102815_100354563 | 3300009080 | Estuarine | MPFAKWTDDMIIEYFDTRPFCKWEATIHEICALSGRARTDVKRVLMKG* |
| Ga0114918_105994661 | 3300009149 | Deep Subsurface | MAHWTDEMIREYFDTHWNATIHEICALSGRTRAEVKRV |
| Ga0114915_10294875 | 3300009428 | Deep Ocean | MFAKWTDDMVRDYFDTHWNATLHEISALSGRTKTDVKLVLMKG* |
| Ga0115562_10537114 | 3300009434 | Pelagic Marine | MLVWTDDMVREYFDTHLNATLHEICALSGRNKADVKRVLMEE* |
| Ga0115559_10988372 | 3300009438 | Pelagic Marine | MTFAKWTDDMVREYFDTHWNATLHEICALSGRTKADLKRVLMEG* |
| Ga0129324_101802783 | 3300010368 | Freshwater To Marine Saline Gradient | LIWTDDMVREYFDTHLNATLHEICALSGRNKADVKRVLMEE* |
| Ga0129324_104109621 | 3300010368 | Freshwater To Marine Saline Gradient | DMVREYFDTHWNATLHEICALSGRSKIDVKRALMEG* |
| Ga0136587_10562942 | 3300011188 | Saline Lake | MARWTDDMIKESFDTNWNATVHQVSALSGRNKADVKRILMGGN* |
| Ga0136587_11946561 | 3300011188 | Saline Lake | VREYFDTNWDATVHQISALSGRNKADIKRILMGGK* |
| Ga0136560_10694251 | 3300012269 | Saline Lake | RWSDDMVREYFDTNWDATVHQISALSGRNKADIKRILMGGK* |
| Ga0160423_104854593 | 3300012920 | Surface Seawater | MKYRLIWTDEMVKEYFDSHLNTTIHEICALSGRTKDEVKNILMEKV* |
| Ga0129327_101121851 | 3300013010 | Freshwater To Marine Saline Gradient | MLIWTDDMVREYFDTHLNATLHEICALSGRNKADVKRV |
| Ga0181565_103631761 | 3300017818 | Salt Marsh | EMVREYFDTHWNATIHEICALSGRTKADVKRVLMEQE |
| Ga0181577_101263254 | 3300017951 | Salt Marsh | MKRWTDEMVREYFDTHWNATIHEICALSGRTKADVKRVLMEQE |
| Ga0181560_101093773 | 3300018413 | Salt Marsh | MKAWTDEMVKEYFDTHWDVTIHQLCALSMRSKADVKRILMER |
| Ga0181559_101432663 | 3300018415 | Salt Marsh | MKAWTDEMVKEYFDTHWDVTIHQLCALSMRSKDDIKRILMER |
| Ga0181563_1001213212 | 3300018420 | Salt Marsh | MFAKWTDDMVREYFDTHLNATLHEICALSGRSKIDVKRALMEG |
| Ga0181563_100434794 | 3300018420 | Salt Marsh | MKKWTDQMICEYFDTHWYATIHTICALSGRTKSDVKRVLMGGK |
| Ga0181591_108696494 | 3300018424 | Salt Marsh | MKRWTDEMVREYFDTHWNATIHEICALSGRTKADVKRVLM |
| Ga0206677_102583774 | 3300021085 | Seawater | MEIWTDNMVREYFDTHWNVTIHELCTLSGLKKSDVKRALMKG |
| Ga0213861_100663163 | 3300021378 | Seawater | MLKQWTDDMVKEYFDTHWGATIHHICALSGRKRADVVAILLGGK |
| Ga0222718_100403843 | 3300021958 | Estuarine Water | MTLAKWTDDMVRDYFDTHWNATLHEICALSGRTKADVKRVLMEG |
| Ga0222718_100537212 | 3300021958 | Estuarine Water | MVKWTDDMVREYFDTHWNATLHEVCAYSGRTKADVKRVLMEG |
