


| Basic Information | |
|---|---|
| Family ID | F084054 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 112 |
| Average Sequence Length | 43 residues |
| Representative Sequence | HAYRLDGVHRGYIGGMLLEKFYNRGWVDYVLLVLTLHRAASR |
| Number of Associated Samples | 85 |
| Number of Associated Scaffolds | 112 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.89 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 91.96 % |
| Associated GOLD sequencing projects | 78 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.964 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (45.536 % of family members) |
| Environment Ontology (ENVO) | Unclassified (55.357 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.571 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.29% β-sheet: 0.00% Coil/Unstructured: 55.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 112 Family Scaffolds |
|---|---|---|
| PF13561 | adh_short_C2 | 10.71 |
| PF01053 | Cys_Met_Meta_PP | 4.46 |
| PF16326 | ABC_tran_CTD | 3.57 |
| PF11154 | DUF2934 | 1.79 |
| PF00313 | CSD | 1.79 |
| PF00072 | Response_reg | 0.89 |
| PF00106 | adh_short | 0.89 |
| PF12872 | OST-HTH | 0.89 |
| PF13489 | Methyltransf_23 | 0.89 |
| PF00078 | RVT_1 | 0.89 |
| PF13610 | DDE_Tnp_IS240 | 0.89 |
| PF13439 | Glyco_transf_4 | 0.89 |
| PF09917 | DUF2147 | 0.89 |
| PF02371 | Transposase_20 | 0.89 |
| PF04794 | YdjC | 0.89 |
| PF12900 | Pyridox_ox_2 | 0.89 |
| PF00296 | Bac_luciferase | 0.89 |
| PF07589 | PEP-CTERM | 0.89 |
| PF13751 | DDE_Tnp_1_6 | 0.89 |
| PF08241 | Methyltransf_11 | 0.89 |
| PF00689 | Cation_ATPase_C | 0.89 |
| PF13924 | Lipocalin_5 | 0.89 |
| PF13495 | Phage_int_SAM_4 | 0.89 |
| COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
|---|---|---|---|
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 4.46 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 4.46 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 4.46 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 4.46 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 4.46 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 4.46 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 4.46 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 4.46 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 4.46 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 4.46 |
| COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 4.46 |
| COG0474 | Magnesium-transporting ATPase (P-type) | Inorganic ion transport and metabolism [P] | 0.89 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.89 |
| COG3394 | Chitooligosaccharide deacetylase ChbG, YdjC/CelG family | Carbohydrate transport and metabolism [G] | 0.89 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.96 % |
| Unclassified | root | N/A | 8.04 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005556|Ga0066707_10190418 | Not Available | 1319 | Open in IMG/M |
| 3300005764|Ga0066903_102698247 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 963 | Open in IMG/M |
| 3300006028|Ga0070717_10288989 | All Organisms → cellular organisms → Bacteria | 1455 | Open in IMG/M |
| 3300006028|Ga0070717_12106163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 507 | Open in IMG/M |
