


| Basic Information | |
|---|---|
| Family ID | F084024 |
| Family Type | Metagenome |
| Number of Sequences | 112 |
| Average Sequence Length | 41 residues |
| Representative Sequence | VGAGVLGFDPALLRSIAERVGTPTYVYSANLIRAQYHALHDA |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 112 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 65.18 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 83.93 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.107 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (27.679 % of family members) |
| Environment Ontology (ENVO) | Unclassified (45.536 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.679 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.29% β-sheet: 0.00% Coil/Unstructured: 55.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 112 Family Scaffolds |
|---|---|---|
| PF09180 | ProRS-C_1 | 57.14 |
| PF08241 | Methyltransf_11 | 8.04 |
| PF00589 | Phage_integrase | 5.36 |
| PF13505 | OMP_b-brl | 3.57 |
| PF13620 | CarboxypepD_reg | 1.79 |
| PF03129 | HGTP_anticodon | 1.79 |
| PF13393 | tRNA-synt_His | 1.79 |
| PF01435 | Peptidase_M48 | 0.89 |
| PF03928 | HbpS-like | 0.89 |
| PF01039 | Carboxyl_trans | 0.89 |
| PF01098 | FTSW_RODA_SPOVE | 0.89 |
| PF06723 | MreB_Mbl | 0.89 |
| PF13649 | Methyltransf_25 | 0.89 |
| COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
|---|---|---|---|
| COG0442 | Prolyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 58.93 |
| COG0124 | Histidyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.79 |
| COG0423 | Glycyl-tRNA synthetase, class II | Translation, ribosomal structure and biogenesis [J] | 1.79 |
| COG0441 | Threonyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.79 |
| COG0772 | Peptodoglycan polymerase FtsW/RodA/SpoVE | Cell cycle control, cell division, chromosome partitioning [D] | 0.89 |
| COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 0.89 |
| COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 0.89 |
| COG1077 | Cell shape-determining ATPase MreB, actin-like superfamily | Cell cycle control, cell division, chromosome partitioning [D] | 0.89 |
| COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 0.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.11 % |
| Unclassified | root | N/A | 0.89 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004479|Ga0062595_100422243 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
| 3300005171|Ga0066677_10653371 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300005187|Ga0066675_10059444 | All Organisms → cellular organisms → Bacteria | 2388 | Open in IMG/M |
| 3300005446|Ga0066686_10769687 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300005446|Ga0066686_10858295 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300005446|Ga0066686_10987159 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 548 | Open in IMG/M |
| 3300005447|Ga0066689_10085271 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1781 | Open in IMG/M |
| 3300005540|Ga0066697_10021383 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 3507 | Open in IMG/M |
| 3300005540|Ga0066697_10260638 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
| 3300005546|Ga0070696_100368494 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1116 | Open in IMG/M |
