


| Basic Information | |
|---|---|
| Family ID | F084031 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 112 |
| Average Sequence Length | 41 residues |
| Representative Sequence | VIRFVLARLLQSLVALAILSVVVFILARATGDPLHLILPMS |
| Number of Associated Samples | 106 |
| Number of Associated Scaffolds | 112 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 55.36 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 93.75 % |
| Associated GOLD sequencing projects | 102 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.107 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (17.857 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.464 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (41.071 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.83% β-sheet: 0.00% Coil/Unstructured: 52.17% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 112 Family Scaffolds |
|---|---|---|
| PF00496 | SBP_bac_5 | 57.14 |
| PF03928 | HbpS-like | 0.89 |
| PF00135 | COesterase | 0.89 |
| COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
|---|---|---|---|
| COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 0.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.11 % |
| Unclassified | root | N/A | 0.89 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2228664021|ICCgaii200_c1000190 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 572 | Open in IMG/M |
| 3300000564|RepKanNP_BrdU_F12BDRAFT_1000814 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1953 | Open in IMG/M |
| 3300001139|JGI10220J13317_10196267 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300002558|JGI25385J37094_10045475 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1492 | Open in IMG/M |
| 3300004479|Ga0062595_100970340 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 726 | Open in IMG/M |
| 3300005167|Ga0066672_10399601 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 899 | Open in IMG/M |
| 3300005174|Ga0066680_10554700 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300005174|Ga0066680_10587025 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 699 | Open in IMG/M |
| 3300005184|Ga0066671_10031008 | All Organisms → cellular organisms → Bacteria | 2510 | Open in IMG/M |
| 3300005444|Ga0070694_100679752 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300005445|Ga0070708_102042144 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 530 | Open in IMG/M |
| 3300005468|Ga0070707_100721457 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 960 | Open in IMG/M |
| 3300005536|Ga0070697_100414957 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1169 | Open in IMG/M |
| 3300005540|Ga0066697_10212853 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1148 | Open in IMG/M |
| 3300005544|Ga0070686_100036888 | All Organisms → cellular organisms → Bacteria | 3029 | Open in IMG/M |
| 3300005545|Ga0070695_101187494 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 627 | Open in IMG/M |
| 3300005546|Ga0070696_101936404 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 511 | Open in IMG/M |
| 3300005555|Ga0066692_10961993 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 523 | Open in IMG/M |
| 3300005558|Ga0066698_10403574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 939 | Open in IMG/M |
| 3300005558|Ga0066698_11018387 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 526 | Open in IMG/M |
| 3300005563|Ga0068855_101092597 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 834 | Open in IMG/M |
| 3300005568|Ga0066703_10077191 | All Organisms → cellular organisms → Bacteria | 1921 | Open in IMG/M |
| 3300005617|Ga0068859_100387822 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1493 | Open in IMG/M |
| 3300005840|Ga0068870_10195117 | All Organisms → cellular organisms → Bacteria | 1224 | Open in IMG/M |