| 3300006755|Ga0079222_12334628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 534 | Open in IMG/M |
| 3300007788|Ga0099795_10199228 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300009088|Ga0099830_11153853 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300009089|Ga0099828_10052698 | All Organisms → cellular organisms → Bacteria | 3383 | Open in IMG/M |
| 3300009444|Ga0114945_10299745 | Not Available | 946 | Open in IMG/M |
| 3300010048|Ga0126373_12914249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 534 | Open in IMG/M |
| 3300010048|Ga0126373_12977505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 528 | Open in IMG/M |
| 3300010359|Ga0126376_12968862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 524 | Open in IMG/M |
| 3300010361|Ga0126378_13016347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 536 | Open in IMG/M |
| 3300010361|Ga0126378_13451670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 501 | Open in IMG/M |
| 3300010362|Ga0126377_12302594 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 615 | Open in IMG/M |
| 3300010362|Ga0126377_13536585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 505 | Open in IMG/M |
| 3300010366|Ga0126379_10119635 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2389 | Open in IMG/M |
| 3300010376|Ga0126381_101039241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1183 | Open in IMG/M |
| 3300010376|Ga0126381_101084573 | All Organisms → cellular organisms → Bacteria | 1157 | Open in IMG/M |
| 3300011120|Ga0150983_12823483 | Not Available | 682 | Open in IMG/M |
| 3300012202|Ga0137363_10309226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1299 | Open in IMG/M |
| 3300012205|Ga0137362_11107174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 673 | Open in IMG/M |
| 3300012357|Ga0137384_11045480 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300012361|Ga0137360_11453428 | Not Available | 589 | Open in IMG/M |
| 3300012929|Ga0137404_10923896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 796 | Open in IMG/M |
| 3300016270|Ga0182036_10383513 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
| 3300016294|Ga0182041_11499392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 621 | Open in IMG/M |
| 3300016294|Ga0182041_12325471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300016319|Ga0182033_10803879 | Not Available | 829 | Open in IMG/M |
| 3300016319|Ga0182033_11769210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 560 | Open in IMG/M |
| 3300016341|Ga0182035_12067506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 518 | Open in IMG/M |
| 3300016371|Ga0182034_11477158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 595 | Open in IMG/M |
| 3300016404|Ga0182037_10392535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1141 | Open in IMG/M |
| 3300016404|Ga0182037_11495535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 599 | Open in IMG/M |
| 3300016404|Ga0182037_11653917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 570 | Open in IMG/M |
| 3300016422|Ga0182039_12178714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 511 | Open in IMG/M |