| 3300005552|Ga0066701_10478568 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 773 | Open in IMG/M |
| 3300005556|Ga0066707_10699271 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 636 | Open in IMG/M |
| 3300005556|Ga0066707_10825961 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300005557|Ga0066704_10164639 | All Organisms → cellular organisms → Bacteria | 1491 | Open in IMG/M |
| 3300005557|Ga0066704_10175844 | All Organisms → cellular organisms → Bacteria | 1442 | Open in IMG/M |
| 3300005557|Ga0066704_10290530 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1106 | Open in IMG/M |
| 3300005557|Ga0066704_10874392 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 556 | Open in IMG/M |
| 3300005561|Ga0066699_10180685 | All Organisms → cellular organisms → Bacteria | 1459 | Open in IMG/M |
| 3300005561|Ga0066699_10293295 | All Organisms → cellular organisms → Bacteria | 1157 | Open in IMG/M |
| 3300005576|Ga0066708_10775274 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300006031|Ga0066651_10390506 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300006034|Ga0066656_10429765 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 857 | Open in IMG/M |
| 3300006791|Ga0066653_10674794 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300006797|Ga0066659_11415032 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300006854|Ga0075425_102755657 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300006903|Ga0075426_11493773 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 514 | Open in IMG/M |
| 3300006954|Ga0079219_10628337 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300007004|Ga0079218_10393284 | All Organisms → cellular organisms → Bacteria | 1177 | Open in IMG/M |
| 3300007255|Ga0099791_10184947 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 980 | Open in IMG/M |
| 3300007258|Ga0099793_10244026 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 866 | Open in IMG/M |
| 3300007258|Ga0099793_10629110 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 539 | Open in IMG/M |
| 3300009012|Ga0066710_101894161 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 893 | Open in IMG/M |
| 3300009038|Ga0099829_10021618 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 4430 | Open in IMG/M |
| 3300009088|Ga0099830_10227264 | All Organisms → cellular organisms → Bacteria | 1470 | Open in IMG/M |
| 3300009088|Ga0099830_10403758 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1105 | Open in IMG/M |
| 3300009089|Ga0099828_11715091 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 552 | Open in IMG/M |
| 3300009137|Ga0066709_100758170 | All Organisms → cellular organisms → Bacteria | 1402 | Open in IMG/M |
| 3300009137|Ga0066709_103373742 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 580 | Open in IMG/M |
| 3300009147|Ga0114129_11080867 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| 3300009553|Ga0105249_13044563 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 538 | Open in IMG/M |
| 3300009821|Ga0105064_1040755 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 883 | Open in IMG/M |
| 3300010301|Ga0134070_10068313 | All Organisms → cellular organisms → Bacteria | 1211 | Open in IMG/M |