| 3300006049|Ga0075417_10376776 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 699 | Open in IMG/M |
| 3300006791|Ga0066653_10364667 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300006796|Ga0066665_11561791 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 518 | Open in IMG/M |
| 3300006804|Ga0079221_10136561 | All Organisms → cellular organisms → Bacteria | 1262 | Open in IMG/M |
| 3300007255|Ga0099791_10538055 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 569 | Open in IMG/M |
| 3300009012|Ga0066710_104161022 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 541 | Open in IMG/M |
| 3300009038|Ga0099829_10376997 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1171 | Open in IMG/M |
| 3300009090|Ga0099827_11983218 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 506 | Open in IMG/M |
| 3300009100|Ga0075418_10639365 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1146 | Open in IMG/M |
| 3300009137|Ga0066709_100767406 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1394 | Open in IMG/M |
| 3300009148|Ga0105243_12270686 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 580 | Open in IMG/M |
| 3300009156|Ga0111538_10163227 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2830 | Open in IMG/M |
| 3300009156|Ga0111538_12406225 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 661 | Open in IMG/M |
| 3300009162|Ga0075423_10712327 | Not Available | 1060 | Open in IMG/M |
| 3300009797|Ga0105080_1033651 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 590 | Open in IMG/M |
| 3300009815|Ga0105070_1116456 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 535 | Open in IMG/M |
| 3300009818|Ga0105072_1092880 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 600 | Open in IMG/M |
| 3300010046|Ga0126384_10037848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3251 | Open in IMG/M |
| 3300010047|Ga0126382_10638580 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 883 | Open in IMG/M |
| 3300010320|Ga0134109_10453088 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 522 | Open in IMG/M |
| 3300010323|Ga0134086_10160312 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 825 | Open in IMG/M |
| 3300010333|Ga0134080_10221906 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 825 | Open in IMG/M |
| 3300010333|Ga0134080_10396633 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 637 | Open in IMG/M |
| 3300010366|Ga0126379_10855567 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1010 | Open in IMG/M |
| 3300010399|Ga0134127_12508873 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 595 | Open in IMG/M |
| 3300010400|Ga0134122_11906508 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 629 | Open in IMG/M |
| 3300011269|Ga0137392_10561125 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 948 | Open in IMG/M |
| 3300011269|Ga0137392_11048255 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 669 | Open in IMG/M |
| 3300011271|Ga0137393_11627427 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 535 | Open in IMG/M |
| 3300011429|Ga0137455_1187447 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 618 | Open in IMG/M |
| 3300012189|Ga0137388_11893266 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 527 | Open in IMG/M |
| 3300012199|Ga0137383_10392959 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1016 | Open in IMG/M |
| 3300012210|Ga0137378_11070405 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 721 | Open in IMG/M |
| 3300012357|Ga0137384_10308013 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1316 | Open in IMG/M |
| 3300012358|Ga0137368_10843502 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300012362|Ga0137361_11411488 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 619 | Open in IMG/M |