| 3300016445|Ga0182038_11245722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 664 | Open in IMG/M |
| 3300020580|Ga0210403_10433628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila | 1071 | Open in IMG/M |
| 3300020580|Ga0210403_10663031 | Not Available | 838 | Open in IMG/M |
| 3300020580|Ga0210403_10733685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 789 | Open in IMG/M |
| 3300020581|Ga0210399_10884200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 725 | Open in IMG/M |
| 3300020583|Ga0210401_10612366 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300021168|Ga0210406_11377676 | Not Available | 504 | Open in IMG/M |
| 3300021178|Ga0210408_10344073 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1189 | Open in IMG/M |
| 3300021178|Ga0210408_10524836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila | 940 | Open in IMG/M |
| 3300021404|Ga0210389_10484061 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300021432|Ga0210384_10243212 | All Organisms → cellular organisms → Bacteria | 1620 | Open in IMG/M |
| 3300021432|Ga0210384_10466955 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
| 3300021432|Ga0210384_10885759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila | 792 | Open in IMG/M |
| 3300021478|Ga0210402_11735702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 550 | Open in IMG/M |
| 3300021560|Ga0126371_13242653 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 550 | Open in IMG/M |
| 3300026551|Ga0209648_10136143 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1960 | Open in IMG/M |
| 3300027610|Ga0209528_1127061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 561 | Open in IMG/M |
| 3300027616|Ga0209106_1034652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1118 | Open in IMG/M |
| 3300028047|Ga0209526_10019513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4720 | Open in IMG/M |
| 3300028047|Ga0209526_10832860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 568 | Open in IMG/M |
| 3300029636|Ga0222749_10117286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila | 1267 | Open in IMG/M |
| 3300031128|Ga0170823_16263900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 685 | Open in IMG/M |
| 3300031231|Ga0170824_118785137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 705 | Open in IMG/M |
| 3300031543|Ga0318516_10770772 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 544 | Open in IMG/M |
| 3300031546|Ga0318538_10001506 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7511 | Open in IMG/M |
| 3300031546|Ga0318538_10084760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1614 | Open in IMG/M |
| 3300031549|Ga0318571_10240224 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 662 | Open in IMG/M |
| 3300031564|Ga0318573_10719476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 536 | Open in IMG/M |
| 3300031572|Ga0318515_10697984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 537 | Open in IMG/M |
| 3300031679|Ga0318561_10815088 | Not Available | 513 | Open in IMG/M |
| 3300031681|Ga0318572_10224426 | All Organisms → cellular organisms → Bacteria | 1101 | Open in IMG/M |