| 3300010321|Ga0134067_10201481 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 731 | Open in IMG/M |
| 3300010322|Ga0134084_10082879 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 999 | Open in IMG/M |
| 3300010323|Ga0134086_10507054 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 500 | Open in IMG/M |
| 3300010326|Ga0134065_10010286 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2481 | Open in IMG/M |
| 3300010329|Ga0134111_10116230 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1037 | Open in IMG/M |
| 3300010337|Ga0134062_10230619 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 854 | Open in IMG/M |
| 3300011271|Ga0137393_11172076 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 652 | Open in IMG/M |
| 3300012096|Ga0137389_10654021 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 903 | Open in IMG/M |
| 3300012198|Ga0137364_10111151 | All Organisms → cellular organisms → Bacteria | 1942 | Open in IMG/M |
| 3300012198|Ga0137364_10623904 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 813 | Open in IMG/M |
| 3300012206|Ga0137380_10288100 | All Organisms → cellular organisms → Bacteria | 1473 | Open in IMG/M |
| 3300012207|Ga0137381_11111870 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 680 | Open in IMG/M |
| 3300012208|Ga0137376_10055198 | All Organisms → cellular organisms → Bacteria | 3262 | Open in IMG/M |
| 3300012208|Ga0137376_11112311 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division TA06 → candidate division TA06 bacterium | 676 | Open in IMG/M |
| 3300012208|Ga0137376_11181044 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 654 | Open in IMG/M |
| 3300012209|Ga0137379_10463044 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1176 | Open in IMG/M |
| 3300012209|Ga0137379_11219091 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300012210|Ga0137378_10314359 | All Organisms → cellular organisms → Bacteria | 1457 | Open in IMG/M |
| 3300012211|Ga0137377_10096584 | Not Available | 2795 | Open in IMG/M |
| 3300012285|Ga0137370_10626720 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300012354|Ga0137366_10135134 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1859 | Open in IMG/M |
| 3300012357|Ga0137384_10046298 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 3594 | Open in IMG/M |
| 3300012357|Ga0137384_10984578 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 678 | Open in IMG/M |
| 3300012359|Ga0137385_10005161 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 11449 | Open in IMG/M |
| 3300012359|Ga0137385_10467267 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1070 | Open in IMG/M |
| 3300012918|Ga0137396_10368383 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1064 | Open in IMG/M |
| 3300012922|Ga0137394_10848863 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 764 | Open in IMG/M |
| 3300012929|Ga0137404_12208906 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 515 | Open in IMG/M |
| 3300012977|Ga0134087_10846322 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 500 | Open in IMG/M |