| 3300012363|Ga0137390_11148916 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 725 | Open in IMG/M |
| 3300012923|Ga0137359_10928610 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 749 | Open in IMG/M |
| 3300012927|Ga0137416_12153221 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 512 | Open in IMG/M |
| 3300012930|Ga0137407_10260913 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1573 | Open in IMG/M |
| 3300012930|Ga0137407_12389182 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 505 | Open in IMG/M |
| 3300012971|Ga0126369_12268888 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 630 | Open in IMG/M |
| 3300012975|Ga0134110_10142945 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 985 | Open in IMG/M |
| 3300013306|Ga0163162_11895743 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 682 | Open in IMG/M |
| 3300015054|Ga0137420_1486460 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1979 | Open in IMG/M |
| 3300015241|Ga0137418_10101637 | All Organisms → cellular organisms → Bacteria | 2586 | Open in IMG/M |
| 3300015358|Ga0134089_10361403 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 613 | Open in IMG/M |
| 3300015371|Ga0132258_10432828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3276 | Open in IMG/M |
| 3300015373|Ga0132257_101741323 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 799 | Open in IMG/M |
| 3300016387|Ga0182040_11294224 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 615 | Open in IMG/M |
| 3300017656|Ga0134112_10276544 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 671 | Open in IMG/M |
| 3300018078|Ga0184612_10133720 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1297 | Open in IMG/M |
| 3300019259|Ga0184646_1360843 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1531 | Open in IMG/M |
| 3300019789|Ga0137408_1209631 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1209 | Open in IMG/M |
| 3300020074|Ga0194113_10491625 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 883 | Open in IMG/M |
| 3300021081|Ga0210379_10533468 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 522 | Open in IMG/M |
| 3300023066|Ga0247793_1035107 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 767 | Open in IMG/M |
| 3300025160|Ga0209109_10367015 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 676 | Open in IMG/M |
| 3300025885|Ga0207653_10120691 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 943 | Open in IMG/M |
| 3300025907|Ga0207645_10774645 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 652 | Open in IMG/M |
| 3300025910|Ga0207684_11472882 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 555 | Open in IMG/M |
| 3300025918|Ga0207662_10199016 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1296 | Open in IMG/M |
| 3300025942|Ga0207689_11529857 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 557 | Open in IMG/M |
| 3300025949|Ga0207667_10849830 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 907 | Open in IMG/M |
| 3300026285|Ga0209438_1097308 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 901 | Open in IMG/M |
| 3300026297|Ga0209237_1053716 | All Organisms → cellular organisms → Bacteria | 2005 | Open in IMG/M |
| 3300026313|Ga0209761_1223475 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 783 | Open in IMG/M |
| 3300026315|Ga0209686_1203041 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 539 | Open in IMG/M |
| 3300026320|Ga0209131_1112009 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1424 | Open in IMG/M |
| 3300026536|Ga0209058_1131315 | All Organisms → cellular organisms → Bacteria | 1218 | Open in IMG/M |
| 3300026548|Ga0209161_10539875 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 519 | Open in IMG/M |