| 3300031681|Ga0318572_10396613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 820 | Open in IMG/M |
| 3300031708|Ga0310686_107653137 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 661 | Open in IMG/M |
| 3300031719|Ga0306917_11000170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 653 | Open in IMG/M |
| 3300031724|Ga0318500_10018078 | All Organisms → cellular organisms → Bacteria | 2643 | Open in IMG/M |
| 3300031736|Ga0318501_10462242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 689 | Open in IMG/M |
| 3300031768|Ga0318509_10318594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 870 | Open in IMG/M |
| 3300031771|Ga0318546_10511117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 843 | Open in IMG/M |
| 3300031780|Ga0318508_1223529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 540 | Open in IMG/M |
| 3300031795|Ga0318557_10202889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 905 | Open in IMG/M |
| 3300031795|Ga0318557_10376406 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 652 | Open in IMG/M |
| 3300031796|Ga0318576_10261044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 817 | Open in IMG/M |
| 3300031799|Ga0318565_10284989 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 803 | Open in IMG/M |
| 3300031819|Ga0318568_10900327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 547 | Open in IMG/M |
| 3300031859|Ga0318527_10530181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300031879|Ga0306919_10224465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_02_64_14 | 1405 | Open in IMG/M |
| 3300031893|Ga0318536_10192244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1039 | Open in IMG/M |
| 3300031894|Ga0318522_10292619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 617 | Open in IMG/M |
| 3300031910|Ga0306923_10079619 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3670 | Open in IMG/M |
| 3300031912|Ga0306921_12024922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 612 | Open in IMG/M |
| 3300031941|Ga0310912_10341825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1161 | Open in IMG/M |
| 3300031941|Ga0310912_10817302 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300031942|Ga0310916_11403418 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300031945|Ga0310913_10126155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1751 | Open in IMG/M |
| 3300031945|Ga0310913_10421307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 947 | Open in IMG/M |
| 3300031945|Ga0310913_10761569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 683 | Open in IMG/M |
| 3300031947|Ga0310909_10047289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3286 | Open in IMG/M |
| 3300031954|Ga0306926_10996205 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 997 | Open in IMG/M |
| 3300032001|Ga0306922_10155188 | All Organisms → cellular organisms → Bacteria | 2449 | Open in IMG/M |
| 3300032041|Ga0318549_10190312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 920 | Open in IMG/M |
| 3300032042|Ga0318545_10012892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2559 | Open in IMG/M |
| 3300032051|Ga0318532_10212442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 686 | Open in IMG/M |