| 3300015356|Ga0134073_10140203 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300017966|Ga0187776_10103657 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium ADurb.Bin474 | 1698 | Open in IMG/M |
| 3300017997|Ga0184610_1008757 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 2485 | Open in IMG/M |
| 3300018028|Ga0184608_10021210 | All Organisms → cellular organisms → Bacteria | 2360 | Open in IMG/M |
| 3300018071|Ga0184618_10021210 | All Organisms → cellular organisms → Bacteria | 2130 | Open in IMG/M |
| 3300018468|Ga0066662_11695379 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 661 | Open in IMG/M |
| 3300018482|Ga0066669_11020194 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 747 | Open in IMG/M |
| 3300021073|Ga0210378_10221407 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300025885|Ga0207653_10022646 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1996 | Open in IMG/M |
| 3300025910|Ga0207684_10921626 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 734 | Open in IMG/M |
| 3300025922|Ga0207646_10045793 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 3925 | Open in IMG/M |
| 3300025934|Ga0207686_10265274 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1261 | Open in IMG/M |
| 3300026296|Ga0209235_1027656 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 2957 | Open in IMG/M |
| 3300026296|Ga0209235_1073269 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1554 | Open in IMG/M |
| 3300026298|Ga0209236_1104107 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1273 | Open in IMG/M |
| 3300026301|Ga0209238_1007954 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 4204 | Open in IMG/M |
| 3300026307|Ga0209469_1037476 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1589 | Open in IMG/M |
| 3300026307|Ga0209469_1143551 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 531 | Open in IMG/M |
| 3300026310|Ga0209239_1061627 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1661 | Open in IMG/M |
| 3300026310|Ga0209239_1096056 | All Organisms → cellular organisms → Bacteria | 1263 | Open in IMG/M |
| 3300026316|Ga0209155_1001626 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 10550 | Open in IMG/M |
| 3300026328|Ga0209802_1058937 | All Organisms → cellular organisms → Bacteria | 1863 | Open in IMG/M |
| 3300026332|Ga0209803_1272877 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300026335|Ga0209804_1117689 | All Organisms → cellular organisms → Bacteria | 1208 | Open in IMG/M |
| 3300026523|Ga0209808_1152312 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 886 | Open in IMG/M |
| 3300026523|Ga0209808_1321320 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 502 | Open in IMG/M |
| 3300026527|Ga0209059_1105822 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1123 | Open in IMG/M |
| 3300026527|Ga0209059_1269213 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 573 | Open in IMG/M |
| 3300026529|Ga0209806_1158616 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 853 | Open in IMG/M |
| 3300027787|Ga0209074_10565015 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 503 | Open in IMG/M |
| 3300028536|Ga0137415_10402989 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
| 3300028819|Ga0307296_10813408 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 509 | Open in IMG/M |
