


| Basic Information | |
|---|---|
| Family ID | F083986 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 112 |
| Average Sequence Length | 50 residues |
| Representative Sequence | MPQIPDLTDPRYLDEVGWFLYHEKYRRDRFGDSYDAERLAYSRLLRDEVA |
| Number of Associated Samples | 103 |
| Number of Associated Scaffolds | 112 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 91.96 % |
| % of genes near scaffold ends (potentially truncated) | 93.75 % |
| % of genes from short scaffolds (< 2000 bps) | 93.75 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.429 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (16.964 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.250 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (44.643 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.87% β-sheet: 0.00% Coil/Unstructured: 55.13% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 112 Family Scaffolds |
|---|---|---|
| PF00005 | ABC_tran | 19.64 |
| PF00664 | ABC_membrane | 2.68 |
| PF12276 | DUF3617 | 0.89 |
| PF08241 | Methyltransf_11 | 0.89 |
| PF00535 | Glycos_transf_2 | 0.89 |
| PF00425 | Chorismate_bind | 0.89 |
| PF04230 | PS_pyruv_trans | 0.89 |
| PF07991 | IlvN | 0.89 |
| PF02806 | Alpha-amylase_C | 0.89 |
| PF06472 | ABC_membrane_2 | 0.89 |
| PF12021 | DUF3509 | 0.89 |
| PF13365 | Trypsin_2 | 0.89 |
| PF00890 | FAD_binding_2 | 0.89 |
| PF01738 | DLH | 0.89 |
| COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
|---|---|---|---|
| COG0059 | Ketol-acid reductoisomerase | Amino acid transport and metabolism [E] | 1.79 |
| COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 0.89 |
| COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 0.89 |
| COG0499 | S-adenosylhomocysteine hydrolase | Coenzyme transport and metabolism [H] | 0.89 |
| COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 0.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.43 % |
| Unclassified | root | N/A | 3.57 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000033|ICChiseqgaiiDRAFT_c2302762 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
| 3300000787|JGI11643J11755_10990754 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300000956|JGI10216J12902_124557035 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300003503|JGI26141J51220_1002082 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1217 | Open in IMG/M |
| 3300004156|Ga0062589_100148926 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1601 | Open in IMG/M |
| 3300004157|Ga0062590_101518346 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300004463|Ga0063356_100708741 | All Organisms → cellular organisms → Bacteria | 1385 | Open in IMG/M |
| 3300005177|Ga0066690_10302900 | All Organisms → cellular organisms → Bacteria | 1080 | Open in IMG/M |
| 3300005181|Ga0066678_10499460 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300005294|Ga0065705_10114538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Chroococcidiopsidales → Chroococcidiopsidaceae → Chroococcidiopsis → Chroococcidiopsis thermalis | 3628 | Open in IMG/M |
| 3300005328|Ga0070676_11036011 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300005332|Ga0066388_106962389 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300005354|Ga0070675_101247949 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300005355|Ga0070671_100335528 | All Organisms → cellular organisms → Bacteria | 1289 | Open in IMG/M |
| 3300005439|Ga0070711_100281357 | All Organisms → cellular organisms → Bacteria | 1316 | Open in IMG/M |
| 3300005444|Ga0070694_101366387 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300005445|Ga0070708_100132568 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2307 | Open in IMG/M |
| 3300005445|Ga0070708_101407219 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300005467|Ga0070706_101575526 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300005468|Ga0070707_101901993 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300005518|Ga0070699_102022133 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300005554|Ga0066661_10783804 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300005556|Ga0066707_10068125 | All Organisms → cellular organisms → Bacteria | 2114 | Open in IMG/M |
| 3300005556|Ga0066707_10393346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 903 | Open in IMG/M |
| 3300005568|Ga0066703_10368903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 861 | Open in IMG/M |
| 3300006796|Ga0066665_11139200 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 594 | Open in IMG/M |
| 3300006797|Ga0066659_10291716 | All Organisms → cellular organisms → Bacteria | 1240 | Open in IMG/M |
| 3300006904|Ga0075424_101105957 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300007004|Ga0079218_11002129 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300007076|Ga0075435_101086304 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300007258|Ga0099793_10509744 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300009012|Ga0066710_100817493 | All Organisms → cellular organisms → Bacteria | 1429 | Open in IMG/M |
| 3300009012|Ga0066710_104858543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 503 | Open in IMG/M |
| 3300009029|Ga0066793_10075209 | All Organisms → cellular organisms → Bacteria | 1937 | Open in IMG/M |