| 3300026697|Ga0207569_102222 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 529 | Open in IMG/M |
| 3300027169|Ga0209897_1037947 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 696 | Open in IMG/M |
| 3300027546|Ga0208984_1079940 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 706 | Open in IMG/M |
| 3300027821|Ga0209811_10084393 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1125 | Open in IMG/M |
| 3300027874|Ga0209465_10081154 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1579 | Open in IMG/M |
| 3300027909|Ga0209382_11997594 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 556 | Open in IMG/M |
| 3300031114|Ga0308187_10415616 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 535 | Open in IMG/M |
| 3300031720|Ga0307469_10969639 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 792 | Open in IMG/M |
| 3300031944|Ga0310884_10293993 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 903 | Open in IMG/M |
| 3300032002|Ga0307416_101424119 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 799 | Open in IMG/M |
| 3300032003|Ga0310897_10095660 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1171 | Open in IMG/M |
| 3300032060|Ga0318505_10345136 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 703 | Open in IMG/M |
| 3300032174|Ga0307470_10188807 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1304 | Open in IMG/M |
| 3300032179|Ga0310889_10613798 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 562 | Open in IMG/M |
| 3300032180|Ga0307471_103427009 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 561 | Open in IMG/M |
| 3300033551|Ga0247830_10223647 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1415 | Open in IMG/M |
| 3300034115|Ga0364945_0166043 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 666 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 13.39% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.14% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 6.25% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.25% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.36% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.57% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 3.57% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.68% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.79% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.79% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.79% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.79% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.79% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.79% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.89% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.89% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.89% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.89% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.89% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000564 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B | Environmental | Open in IMG/M |
| 3300001139 | Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soil | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009797 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_10_20 | Environmental | Open in IMG/M |
| 3300009815 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 | Environmental | Open in IMG/M |
| 3300009818 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011429 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300023066 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S223-509R-6 | Environmental | Open in IMG/M |