| 3300032059|Ga0318533_10779569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 702 | Open in IMG/M |
| 3300032059|Ga0318533_10904075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 648 | Open in IMG/M |
| 3300032064|Ga0318510_10123691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1003 | Open in IMG/M |
| 3300032065|Ga0318513_10207931 | Not Available | 944 | Open in IMG/M |
| 3300032068|Ga0318553_10648759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 552 | Open in IMG/M |
| 3300032076|Ga0306924_10548619 | All Organisms → cellular organisms → Bacteria | 1312 | Open in IMG/M |
| 3300032076|Ga0306924_11533130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 705 | Open in IMG/M |
| 3300032076|Ga0306924_11845606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 628 | Open in IMG/M |
| 3300032076|Ga0306924_12225391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 558 | Open in IMG/M |
| 3300032205|Ga0307472_101651406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 631 | Open in IMG/M |
| 3300032261|Ga0306920_101522120 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 954 | Open in IMG/M |
| 3300032261|Ga0306920_103265171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 605 | Open in IMG/M |
| 3300032261|Ga0306920_103987357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 536 | Open in IMG/M |
| 3300034820|Ga0373959_0218136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 510 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 45.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 22.32% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.82% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.14% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.46% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.79% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.79% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.89% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.89% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.89% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0066707_101904181 | 3300005556 | Soil | HAYRLDGVHQGYIGGILLEKFYNRGWVDYVLLVLTLHRAASR* |
| Ga0066903_1026982472 | 3300005764 | Tropical Forest Soil | DEECDRLLRAYKRDGAHRGYIGGMLLEKFYNRGWVDYVLLVLKPHRIASR* |
| Ga0070717_102889892 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LHAYRLDGVHRGYIGGMLLEKFYNRGWVDYVLLVLTLHRAANR* |
| Ga0070717_121061631 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LDGVHRGYIGGMLLEKFYNRGWVDYVLLVLTLHRAASR* |
| Ga0079222_123346281 | 3300006755 | Agricultural Soil | LLHAYHPDRVHRGYIGGMLLEKFYNRGWVDYVLLVLTPHRAASR* |
| Ga0099795_101992282 | 3300007788 | Vadose Zone Soil | DEECDRLLHAYHLDGVHQGYIGGMLLEKFYNREWVDYILLVLTLHGAASR* |
| Ga0099830_111538532 | 3300009088 | Vadose Zone Soil | LDGVHRGYIGGMLLEKFYNRGWVDYALLVLTLHRAASR* |
| Ga0099828_100526981 | 3300009089 | Vadose Zone Soil | HLDGVHQGYVGGMLLEKFYNRGWVDYALLVLTLHRAASR* |
| Ga0114945_102997452 | 3300009444 | Thermal Springs | LLQAYQQHGAHPGYIDGMLLEKFYNRQWVDYVLMVLR* |
| Ga0126373_129142491 | 3300010048 | Tropical Forest Soil | AYHLDAVHQGYIGGMLLEKFYNRGWVDYVLLVLTPRRAASR* |