| 3300009053|Ga0105095_10312072 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300009090|Ga0099827_10780159 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300009137|Ga0066709_103765025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 550 | Open in IMG/M |
| 3300009162|Ga0075423_12594722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 554 | Open in IMG/M |
| 3300009177|Ga0105248_12522968 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300010043|Ga0126380_10798801 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 772 | Open in IMG/M |
| 3300010047|Ga0126382_10303930 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1199 | Open in IMG/M |
| 3300010114|Ga0127460_1096404 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300010141|Ga0127499_1183295 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300010362|Ga0126377_10238735 | All Organisms → cellular organisms → Bacteria | 1763 | Open in IMG/M |
| 3300010400|Ga0134122_13161743 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300011269|Ga0137392_10742969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 811 | Open in IMG/M |
| 3300012199|Ga0137383_10761624 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 707 | Open in IMG/M |
| 3300012202|Ga0137363_10026526 | All Organisms → cellular organisms → Bacteria | 3954 | Open in IMG/M |
| 3300012204|Ga0137374_10779006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 711 | Open in IMG/M |
| 3300012204|Ga0137374_10785206 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 707 | Open in IMG/M |
| 3300012205|Ga0137362_11386086 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 589 | Open in IMG/M |
| 3300012206|Ga0137380_11018065 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300012207|Ga0137381_10674661 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 899 | Open in IMG/M |
| 3300012353|Ga0137367_11035265 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300012360|Ga0137375_10903829 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300012532|Ga0137373_10099207 | All Organisms → cellular organisms → Bacteria | 2552 | Open in IMG/M |
| 3300012532|Ga0137373_10266980 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1374 | Open in IMG/M |
| 3300012916|Ga0157310_10441962 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300012917|Ga0137395_10909503 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300012918|Ga0137396_11132748 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300012925|Ga0137419_11067592 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300012948|Ga0126375_11365679 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 599 | Open in IMG/M |
| 3300012960|Ga0164301_10506332 | Not Available | 872 | Open in IMG/M |
| 3300015200|Ga0173480_11220486 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300015358|Ga0134089_10566503 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300015359|Ga0134085_10121567 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1095 | Open in IMG/M |
| 3300015372|Ga0132256_103773895 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300017994|Ga0187822_10286984 | Not Available | 577 | Open in IMG/M |
| 3300018466|Ga0190268_11080560 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300018468|Ga0066662_10929147 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300018468|Ga0066662_12607100 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 534 | Open in IMG/M |
| 3300019233|Ga0184645_1129825 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300019887|Ga0193729_1111234 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
| 3300021559|Ga0210409_11244346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 620 | Open in IMG/M |
| 3300022214|Ga0224505_10184851 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300023057|Ga0247797_1010601 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
| 3300025165|Ga0209108_10065980 | All Organisms → cellular organisms → Bacteria | 1987 | Open in IMG/M |
| 3300025901|Ga0207688_10424039 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300025906|Ga0207699_10459789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 914 | Open in IMG/M |
| 3300025910|Ga0207684_10012302 | All Organisms → cellular organisms → Bacteria | 7449 | Open in IMG/M |
| 3300025924|Ga0207694_10747017 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300025928|Ga0207700_10963592 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 764 | Open in IMG/M |
| 3300025931|Ga0207644_10279566 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1340 | Open in IMG/M |
| 3300025941|Ga0207711_11980309 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300026116|Ga0207674_12215017 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 512 | Open in IMG/M |
| 3300026118|Ga0207675_100307983 | All Organisms → cellular organisms → Bacteria | 1544 | Open in IMG/M |
| 3300026118|Ga0207675_102098117 | Not Available | 582 | Open in IMG/M |
| 3300026121|Ga0207683_11313860 | Not Available | 669 | Open in IMG/M |
| 3300026308|Ga0209265_1075839 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
| 3300026358|Ga0257166_1009472 | All Organisms → cellular organisms → Bacteria | 1185 | Open in IMG/M |
| 3300026496|Ga0257157_1092420 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300026508|Ga0257161_1046582 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300027490|Ga0209899_1115048 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 504 | Open in IMG/M |