| 3300025160 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2 | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026697 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G09A4-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027169 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034115 | Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICCgaii200_10001901 | 2228664021 | Soil | VIRFVLSRLAQSLVALAILSVVVFILARATGDPLQLILPMSATAEDYAE |
| RepKanNP_BrdU_F12BDRAFT_10008141 | 3300000564 | Soil | VARFVLARLVQSLVALAILSVVVFVLARATGDPLHLILPMSASEE |
| JGI10220J13317_101962672 | 3300001139 | Soil | LIRFVVSRVLQSLVALAILSVVVFILARATGDPLQLI |
| JGI25385J37094_100454752 | 3300002558 | Grasslands Soil | VARFVFTRLVQSLAALAILSVVVFILARATGDPLHLILPMSA |
| Ga0062595_1009703401 | 3300004479 | Soil | MLRFVAARLLQSLVALAIISVVVFVLARATGDPLYLILPMSASQEDF |
| Ga0066672_103996011 | 3300005167 | Soil | VARFVLTRLLQSLAALAILSVVVFVLARAAGDPLHLILPMSASEEDFAN |
| Ga0066680_105547001 | 3300005174 | Soil | MLRFVLARLSQSAITLLLFSVVIFGLARATGDPLTLVLPMVATEE |
| Ga0066680_105870252 | 3300005174 | Soil | VARFVLTRLLQSLAALAILSVVVFVLARATGDPLHLILPMSASEEDYANAR |
| Ga0066671_100310081 | 3300005184 | Soil | MLRFVFFRLLQSLIALAILSVVVFVLARATGDPLHMILPMNASEEDYA |
| Ga0070694_1006797521 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | VIRFVLARLLQSLVALAILSVVVFILARATGDPLHLILPMS |
| Ga0070708_1020421441 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRFVAARLVQSLVALAIISVVVFVLARATGDPLYLILPMSA |
| Ga0070707_1007214571 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRFVAARLLQSLIALAIVSVVVFVLARATGDPLYLILPMSASQ |
| Ga0070697_1004149572 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRFVFFRLLQSLIALAILSVVVFVLARATGDPLHMILPMNASE |
| Ga0066697_102128531 | 3300005540 | Soil | VARFVLTRLLQSLAALAILSVVVFVLARATGDPLHLILPMSASEEDYANA |
| Ga0070686_1000368884 | 3300005544 | Switchgrass Rhizosphere | VIRFVLARFVQSLVALAILSVVVFILARATGDPLHLILPMS |
| Ga0070695_1011874942 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRFVFFRLIQSLVALAILSIVVFVLARATGDPLHMILPMNAS |
| Ga0070696_1019364042 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MIRFVCFRLLQSLIALAILSVVVFVLARATGDPLHMILPMNA |
| Ga0066692_109619932 | 3300005555 | Soil | VARFVLTRLLQSLAALAILSVVVFVLARATGDPLHLILPMSASEEDYA |
| Ga0066698_104035741 | 3300005558 | Soil | VIRFVVSRLLQSLVALAILSVVVFILARATGDPLHLILPMSA |
| Ga0066698_110183872 | 3300005558 | Soil | MVRFVVFRLLQSLVALAILSVVVFVLARATGDPLHMILPMNASEEDY |
| Ga0068855_1010925971 | 3300005563 | Corn Rhizosphere | MLRFIATRLVQSLVALAIVSVVVFVLARATGDPLYLILPM |
| Ga0066703_100771911 | 3300005568 | Soil | VLRFVLFRLLQSLVALAILSVVVFVLARATGDPLHMI |
| Ga0068859_1003878221 | 3300005617 | Switchgrass Rhizosphere | VIRFVLARFVQSLVALAILSVVVFILARATGDPLHLILP |
| Ga0068870_101951172 | 3300005840 | Miscanthus Rhizosphere | MIRFVLFRLLQSLIALAILSVVVFVLARATGDPLH |
| Ga0075417_103767761 | 3300006049 | Populus Rhizosphere | MLRFVAVRLLQSVVTLALLSLVVFVLARTTGDPLHM |
| Ga0066653_103646671 | 3300006791 | Soil | MLRFVVFRLLQSLVALAILSVVVFVLARATGDPLHMILPMNA |
| Ga0066665_115617911 | 3300006796 | Soil | VIRFVVSRLLQSLVALAILSVVVFILARATGDPLH |
| Ga0079221_101365612 | 3300006804 | Agricultural Soil | MLRFVAARLMQSLVALAIISVVVFVLARATGDSLYLI |
| Ga0099791_105380552 | 3300007255 | Vadose Zone Soil | MLRFVAARLVQSLVALAIISVVVFVLARATGDPLYL |
| Ga0066710_1041610222 | 3300009012 | Grasslands Soil | MLRFVLSRLVQSLVALAILSVVVFVLARTTGDPLHLILP |
| Ga0099829_103769972 | 3300009038 | Vadose Zone Soil | LIRFILFRLLQSLVALAMLSVVVFVLARTTGDPLHMILPMN |
| Ga0099827_119832181 | 3300009090 | Vadose Zone Soil | VLRFVLTRLAQSLAALAILSVVVFVLARATGDPLHLILPMSASEEDYANARQYL |
| Ga0075418_106393652 | 3300009100 | Populus Rhizosphere | VIRFVLSRLAQSLVALAILSVVVFILARATGDPLQLILPMSA |
| Ga0066709_1007674062 | 3300009137 | Grasslands Soil | MIRFVAVRLLQSLVALALLSIVVFVLARATGDPLT |
| Ga0105243_122706862 | 3300009148 | Miscanthus Rhizosphere | VIRFVLARFLQSLVALAILSVVVFILARATGDPLHLILPMSA |
| Ga0111538_101632271 | 3300009156 | Populus Rhizosphere | VARFVFARLVQSLVALVILSVVVFVLARATGDPLHLILPM |