| Ga0126373_129775051 | 3300010048 | Tropical Forest Soil | RPDEECDRLLHAYQLDGVHRGYIGGMLLEKFYNRGWVDYVLLVLTPYPSSSR* |
| Ga0126376_129688621 | 3300010359 | Tropical Forest Soil | RLAHAYQLHGAHRGYIGGMLLEKFYNRGWVDYVLLVLTPHRAASR* |
| Ga0126378_130163472 | 3300010361 | Tropical Forest Soil | DGVHRGYIGGMLLEKFYNRGWVDYVLLALTPHRAA* |
| Ga0126378_134516701 | 3300010361 | Tropical Forest Soil | LDGVHPGYIGGMLLEKFYNRGWVDYVLLVLTPHRAAGR* |
| Ga0126377_123025941 | 3300010362 | Tropical Forest Soil | SYQIDGAYRDYAGEMPLEKFYNRGWVDCVLLVLTPHRAVSR* |
| Ga0126377_135365852 | 3300010362 | Tropical Forest Soil | CDRLLHAYQLDGVHRGYIGGMLLEKFYNRGWVDYVLLVLTRPRAASR* |
| Ga0126379_101196354 | 3300010366 | Tropical Forest Soil | DRLVHAYQLRGAHRGYIGGMLLEKFYNRGWVDYVLLVLTPHRAAGR* |
| Ga0126381_1010392412 | 3300010376 | Tropical Forest Soil | VHQGYIGGMLLEKFYNRGWVDYVLIVLTPHRAASR* |
| Ga0126381_1010845734 | 3300010376 | Tropical Forest Soil | PDEECDRLLHEYQLDGVHRGYIGGMLLEKFYNRGWVDYVLVVLRPHRAASR* |
| Ga0150983_128234832 | 3300011120 | Forest Soil | AYHLDGVHQGYIGGMLLEKFYNRGWVDYVMLVLTLRRAASR* |
| Ga0137363_103092263 | 3300012202 | Vadose Zone Soil | YRLDGVHRGYIGGMLLEKFYNRGWVDYVLLVLTPHRAASR* |
| Ga0137362_111071742 | 3300012205 | Vadose Zone Soil | HAYRLDGVHRGYIGGMLLEKFYNRGWVDYVLLVLTLHRATSR* |
| Ga0137384_110454801 | 3300012357 | Vadose Zone Soil | DRLVHAYQLHGAHRGYIGGMLLEKFYNRGWVDYVLLVLTPHRAASR* |
| Ga0137360_114534281 | 3300012361 | Vadose Zone Soil | HAYHLDGVHQGYIGGMLLEKFYNRGWVDYVLLVLTLHRAGSR* |
| Ga0137404_109238961 | 3300012929 | Vadose Zone Soil | LLHAYRLDGVHRGYIGGMLLEKFYNRGWVDYVLLVLTLHRAASR* |
| Ga0182036_103835131 | 3300016270 | Soil | STGVHRGYIGGMLLEKFYNRGWVDYVLLVLTLHRAASR |
| Ga0182041_114993923 | 3300016294 | Soil | DGVHQGYIGGMLLEKFYNRGWVDYVLFVLTLRRAASR |
| Ga0182041_123254711 | 3300016294 | Soil | RLLHAYQLGDVHRGYIGGMLLEKFYNRGWVDYVLLVLTPHRTARLVAD |
| Ga0182033_108038793 | 3300016319 | Soil | YRVDGVHQGYIGGMLLEKFYNRGWVDYVLLVLTLHRAASR |
| Ga0182033_117692102 | 3300016319 | Soil | YRVDGVHQGYIGGMLLEKFYNRGWVDYVLLVLTLRRAASR |
| Ga0182035_120675061 | 3300016341 | Soil | TRSDEECDRLLHTYRLDGVHQGYIGGMLLEKFYNRGWVDYVLLVLTLHRTASR |
| Ga0182034_114771582 | 3300016371 | Soil | AYQLDGVHRGYIGGMLLEKFYNLGWVDYVLLVLTPHGATSR |
| Ga0182037_103925351 | 3300016404 | Soil | DGVHQGYIGGMLLEKFYNRGWVDYVLLVLTLHRAASR |
| Ga0182037_114955351 | 3300016404 | Soil | DRLLHAYHLDGVHQGYIGGMLLEKFYNRGWVDYVLLVLTRHRAASR |
| Ga0182037_116539171 | 3300016404 | Soil | LVHAYQLDGVHRGYIGGILLEKFYNRGWVDYVLLVLTPHGVTGR |
| Ga0182039_121787142 | 3300016422 | Soil | GVHQGYIGGMLLEKFYNRGWVDYVLLVLTPQRAASC |
| Ga0182038_112457221 | 3300016445 | Soil | GVHRGYIGGMLLEKFYNRGWVDYVLLVLTPNRTASR |
| Ga0210403_104336283 | 3300020580 | Soil | HAYRLDGVHRGYIGGMLLEKFYNRGWVDYVLLVLTLHRAASR |
| Ga0210403_106630311 | 3300020580 | Soil | TRSDEECDRLLHAYRLDGVHWGYIGGMLLEKFYNRGWVDYVLVVLTLHRAASR |
| Ga0210403_107336851 | 3300020580 | Soil | HAYRLDGVHRGYIGGMLLEKFYNRGWVDYVLLVLTLHRAASRRGIAKRE |
| Ga0210399_108842001 | 3300020581 | Soil | VHQGYIGGMLLEKFYNRGWVDYVLLVLTPHRAASR |
| Ga0210401_106123662 | 3300020583 | Soil | LLHAYHLDGVHQGYIGGMLLEKFYNRGWVDYVLVVLTPHRAANR |
| Ga0210406_113776761 | 3300021168 | Soil | HAYNLDGVHQGYVGGMLLEKFYNRGWVDYVLLVLTLHRAANR |