| 3300031226|Ga0307497_10507490 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 596 | Open in IMG/M |
| 3300032211|Ga0310896_10585210 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 621 | Open in IMG/M |
| 3300032770|Ga0335085_10246902 | All Organisms → cellular organisms → Bacteria | 2148 | Open in IMG/M |
| 3300032770|Ga0335085_10380602 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1644 | Open in IMG/M |
| 3300032828|Ga0335080_10474179 | All Organisms → cellular organisms → Bacteria | 1332 | Open in IMG/M |
| 3300032897|Ga0335071_10041477 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 4549 | Open in IMG/M |
| 3300033433|Ga0326726_10167253 | All Organisms → cellular organisms → Bacteria | 2014 | Open in IMG/M |
| 3300034164|Ga0364940_0072554 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 948 | Open in IMG/M |
| 3300034178|Ga0364934_0315038 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 593 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 27.68% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 26.79% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 9.82% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 8.04% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.57% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.57% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.68% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.68% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.79% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.79% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.79% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.89% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.89% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.89% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009821 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300034164 | Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17 | Environmental | Open in IMG/M |
| 3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062595_1004222432 | 3300004479 | Soil | VGTGVLGFDPGLLQAIADRVGTPAYVYSTHLIRAQYNALDDALHGIK |
| Ga0066677_106533711 | 3300005171 | Soil | VGAAALGFDPALLRGIAERVGTPAYVYSSNLIRAQYHALHDAL |
| Ga0066675_100594443 | 3300005187 | Soil | MGAGVLGFDPALLRSIAERVGTPTYVYSANLIRAQYHALHDAL |
| Ga0066686_107696871 | 3300005446 | Soil | VGPGVLGFDPALLRSIAERVGTPVYVYGANLIRAQYHALHDALQ |
| Ga0066686_108582951 | 3300005446 | Soil | VQQVGTALGFDPALLRSIAERVGTPTYVYSANLIRAQYHALQDALK |
| Ga0066686_109871592 | 3300005446 | Soil | VGAGALGFDPALLRSIADRVGTPAYVYSANLIRAQYHALQDALKDV |
| Ga0066689_100852711 | 3300005447 | Soil | VGAGVLGFDPALLRSIAERVGTPTYVYSANLIRAQYHALQ |
| Ga0066697_100213831 | 3300005540 | Soil | VGAGVLGFDPALLRGIAERVGTPAYVYSANLMRAQYHALH |
| Ga0066697_102606382 | 3300005540 | Soil | VGAGVLGRSPLGFDPALLRAIGERVGTPTYVYSANLIRAQYHALDDALKDI |
| Ga0070696_1003684941 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | VGAGVLGFDPALLRSIAERVGTPTYVYSANLIRAQYHALQDAL |
| Ga0066701_104785681 | 3300005552 | Soil | VGAGALGFDPALLRCIAERVGTPAYVYSANLIRAQYHALQDALKDV |
| Ga0066707_106992711 | 3300005556 | Soil | VGAGVLGFDPALLRSIAERVGTPTYVYSANLIRAQYHALH |
| Ga0066707_108259611 | 3300005556 | Soil | VQQVGTALGFDPALLRSIAERVGTPTYVYSANLIRAQ |