| Ga0111538_124062251 | 3300009156 | Populus Rhizosphere | MARFVFFRLLQSLIALAILSVVVFVLARATGDPLHMILPM |
| Ga0075423_107123271 | 3300009162 | Populus Rhizosphere | VIRFVLSRLAQSLVALAILSVVVFILARATGDPLQL |
| Ga0105080_10336511 | 3300009797 | Groundwater Sand | LLRFVFFRLLQSLVALAMLSVVVFVLARATGDPLHMILPMSATEE |
| Ga0105070_11164562 | 3300009815 | Groundwater Sand | LIRFVFSRLVQSLVALAILSIVVFVLARTTGDPLHLILPMSATEED |
| Ga0105072_10928802 | 3300009818 | Groundwater Sand | MIRFVLVRLLQSLVALAILSVVVFVLARTTGDPLHMILPMSATQE |
| Ga0126384_100378483 | 3300010046 | Tropical Forest Soil | LVRFVLFRLLQSLVALAILSVVVFVLARTTGDPLH |
| Ga0126382_106385801 | 3300010047 | Tropical Forest Soil | MQRYIVRRFLQSLLALIILSVVVFLLARATGDPLHLI |
| Ga0134109_104530882 | 3300010320 | Grasslands Soil | MLRFVVFRLLQSLVALAILSVVVFILARATGDPLHMILPMNASEEDYA |
| Ga0134086_101603122 | 3300010323 | Grasslands Soil | VIRFVLSRVLQSLVALAILSVVVFILARATGDPLHLIL |
| Ga0134080_102219062 | 3300010333 | Grasslands Soil | VVRFVLARLLQSMVALAILSVVVFILARATGDPLHLILPMSASEE |
| Ga0134080_103966332 | 3300010333 | Grasslands Soil | VARFVLARLVQSLVALAILSVVVFVLARATGDPLHLIL |
| Ga0126379_108555672 | 3300010366 | Tropical Forest Soil | VARFVFARLVQSLVALAILSVVVFVLARATGDPLHL |
| Ga0134127_125088731 | 3300010399 | Terrestrial Soil | VIRFVLARFLQSLVALAILSVVVFILARATGDPLHLILPMSATQEDYAEARRYL |
| Ga0134122_119065081 | 3300010400 | Terrestrial Soil | MLRFIAARLLQSLIALAIVSVVVFVLARATGDPLYLILPMSASQED |
| Ga0137392_105611252 | 3300011269 | Vadose Zone Soil | LIRFILFRLLQSLVALAMLSVVVFVLARTTGDPLHMILPMNASEEDYAN |
| Ga0137392_110482551 | 3300011269 | Vadose Zone Soil | MLRFVAARLVQSLVALAIISVVVFVLARATGDPLYLI |
| Ga0137393_116274272 | 3300011271 | Vadose Zone Soil | LIRFVLSRLLQSLVALAILSVVVFVLARATGDPLSLILPMGATEE |
| Ga0137455_11874471 | 3300011429 | Soil | VIRFVFSRLLQSLAALAILSVVVFALARTTGDPLHLILPM |
| Ga0137388_118932662 | 3300012189 | Vadose Zone Soil | MLRFLLTRLVQSAATLAILSVVVFLLARSTGDPLTL |
| Ga0137383_103929592 | 3300012199 | Vadose Zone Soil | VLRFVLFRLLQSLVALAILSVVVFVLARATGDPLHMILPMNASEED |
| Ga0137378_110704051 | 3300012210 | Vadose Zone Soil | VLRFVLFRLLQSLVALAILSVVVFLLARATGDPLHMILP |
| Ga0137384_103080132 | 3300012357 | Vadose Zone Soil | VARFVLTRLLQSLAALAILSVVVFVLARATGDPLHLILPMSA |
| Ga0137368_108435021 | 3300012358 | Vadose Zone Soil | MIRFVLTRFAQSLIALAMLSVVVFILARATGDPLQMILPM |
| Ga0137361_114114881 | 3300012362 | Vadose Zone Soil | VARFVLTRLLQSLAVLAILSVVVFVLARASGDPLHLILPMS |
| Ga0137390_111489162 | 3300012363 | Vadose Zone Soil | VVRFILSRLLQSLVALAILSVVVFILARATGDPLHLILPMSASEEDYA |
| Ga0137359_109286101 | 3300012923 | Vadose Zone Soil | VARFVLTRLLQSLAALAILSVVVFVLARATGDPLHLILPMSASEEDYAN |
| Ga0137416_121532211 | 3300012927 | Vadose Zone Soil | VIRFVLSRVLQSLVALAILSVVVFILARATGDPLHLI |
| Ga0137407_102609132 | 3300012930 | Vadose Zone Soil | MLRFVFFRLLQSLIALAILSVVVFVLARATGDPLH |
| Ga0137407_123891821 | 3300012930 | Vadose Zone Soil | VVRFVLARLLQSLVALAILSVVVFILARATGDPLHL |
| Ga0126369_122688882 | 3300012971 | Tropical Forest Soil | MLRFVLFRVLQSLIALAILSVVVFVLARTTGDPLHLILP |
| Ga0134110_101429452 | 3300012975 | Grasslands Soil | MLRFVFFRLLQSLIALAILSVVVFVLARATGDPLHMILPMNA |
| Ga0163162_118957432 | 3300013306 | Switchgrass Rhizosphere | MRRFLLQRVVRALLTLAILSVVIFLLARATGDPLTLILPPEASAQ |
| Ga0137420_14864606 | 3300015054 | Vadose Zone Soil | MLRFVFFRLLQSLIALAILSVVVFVLARATGDPCHMILPMNASEEDYAQRAALPRAR |
| Ga0137418_101016371 | 3300015241 | Vadose Zone Soil | MLRFVLARLSQSAITLLLFSVVIFGLARATGDPLT |
| Ga0134089_103614031 | 3300015358 | Grasslands Soil | VLRFVLFRVLQSLVALTLLSVVVFVLARTTGDPLHLILP |
| Ga0132258_104328283 | 3300015371 | Arabidopsis Rhizosphere | VIRFVLARLGHSLIALALLSVVVFALARFTGDPLNLI |
| Ga0132257_1017413231 | 3300015373 | Arabidopsis Rhizosphere | MLRFVAARLLQSLAALAIISVVVFVLARATGDPLYLIL |