| Ga0210408_103440731 | 3300021178 | Soil | QAYHLDGVHQGYLGRILLEKFYNRGWVDYVLLVLTLHRAASP |
| Ga0210408_105248361 | 3300021178 | Soil | LDGVHRGYIGGMLLEKFYNRGWVDYVLLVLTLHRAASR |
| Ga0210389_104840611 | 3300021404 | Soil | VHWGYIGGMLLEKFYNRGWVDYVLVVLTLHRAASR |
| Ga0210384_102432121 | 3300021432 | Soil | VHQGYIGGMLLEKFYNRGWVDYVLLVLTLHRAASR |
| Ga0210384_104669552 | 3300021432 | Soil | LLHAYRLDGVHRGYIGGMLLEKFYNRGWVDYVLLVLTLHRAASR |
| Ga0210384_108857593 | 3300021432 | Soil | DGVHRGYIGGMLLEKFYNRGWVDYVLLVLTLHRAASR |
| Ga0210402_117357022 | 3300021478 | Soil | LVHAYQRHGVHLGYIGGMLLEKFYNRGWVDYVLLVLAPHRAASR |
| Ga0126371_132426531 | 3300021560 | Tropical Forest Soil | LLRAYKRDGAHRGYIGGMLLEKFYNRGWVDYVLLVLKPHRIASR |
| Ga0209648_101361434 | 3300026551 | Grasslands Soil | SCLSRTKCDRLLHAYHLDGVHQGYIGGMLLEKFYNRGWVDYVLLLLTPHRAASR |
| Ga0209528_11270611 | 3300027610 | Forest Soil | RLLHAYRLDGVHRGYIGGMLLEKFYNRGWVAYVMLVLTLHRAASR |
| Ga0209106_10346521 | 3300027616 | Forest Soil | LLHAYHLHGVHQGYIGGMLLEKFYNRGWVDYVLLVLTPHRAASR |
| Ga0209526_100195131 | 3300028047 | Forest Soil | RLLHAYRLDGVHRGYIGGMLLEKFYNRGWVDYVLLVLTLHRAASR |
| Ga0209526_108328601 | 3300028047 | Forest Soil | RLLHAYRLDGVHRGYIGGMLLEKFYNRGWVDYVMLALTLHRAASR |
| Ga0222749_101172863 | 3300029636 | Soil | GVHRGYIGGMLLEKFYNRGWVDYVLLVLTLHRAASR |
| Ga0170823_162639001 | 3300031128 | Forest Soil | LDGVHQGYIGGMLLEKFYNRGWVDYVLLVLTPHRAGIAKRQ |
| Ga0170824_1187851371 | 3300031231 | Forest Soil | LHTRSDEECDRLLHAYHLDGVHQGYIGGMLLEKFYNRGWVDYVLLVLTPHR |
| Ga0318516_107707721 | 3300031543 | Soil | LHAYLLDGAHRGYIGGMLLEKFYNRGWVDYVLLVLKPHRFASR |
| Ga0318538_100015061 | 3300031546 | Soil | ECDRLLRAYQLDGAHPGYIGGMLLEKFYNREWVDYVLLVLKPHRLASR |
| Ga0318538_100847601 | 3300031546 | Soil | IASTGVHRGYIGGMLLEKFYNRGWVDYVLLVLTLHRAASR |
| Ga0318571_102402242 | 3300031549 | Soil | AHRGYIGGMLLEKFYNRGWVDYVLLVLKPHRFASR |
| Ga0318573_107194762 | 3300031564 | Soil | LLHAYRVDGVHQGYIGGMLLEKFYNRGWVDYVLLVLTLRRAASR |
| Ga0318515_106979841 | 3300031572 | Soil | DGVHQGYIGGMLLEKFYNRGWVDYVLLVLTPHRAASR |
| Ga0318561_108150881 | 3300031679 | Soil | DEECDRLLHAYRRSGVHQGYIGGMLLEKFYNRGWVDYVLLVLTPQRAASC |
| Ga0318572_102244263 | 3300031681 | Soil | ECDRLLHAYQLHGVHRGYIGGLLLEKFYNRGWVDYVLLVLTLCGAASR |
| Ga0318572_103966131 | 3300031681 | Soil | YQLDGVHRRYIGGILLEKFYNRGWVDYVLLVLTPHGVTGR |
| Ga0310686_1076531371 | 3300031708 | Soil | HTRPDEECDRLLHAYQLHGAHRGYIGGLLLEKFYNRGWVDYVLLVLTPHSAAGR |
| Ga0306917_110001701 | 3300031719 | Soil | DEECDRLLHAYHLDGVHQGYIGGMLLEKFYNRGWVDYVLLVLTLHRAASR |
| Ga0318500_100180781 | 3300031724 | Soil | CMRIASTGVHRGYIGGMLLEKFYNRGWVDYVLLVLTLHRAASR |
| Ga0318501_104622421 | 3300031736 | Soil | LLHAYRVDGVHRGYIGGMLLEKFYNRGWVDYVLLVLTLHLAASR |
| Ga0318509_103185941 | 3300031768 | Soil | SDEECDRLLHAYHLDGAHQGYIGGMLVEKFHNRGWVDYVLLVLTLHRTASR |
| Ga0318546_105111172 | 3300031771 | Soil | LLHAYHLDGAHQGYIGGMLVEKFYNRGWVDYVLLVLTLHRTASR |
| Ga0318508_12235291 | 3300031780 | Soil | AYHLDGVHQGYIGGMLLEKFYNRGWVDYVLLVLTLHRAASR |
| Ga0318557_102028893 | 3300031795 | Soil | PDEECDRLAHAYQLHGLHRGYIGGMLLEKFYNRGWVDYVLLVLTPHRPASR |
| Ga0318557_103764061 | 3300031795 | Soil | YQLDGAHPGYIGGMLLEKFYNRDWVDYVLLVLKPHRLASR |
| Ga0318576_102610441 | 3300031796 | Soil | SDEECDHLLHAYRVDGVHQGYIGGMLLEKFYNRGWVDYVLLALTLRRAARR |