| Ga0222715_105704571 | 3300021960 | Estuarine Water | MFAKWTDEMVREYFDTHWNATLHEICALSGRTKADVK |
| Ga0222719_106540672 | 3300021964 | Estuarine Water | MNKIEFAKWTDEMVREYFDTHWNATLHEICALSGRTKADVKRVLMGK |
| Ga0196883_10373172 | 3300022050 | Aqueous | MFAKWTDEMIREYFDSHWDATIHEVCALSGRTKAEVKRALMQGSKT |
| Ga0212023_10052304 | 3300022061 | Aqueous | MFAKWTDDMVRDYFDTHWNATLHEVCALSGRNKSDVKRALMEG |
| Ga0196903_10245002 | 3300022169 | Aqueous | MLIWTDDMVREYFDTHLNATLHEICALSGRNKADVKRVLMEE |
| Ga0212031_10192243 | 3300022176 | Aqueous | MTFAKWTDDMVRDYFDTHWNATLHEICALSGRTKADVKRVLMEG |
| Ga0196891_100201013 | 3300022183 | Aqueous | MLIWTDDMVREYFDTHLNATLHEICALSGRNRADVKRVLMEE |
| Ga0196905_10233512 | 3300022198 | Aqueous | MFAKWTDDMVREYFDTHWNATLHEICALSGRTKADVKRVLMGG |
| Ga0196901_10209878 | 3300022200 | Aqueous | MNIWTDDMIREYFDSNWNVTIHQICALSGRTKADVKAVLMGGK |
| Ga0196901_10907103 | 3300022200 | Aqueous | MFAKWTDDMVRDYFDTHWNATLHEVCALSGRNKTDVKSVLMEGTDT |
| Ga0196901_11369282 | 3300022200 | Aqueous | MKKWTDDMVREYFDTHWNVTIHTLCALSGRSKADVKAILLEA |
| Ga0224504_100563623 | 3300022308 | Sediment | MFAKWTDDMVRDYFDTHWNATLHEICALSGRTKADVKRVLMEG |
| Ga0228670_10267105 | 3300024319 | Seawater | MFAKWTDDMVRDYFDTHWNATLHEISALSGRTKADVKRVLMEG |
| Ga0244775_100461006 | 3300024346 | Estuarine | MFAKWTDDMVRDYFDTHWNATLHEVCALSGRSKADVKQVLMEG |
| Ga0244775_102932683 | 3300024346 | Estuarine | MKVWTDEMVREYFDTHWNATLHDICALSGRTKADVKRVLMGG |
| (restricted) Ga0255047_1001458112 | 3300024520 | Seawater | MKWTDDMLKEYFDTHWNATIHEICALSGRTKADIKRILMGGK |
| Ga0208814_10153204 | 3300025276 | Deep Ocean | MFAKWTDDMVRDYFDTHWNATLHEICALSGRTKTDVKLVLMKG |
| Ga0208303_10015117 | 3300025543 | Aqueous | MMKWSDEIVKEYFDTHWNVTIHQLCALSGRTKVDVKRILMESK |
| Ga0208149_10190603 | 3300025610 | Aqueous | MKRWTDEMVREYFDTHWNATIHEICALSGRTKADVKRILMEQE |
| Ga0208149_11174191 | 3300025610 | Aqueous | TRARHNKMKRWTDEMVREYFDTHWNATIHEICALSGRTKADVKRVLMEQE |
| Ga0209405_11132062 | 3300025620 | Pelagic Marine | MLVWTDDMVREYFDTHLNATLHEICALSGRNKADVKRVLMEE |
| Ga0208643_10715093 | 3300025645 | Aqueous | MTMATWTDDMIIEYFDTHINATIHEICALSGRRRADVKRVLMGG |
| Ga0208134_11665641 | 3300025652 | Aqueous | DDMVREYFDTHWNATLHEICALSGRSKVDVKRALMEG |