| Ga0182040_112942241 | 3300016387 | Soil | VARFVFTRLLQSLAALAILSVVVFVLARATGDPLHL |
| Ga0134112_102765442 | 3300017656 | Grasslands Soil | VIRFVLSRVLQSLVALAILSVVVFILARATGDPLHL |
| Ga0184612_101337202 | 3300018078 | Groundwater Sediment | LIRFVLSRLLQSLVALAILSVVVFVLARTTGDPLYLIL |
| Ga0184646_13608432 | 3300019259 | Groundwater Sediment | MLRFVSFRLLQSLVALAMLSVVVFVLARTTGDPLHMILPMS |
| Ga0137408_12096311 | 3300019789 | Vadose Zone Soil | VARFVLAFVLARLVQSLMALAILSVVVFVLARATGDPLHLIL |
| Ga0194113_104916252 | 3300020074 | Freshwater Lake | LIRFVVVRLLQSLVALAILTIVVFILARATGDPLHMILPMS |
| Ga0210379_105334682 | 3300021081 | Groundwater Sediment | VLRFIGARLLQSLVALAIISVVVFVLARTTGDPLYLILPMSA |
| Ga0247793_10351072 | 3300023066 | Soil | MLRFIATRLVQSLVALAIVSVVVFVLARATGDPLYLILPMSASQ |
| Ga0209109_103670151 | 3300025160 | Soil | MWRFGLSRALQSLVALAILSVVVFVLARATGDPLHLILPANA |
| Ga0207653_101206912 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRFVAARLVQSLVALAIISVVVFVLARATGDPLYLILPM |
| Ga0207645_107746451 | 3300025907 | Miscanthus Rhizosphere | VIRFVVSRLLQSLVALAILSVVVFILARATGDPLHLILPMSATK |
| Ga0207684_114728822 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | LIRFVVSRVLQSLVALAILSVVVFILARATGDPLQ |
| Ga0207662_101990161 | 3300025918 | Switchgrass Rhizosphere | VIRFVLARFVQSLVALAILSVVVFILARATGDPLHLILPMSATQEDYAEARRYL |
| Ga0207689_115298571 | 3300025942 | Miscanthus Rhizosphere | MIRFVLFRLLQSLIALAILSVVVFVLARATGDPLHMIMPMSAT |
| Ga0207667_108498302 | 3300025949 | Corn Rhizosphere | MLRFIATRLVQSLVALAIVSVVVFVLARATGDPLYLILPMSAS |
| Ga0209438_10973082 | 3300026285 | Grasslands Soil | VARFVLTRLLQSLAALAILSVVVFVLARATGDPLHLI |
| Ga0209237_10537162 | 3300026297 | Grasslands Soil | VARFVLTRLLQSLAALAILSVVVFVLARATGDPLHLILPMSASEEDYANARRYL |
| Ga0209761_12234751 | 3300026313 | Grasslands Soil | VARFVLTRLVQSLAALAILSVVVFVLARATGDPLHLILP |
| Ga0209686_12030412 | 3300026315 | Soil | MLRFVFFRLLQSLIALAILSVVVFVLARATGDPLHM |
| Ga0209131_11120092 | 3300026320 | Grasslands Soil | MRRFLVQRVVRALLTLAILSVVIFLLARATGDPLTLILPPEASAQ |
| Ga0209058_11313152 | 3300026536 | Soil | VARFVLTRLLQSLAALAILSVVVFVLARATGDPLHLILPMSASEEDY |
| Ga0209161_105398752 | 3300026548 | Soil | VARFVLTRLLQSLAALAILSVVVFVLARATGDPLHLILPMS |
| Ga0207569_1022221 | 3300026697 | Soil | LIRFVVSRVLQSLVALAILSVVVFILARATGDPLQLIL |
| Ga0209897_10379471 | 3300027169 | Groundwater Sand | LLRFVAARLVQSLVALAILSIVVFVLARATGDPLH |
| Ga0208984_10799402 | 3300027546 | Forest Soil | MLRFVFFRLLQSLIALAILSVVVFALARATGDPLHMI |
| Ga0209811_100843931 | 3300027821 | Surface Soil | VIRFVLARLFQSLVALAILSVVVFILARATGDPLHLILPMSATQ |
| Ga0209465_100811542 | 3300027874 | Tropical Forest Soil | VARFVFTRLLQSLAALAILSVVVFVLARATGDPLHLILP |
| Ga0209382_119975941 | 3300027909 | Populus Rhizosphere | VARFVLTRLVQSLAALAILSVVVFVLARATGDPLHLILPMSASE |
| Ga0308187_104156161 | 3300031114 | Soil | MSVILRFVAVRLAQSLVALALLSIVVFILARATGDPL |
| Ga0307469_109696391 | 3300031720 | Hardwood Forest Soil | VIRFILSRVFQSLVALAILSVVVFILARATGDPLHLILPMSASEE |
| Ga0310884_102939931 | 3300031944 | Soil | VARFVLTRLLQSLAALAILSVVVFVLARATGDPLH |
| Ga0307416_1014241191 | 3300032002 | Rhizosphere | MLRFISFRLLQSLIALAILSVVVFVLARATGDPLHMIL |
| Ga0310897_100956602 | 3300032003 | Soil | MIRFVCFRLLQSLIALAILSVVVFVLARATGDPLHMILP |
| Ga0318505_103451361 | 3300032060 | Soil | VARFVFTRLLQSLAALAILSVVVFVLARATGDPLHLIL |
| Ga0307470_101888071 | 3300032174 | Hardwood Forest Soil | VIRFVVSRLLQSLVALAILSVVVFILARATGDPLHLILPMSATKED |
| Ga0310889_106137982 | 3300032179 | Soil | MLRFVAARLLQSLVALAIISVVVFVLARATGDPLYLILPMSA |
| Ga0307471_1034270092 | 3300032180 | Hardwood Forest Soil | VARFVLARLVQSLVALAILSVVVFVLARATGDPLHLILPMSA |
| Ga0247830_102236471 | 3300033551 | Soil | MLRFVASRLLQSLVALAILSVVVFVLARATGDPLHMI |
| Ga0364945_0166043_531_665 | 3300034115 | Sediment | VARFVLTRLIQSLAALALLSVVVFVLARATGDPLHLILPMSASEE |
| ⦗Top⦘ |