| Ga0066704_101646391 | 3300005557 | Soil | VGAAALGFDPALLRGIAERVGTPAYVYSANLIRAQYH |
| Ga0066704_101758443 | 3300005557 | Soil | VGAGVLGFDPALLRGIAERVGTPAYVYSANLIRAQYHALHDAL |
| Ga0066704_102905301 | 3300005557 | Soil | MGTGVLGFDPALLRAIAERVGTPTYVYSANLIRAQYHALHDAL |
| Ga0066704_108743923 | 3300005557 | Soil | MVGTALGFDPALLRSIAERVGTPAYVYSANLIRAQYHALQD |
| Ga0066699_101806851 | 3300005561 | Soil | VGAGVLGFDPALLRGIAQRVGTPAYVYSANLIRAQYH |
| Ga0066699_102932951 | 3300005561 | Soil | VGASVLAFDPALLRSIAERVGTPTYVYSANLIRAQY |
| Ga0066708_107752742 | 3300005576 | Soil | VGAAALGFDPALLRGIAERVGTPAYVYSSNLIRAQYHALQDALKDVP |
| Ga0066651_103905062 | 3300006031 | Soil | VGAGVLGFDPGLLQAIADRIGTPAYVYSANLIRAQYNALADALH |
| Ga0066656_104297654 | 3300006034 | Soil | MGASVLGFDPALLRGIAERVGTPAYVYSANLIRAQYHALHDAL |
| Ga0066653_106747942 | 3300006791 | Soil | VGAGVLGFDPALLRSIAERVGTPTYVYSGNLIRAQYHAL |
| Ga0066659_114150321 | 3300006797 | Soil | MGAGVLGFDPALLRSIAERVGTPTYVYSANLIRAQYHALHDA |
| Ga0075425_1027556572 | 3300006854 | Populus Rhizosphere | VGTGVLGFDPGLLQAIADRVGTPAYVYSTNLIRAQYNALHDALHGIKH |
| Ga0075426_114937732 | 3300006903 | Populus Rhizosphere | VGAGVLTPRPVGLDPALLRSIAVRVGTPAYVYSAGLIRAQY |
| Ga0079219_106283371 | 3300006954 | Agricultural Soil | VGAGVLGFDPALLRSVAERVGTPVYVYSANLIRAQYHALHDA |
| Ga0079218_103932842 | 3300007004 | Agricultural Soil | LGSGVLGFDPALLQSIADRIGTPAYVYSTNLIRAQYHALDDALKSI |
| Ga0099791_101849472 | 3300007255 | Vadose Zone Soil | VGAGVLGFDPALLRSIAERVGTPTYVYSGNLIRAQYHALHDA |
| Ga0099793_102440262 | 3300007258 | Vadose Zone Soil | VGAGVLAFDPALLRSIAERVGTPTYVYSGNLIRAQYHALHDAL |
| Ga0099793_106291101 | 3300007258 | Vadose Zone Soil | VGAGVLGIDPGLLQAIADRVGTPAYVYSANLIRAQYHALDDA |
| Ga0066710_1018941612 | 3300009012 | Grasslands Soil | VGAGVLGFDPALLRAIAQRVGTPVYVYSANLIRAQYHALHDAL |
| Ga0099829_100216185 | 3300009038 | Vadose Zone Soil | MGTGVLGFDPALLRAVAERVGTPTYVYSANLIRAQYHALHDALHD |
| Ga0099830_102272642 | 3300009088 | Vadose Zone Soil | VGAGVLGFDPALLRSIAERVGTPTYVYSGNLIRAQYH |
| Ga0099830_104037582 | 3300009088 | Vadose Zone Soil | MGTGVLGFDPALLRAVAERVGTPTYVYSANLIRAQY |
| Ga0099828_117150911 | 3300009089 | Vadose Zone Soil | MGTGLLGFDPALLRAVAERVGTPTYVYSANLIRAQYHA |
| Ga0066709_1007581702 | 3300009137 | Grasslands Soil | VGAGVLGFDPALLRSIAERVGTPTYVYSANLIRAQYHALHDALK |
| Ga0066709_1033737422 | 3300009137 | Grasslands Soil | VGAGVLGFDPALLRSIAERVGTPTYVYSGNLIRAQYHALH |
| Ga0114129_110808671 | 3300009147 | Populus Rhizosphere | MMGTGILGFDPALLTAIATRVGTPAYVYGANLIRAQYHALDD |
| Ga0105249_130445632 | 3300009553 | Switchgrass Rhizosphere | VGAGVLGFDPGLLQAIADRIGTPAYVYSANLIRAQYNA |
| Ga0105064_10407551 | 3300009821 | Groundwater Sand | VGAGVLGFDPALLRSIAERVGTPVYVYSANLIRAQYHALSDALQAV |
| Ga0134070_100683132 | 3300010301 | Grasslands Soil | VGAGVLGFDPALLRAIGERVGTPAYVYSANLIRAQYHA |
| Ga0134067_102014812 | 3300010321 | Grasslands Soil | VGAGVLGFDPGLLQAIADRIGTPAYVYSTNLIRAQY |
| Ga0134084_100828792 | 3300010322 | Grasslands Soil | VGAGVLGFDPALLRSIAERIGTPTYVYSANLIRAQYHALH |
| Ga0134086_105070542 | 3300010323 | Grasslands Soil | MGTGVLGFDPALLRSIAERVGTPAYVYSANLIRAQYHALQDA |
| Ga0134065_100102864 | 3300010326 | Grasslands Soil | VGAAVLGFDPALLRGIAERVGTPAYVYSSNLIRAQYHAL |