| Ga0318565_102849892 | 3300031799 | Soil | LHSAHRGYIGGLLLEKFYNRGWVDYVLLVLTPRGAASR |
| Ga0318568_109003271 | 3300031819 | Soil | HVHTRSDEECGRLLHAYHLDGVHQGYIGGMLLEKFYNRGWVDYVLLVLTPHRAASR |
| Ga0318527_105301811 | 3300031859 | Soil | PTRSDEECDRLLHAYHLDGAHQGYIGGMLVEKFHNRGWVDYVLLVLTLHRTASR |
| Ga0306919_102244652 | 3300031879 | Soil | AYQLHGVHRGYIGGMLLEKFYNRGWVDYVLLVLTPNRTASR |
| Ga0318536_101922442 | 3300031893 | Soil | CGRLLHAYHLDGVHQGYIGGMLLEKFYNRGWVDYVLLVLTPHRAASR |
| Ga0318522_102926192 | 3300031894 | Soil | HAYRVDGVHQGYIGGMLLEKFYNRGWVDYVLLVLTLRRAASR |
| Ga0306923_100796196 | 3300031910 | Soil | ECDRLLHAYHLDGVHQGYIGGMLLEKFYNRGWVDYVLLVLTRHRAASR |
| Ga0306921_120249221 | 3300031912 | Soil | LDGVHQGYIGGMLLEKFYNRGWVDYVLLVLTPHRAASR |
| Ga0310912_103418251 | 3300031941 | Soil | ECGRLLHAYHLDGVHQGYIGGMLLEKFYNRGWVDYVLLVLTPHRAASR |
| Ga0310912_108173022 | 3300031941 | Soil | LHGVHRGYIGGMLLEKFYNRGWVDYVLLVLTPHRTARLVAD |
| Ga0310916_114034182 | 3300031942 | Soil | AYRRSGVHQGYIGGMLLEKFYNRGWVDYVLLVLTPQRAASC |
| Ga0310913_101261551 | 3300031945 | Soil | AYRVDGVHRGYIGGMLLEKFYNRGWVDYVLLVLTLHLAASR |
| Ga0310913_104213073 | 3300031945 | Soil | TRSDEECDRLSHAYRLDGVHRGYIGGILLEKFYNRGWVDYVMLVLTLHRAASR |
| Ga0310913_107615693 | 3300031945 | Soil | TRSDEECDHLLHAYRVDGVHQGYIGGMLLEKFYNRGWVDYVLLVLTLRRAASR |
| Ga0310909_100472895 | 3300031947 | Soil | DRLAHAYQLHGLHRGYIGGMLLEKFYNRGWVDYVLLVLTPHRPASR |
| Ga0306926_109962053 | 3300031954 | Soil | DGAHRGYIGGLLLEKFYNRGWVDYVLLVLTPRGAASR |
| Ga0306922_101551884 | 3300032001 | Soil | AHRGYIGGLLLEKFYNRGWVDYVLLVLTPRGAASR |
| Ga0318549_101903121 | 3300032041 | Soil | VTGVHRGYIGGMLLEKFYNLGWVDYVLLVLTPHGATSR |
| Ga0318545_100128924 | 3300032042 | Soil | VLTRSDEECDRLLHAYRLDGVHRGYIGGMLLEKFYNRGWVDYVLLVLTLHRAASR |
| Ga0318532_102124422 | 3300032051 | Soil | YRLDGVHQGYIGGMLLEKFYNRGWVDYVLLVLTLHRTASR |
| Ga0318533_107795691 | 3300032059 | Soil | YHLDGVHQGYIGGMLLEKFYKRGWVDYVLLVLTPHRAASR |
| Ga0318533_109040751 | 3300032059 | Soil | TRSDEECDRLLHAYRVDGVHQGYIGGMLLEKFYNRGWVDYVLFVLTLRRAASR |
| Ga0318510_101236913 | 3300032064 | Soil | YMRIASTGVHRGYIGGMLLEKFYNRGWVDYVLLVLTLHRAASR |
| Ga0318513_102079311 | 3300032065 | Soil | LLHAYRVDGVHQGYIGGMLLEKFYNRGWVDYVLFVLTLRRAASR |
| Ga0318553_106487592 | 3300032068 | Soil | SDEECDRLLHAYRVDGVHQGYIGGMLLEKFYNRGWVDYVLLVLTLRRAASR |
| Ga0306924_105486193 | 3300032076 | Soil | GAHQGYIGGMLLEKFYNRGWVDYVLLVLTPHRAASG |
| Ga0306924_115331302 | 3300032076 | Soil | DEECDRLLHTYHLDAVHRGYIGGLLLEKFYNRGWVDYVLLVLTPHRAASR |
| Ga0306924_118456061 | 3300032076 | Soil | GVHQGYIGGMLLEKFYNRGWVDYVLLVLTPHRAASR |
| Ga0306924_122253912 | 3300032076 | Soil | HLDGVHQGYIGGMLLEKFYNRGWVDYVLLVLTRHRAASR |
| Ga0307472_1016514061 | 3300032205 | Hardwood Forest Soil | RSEEECDRLLHAYRLDGVHRGYIGGMLLEKFYNRGWVDYVMLVLTLRRAASR |
| Ga0306920_1015221202 | 3300032261 | Soil | LHTYQLHGAHQGYIGGMLLEKFYNRGWVDYVLLVLTPHRAASG |
| Ga0306920_1032651711 | 3300032261 | Soil | DGVHQGYIGGMLLEKFYNRGWVDYVLLALTLRRAARR |
| Ga0306920_1039873571 | 3300032261 | Soil | CDRLLHAYRVDGVHQGYIGGMLLEKFYNREWVDYVLLVLTLHRAASR |
| Ga0373959_0218136_3_140 | 3300034820 | Rhizosphere Soil | RLLHAYQLDGVHRGYIGGMLLEKFYNRGWVDYVLLVLTPHRAAGR |
| ⦗Top⦘ |