| Ga0208428_11091523 | 3300025653 | Aqueous | MKRWTDEMVREYFDTHWNATIHEICALSGRTKADVKRILMEQG |
| Ga0208898_10084661 | 3300025671 | Aqueous | MFAKWTDEMVREYFDTHWNATLHEICALSGRTKADVKRVLMGG |
| Ga0208019_11986552 | 3300025687 | Aqueous | MFAKWTDDMVREYFDTHWNATLHEICALSGRTKADVKRALMGG |
| Ga0208899_10231951 | 3300025759 | Aqueous | MFAKWTDEMIREYFDSHWDATIHEVCALSGRTKAEVKRALMQG |
| Ga0208899_12160803 | 3300025759 | Aqueous | MFAKWTDEMVREYFDTHWNATLHEICALSGRTKADVKRVLLEG |
| Ga0209137_10359885 | 3300025767 | Marine | MFAKWTDDMVRDYFDTRWNATLHEICALSGRTKADVKRVLMGG |
| Ga0208645_10852852 | 3300025853 | Aqueous | MFAKWTDEMIREYFDSHWNATIHEICALSGRTKADVKRALMVQSK |
| Ga0208644_10408091 | 3300025889 | Aqueous | MFAKWTDEMVREYFDTHWNATLHEICALSGRTKADVKRVLMEG |
| Ga0209953_10265922 | 3300026097 | Pond Water | MTFAKWTDDMVREYFDTHWNATLHEICALSGRTKVDIKRVLMEG |
| Ga0209925_12423931 | 3300026197 | Pond Soil | MNRWTDDMIREYFDTHWNATIHEICALSGRTKAEVKRALMQGAG |
| Ga0208166_10302271 | 3300027215 | Estuarine | MFAKWTDDMVRDYFDTHWNATLHEVCALSGRNKSDVKSV |
| Ga0208167_10573773 | 3300027219 | Estuarine | MFAKWTDDMVRDYFDTHWNATLHEVCALSGRNKSD |
| Ga0209037_10086556 | 3300027612 | Marine | MTFAKWTDDMVRDYFDTHWNATLHEICALSGRTKADLKRVLMEG |
| Ga0208305_101196222 | 3300027753 | Estuarine | MFAKWTDDMIIEYFDTRPFCKWEATIHEICALSGRARTDVKRVLMKG |
| Ga0209379_100324113 | 3300027758 | Marine Sediment | MKWSDDMIREYFDTHWNATLHEICALSGRTRADVKRA |
| Ga0209692_100070586 | 3300027828 | Marine Sediment | MKWSDDMIREYFDTHWNATLHEICALSGRTKAEVKRALMRESA |
| Ga0209271_102963722 | 3300027845 | Marine Sediment | MKWSDDMIREYFDTHWNATLHEICALSGRTRADVKRAL |
| Ga0209536_1021393292 | 3300027917 | Marine Sediment | MFAKWTDDMIREYFDSHWDATIHEICALSGRTKAEVKRALMQGSKT |
| Ga0306872_1177032 | 3300028361 | Saline Lake | MARWTDDMIKESFDTNWNATVHQVSALSGRNKADVKRILMGGN |
| Ga0306871_10610681 | 3300028370 | Saline Lake | MVREYFDTNWDATVHQISALSGRNKADIKRILMGGK |
| Ga0307996_10016032 | 3300031589 | Marine | MFAKWKDDMVRDYFDTHWNATLHEICALSGRTKADVKRVLMKG |
| Ga0302130_100339312 | 3300031700 | Marine | MKKWTDDMVRDYFDAHLNTTLHELGAYSGRTRADLKRILMAPQKPRD |
| Ga0316202_101231064 | 3300032277 | Microbial Mat | MNMATWTDDMIIEYFDTHINATIHEICALSGRRRADVKRVLMGG |
| Ga0348335_117589_93_233 | 3300034374 | Aqueous | MFAKWTDDMIREYFDTHLNATIHEICALSGRTKAEVKRALMQGSKT |
| ⦗Top⦘ |