| Ga0134111_101162301 | 3300010329 | Grasslands Soil | VGAGVLGFDPALLRGIAERVGTPAYVYSANLIRAQYHALHDALKD |
| Ga0134062_102306192 | 3300010337 | Grasslands Soil | VGAGVLGFDPALLRAIGERVGTPTYVYSANLIRAQ |
| Ga0137393_111720761 | 3300011271 | Vadose Zone Soil | MGTGLLGFDPALLRAVAERVGTPTYVYSANLIRAQYHALHDA |
| Ga0137389_106540211 | 3300012096 | Vadose Zone Soil | MGAGVLGFDPALLRSIAERVGTPTYVYSANLIRAQYHAL |
| Ga0137364_101111513 | 3300012198 | Vadose Zone Soil | VQQVGTALGFDPALLRSIAERVGTPTYVYSGNLIRAQYHALHDAL |
| Ga0137364_106239042 | 3300012198 | Vadose Zone Soil | LRGDDDVQQVGTALAFDPALLRSIAERVGTPTYVYSANLI |
| Ga0137380_102881001 | 3300012206 | Vadose Zone Soil | VGAGVLGFDPALLRSIAERVGTPTYVYSANLIRAQYHALQD |
| Ga0137381_111118702 | 3300012207 | Vadose Zone Soil | MGPVVLGFDPALLRSIAERVGTPVYVYGANLIRAQYHALHDALQ |
| Ga0137376_100551987 | 3300012208 | Vadose Zone Soil | MNVGTGVLGFDPGLLQAIADRIGTPAYVYSANLIRAQYNALDD |
| Ga0137376_111123112 | 3300012208 | Vadose Zone Soil | VGAAALGFDPALLRGIAERVGTPAYVYSSNLIRAQYHALHDALK |
| Ga0137376_111810441 | 3300012208 | Vadose Zone Soil | VGAGVLAFDPALLRSIAERVGTPTYVYSANLIRAQYHALQDALKDV |
| Ga0137379_104630441 | 3300012209 | Vadose Zone Soil | VGAGVLGFDPALLRSIAERVGTPTYVYSANLIRAQYHALQDALKD |
| Ga0137379_112190911 | 3300012209 | Vadose Zone Soil | VTQHVGTALGFDPALLRSIADRVGTPAYIYSANLI |
| Ga0137378_103143591 | 3300012210 | Vadose Zone Soil | VGAGVLGFDPALLSSIAQRLGTPVYVYGANLIRAQYHALQDA |
| Ga0137377_100965847 | 3300012211 | Vadose Zone Soil | MGPVVLGFDPALLRSIAERVGTPVYVYGANLIRAQYH |
| Ga0137370_106267201 | 3300012285 | Vadose Zone Soil | MGAGALGFDPALLRSIAERIGTPTYVYSANLIRAQYHALHDALKD |
| Ga0137366_101351343 | 3300012354 | Vadose Zone Soil | VGAGVLGFDPALLRGIAERVGTPAYVYSANLIRAQYH |
| Ga0137384_100462984 | 3300012357 | Vadose Zone Soil | VGAGVLAFDPALLRSIAERVGTPTYVYSGNLIRAQYHA |
| Ga0137384_109845782 | 3300012357 | Vadose Zone Soil | VGAGVLGFDPALLRSIAERVGTPAYVYSANLIRAQYHALHDALKD |
| Ga0137385_100051611 | 3300012359 | Vadose Zone Soil | VGTSVLGRSPLGFDPALLRAIGERVGTPTYVYSANLIRAQYHALDDAL |
| Ga0137385_104672672 | 3300012359 | Vadose Zone Soil | VGAGVLGFDPALLRSIAERVGTPTYVYSGNLIRAQYHALQDALKD |
| Ga0137396_103683832 | 3300012918 | Vadose Zone Soil | VGAGVLGFDPGLLQAIADRIGTPAYVYSTNLIRAQYNA |
| Ga0137394_108488631 | 3300012922 | Vadose Zone Soil | VGAGVLAFDPALLRSIAERVGTPTYVYSGNLIRAQYH |
| Ga0137404_122089062 | 3300012929 | Vadose Zone Soil | VGAGVLGFDPSLLRSIAERVGTPTYVYSGNLIRAQYHA |
| Ga0134087_108463222 | 3300012977 | Grasslands Soil | VGAGVLGFDPALLRSIAERVGTPTYVYSGNLIRAQY |
| Ga0134073_101402033 | 3300015356 | Grasslands Soil | VGAGVLGFDPALLRSIAERVGTPTYVYSANLIRAQYHAL |
| Ga0187776_101036571 | 3300017966 | Tropical Peatland | MTERATAVLGFDPALLTAIAERTGTPVYVYSANLIRAQYHALHDALQ |
| Ga0184610_10087571 | 3300017997 | Groundwater Sediment | VGAGVLGFDPGLLQAIADRIGTPAYVYSTNLIRAQYHAL |
| Ga0184608_100212104 | 3300018028 | Groundwater Sediment | MGAGVLGIDPGLLQAIADRVGTPAYVYSANLIRAQYHAL |
| Ga0184618_100212101 | 3300018071 | Groundwater Sediment | MGAGVLGIDPGLLQAIADRVGTPAYVYSANLIRAQYHALDD |
| Ga0066662_116953792 | 3300018468 | Grasslands Soil | VGAGVLGFDPALLRSIAERVGTPVYVYSANLIRAQYHALHDALHD |
| Ga0066669_110201942 | 3300018482 | Grasslands Soil | VQQVGTALGFDPALLRSIAERVGTPTYVYSANLIRAQYH |
| Ga0210378_102214072 | 3300021073 | Groundwater Sediment | MGAGVLGIDPGLLQAIADRVGTPAYVYSANLIRAQYHA |
| Ga0207653_100226463 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | VGAGVLGFDPALLRSIAERVGTPTYVYSANLIRAQYHALQDALK |
| Ga0207684_109216261 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VGAGVLGIDPALLQAIADRVGTPAYVYSANLIRAQYHALDDALQ |
| Ga0207646_100457934 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VGAGVLGFDPGLLQAIADRVRTPAYVYSTNLIRAQYHALDDA |
| Ga0207686_102652743 | 3300025934 | Miscanthus Rhizosphere | VGAGVLGFDPGLLQAIADRIGTPAYVYSTNLIRAQYNALDDAL |
| Ga0209235_10276561 | 3300026296 | Grasslands Soil | VGAGVLGFDPALLRSIAERVGTPTYVYSANLIRAQYHALQDA |
| Ga0209235_10732692 | 3300026296 | Grasslands Soil | MGAGVLGFDPALLRSIAERVGTPTYVYSANLIRAQYHALQDA |
| Ga0209236_11041073 | 3300026298 | Grasslands Soil | LTARVGTALGFDPALLRSIAERVGTPAYVYSANLIRAQYHALQDA |
| Ga0209238_10079545 | 3300026301 | Grasslands Soil | VGAGVLGFDPALLRSIGERVGTPTYVYSANLIRAQYHALDD |
| Ga0209469_10374762 | 3300026307 | Soil | VGAGVLGFDPALLRSIAERVGTPVYVYSANLIRAQYHALHDALHDV |
| Ga0209469_11435512 | 3300026307 | Soil | VGAGVLGFDPALLRAIGERVGTPAYVYSANLIRAQYHALDDALKDI |
| Ga0209239_10616271 | 3300026310 | Grasslands Soil | VGAGVLEFDPALLRSIAERVGTPTYVYSGNLIRAQYHALH |
| Ga0209239_10960562 | 3300026310 | Grasslands Soil | VGAGVLGFDPALLRSIAERVGTPAYVYSANLIRAQY |
| Ga0209155_10016261 | 3300026316 | Soil | VGAGVLGLDPALLRSIAERVGTPTYVYSANLIRAPYHALQDALKDV |
| Ga0209802_10589371 | 3300026328 | Soil | VGPGVLGFDPALLRSIAERVGTPVYVYGANLIRAQYHALHDA |
| Ga0209803_12728771 | 3300026332 | Soil | VGAAALGFDPALLRGIAERVGTPAYVYSANLIRAQYHAP |
| Ga0209804_11176892 | 3300026335 | Soil | VGAGVLGFDPALLRSIAERVGTPTYVYSANLIRAQYHALHDA |
| Ga0209808_11523122 | 3300026523 | Soil | VSAGVLGFDPALLRGIAERVGTPAYVYSANLIRAQYHALHDAL |
| Ga0209808_13213202 | 3300026523 | Soil | MGAGVLGFDPALLRSIAERVGTPTYVYSANLIRAQYHALHDALK |
| Ga0209059_11058221 | 3300026527 | Soil | VGAGVLGFDPALLRGIAQRVGTPAYVYSANLIRAQYHA |
| Ga0209059_12692132 | 3300026527 | Soil | VGAGVLGFDPALLRSIAERVGTPAYVYSANLIRGQYHALHDALK |
| Ga0209806_11586162 | 3300026529 | Soil | MGAALGFDPALLRSIAERVGTPTYVYSANLIRAQYHALHDALK |
| Ga0209074_105650151 | 3300027787 | Agricultural Soil | VGAGVLGFDPALLRAIAERVGTPAYVYSANLIRAHYN |
| Ga0137415_104029892 | 3300028536 | Vadose Zone Soil | VGTGVLGFDPGLLQAIADRIGTPAYVYSANLIRAQYNA |
| Ga0307296_108134082 | 3300028819 | Soil | VGAGVLGIDPGLLQAIADRVGTPAYVYSANLIRAQYHALDD |
| Ga0307497_105074901 | 3300031226 | Soil | MTAVLGFDPALLTAIADRTGTPVYVYSANLIRAQYHAL |
| Ga0310896_105852101 | 3300032211 | Soil | VGAGVLGFDPGLLQAIADRIGTPAYVYSTNLIRAQYNALSDALH |
| Ga0335085_102469021 | 3300032770 | Soil | VTVATKHAKAGAGVLGFDPALLQAIADREGTPAYVYGVNLIRAQFHALDDALQ |
| Ga0335085_103806023 | 3300032770 | Soil | VTVATKHAKVGAGVLGFDPALLQAVADRVGTPAYVYGANLIRAQFHALDDA |
| Ga0335080_104741791 | 3300032828 | Soil | VGTGVLGLDPALLTAIARRVGTPAYVYGANLIRAQFHALEDALRSAGV |
| Ga0335071_100414771 | 3300032897 | Soil | VGTGVLGLDPALLTAVARRVGTPTYVYSANLIRAQFHALEDALRSAGV |
| Ga0326726_101672533 | 3300033433 | Peat Soil | VGAGVLGFDPALLEGIVSRVGTPVYVYGANLIRAQFHALDDALQAI |
| Ga0364940_0072554_1_117 | 3300034164 | Sediment | MGAGVLGIDPGLLQTIADRVGTPAYVYSANLIRAQYHAL |
| Ga0364934_0315038_2_124 | 3300034178 | Sediment | MGAGLLGIDPGLLQAIADRVGTPAYVYSANLIRAQYHALDD |
| ⦗Top⦘ |