| 3300027650|Ga0256866_1214442 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300027682|Ga0209971_1187293 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300027722|Ga0209819_10007572 | All Organisms → cellular organisms → Bacteria | 3478 | Open in IMG/M |
| 3300027748|Ga0209689_1155468 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
| 3300027765|Ga0209073_10156489 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300027821|Ga0209811_10149305 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300027846|Ga0209180_10095483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1690 | Open in IMG/M |
| 3300027882|Ga0209590_10081212 | All Organisms → cellular organisms → Bacteria | 1894 | Open in IMG/M |
| (restricted) 3300027997|Ga0255057_10053626 | All Organisms → cellular organisms → Bacteria | 1939 | Open in IMG/M |
| 3300028608|Ga0247819_10783380 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300028673|Ga0257175_1016698 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
| 3300028673|Ga0257175_1101235 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300028811|Ga0307292_10116270 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
| 3300031228|Ga0299914_10693113 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300031903|Ga0307407_11686950 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300031965|Ga0326597_11276916 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300033814|Ga0364930_0226665 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300033814|Ga0364930_0249967 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300034150|Ga0364933_206496 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 517 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 16.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.61% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.36% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.46% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.57% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.57% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 2.68% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.68% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.68% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.79% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.79% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.89% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.89% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.89% |
| Seawater | Environmental → Aquatic → Marine → Gulf → Unclassified → Seawater | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.89% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.89% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.89% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.89% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.89% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.89% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003503 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM | Host-Associated | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010114 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010141 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019233 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022214 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300023057 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S136-409B-6 | Environmental | Open in IMG/M |
| 3300025165 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1 | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026358 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-B | Environmental | Open in IMG/M |
| 3300026496 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300027490 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027650 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 HiSeq | Environmental | Open in IMG/M |
| 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027722 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027997 (restricted) | Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_6 | Environmental | Open in IMG/M |
| 3300028608 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6 | Environmental | Open in IMG/M |
| 3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300033814 | Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17 | Environmental | Open in IMG/M |
| 3300034150 | Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiDRAFT_23027621 | 3300000033 | Soil | MADIPDLTDPRYLEEIGWFLYYEKYRRDQFGGSYEAERLAYSRLLLAEVAGYLGRDVS |
| JGI11643J11755_109907541 | 3300000787 | Soil | MADIPDLTDPRYLEEIGWFLYYEKYRRDQFGGSYEAERVAYSRLLLAEVAD |
| JGI10216J12902_1245570351 | 3300000956 | Soil | MPEIPDLSNPRYLDEVGWFLYHEKYRRDHFGGPYDA |
| JGI26141J51220_10020821 | 3300003503 | Arabidopsis Thaliana Rhizosphere | MPEVPDLTDPRYLDEIGWFLYHEKYRRDRFGGSYDAERVANSRLLRDEVAAYLEQHAGW |
| Ga0062589_1001489263 | 3300004156 | Soil | MPEVPDLTDPRYLDEIGWFLYHEKYRRDRFGGSYDAERVANSRLLRDEVAAY |
| Ga0062590_1015183462 | 3300004157 | Soil | MPELPDLDDPRYLDELGWFVHYAERRRDEYGASYDEERLANSR |
| Ga0063356_1007087412 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MLEGTLPKIPDVTDRYRDELGWFLYQEKCRHDQFCASYTDERLAYSRLLLDEVLGA* |
| Ga0066690_103029002 | 3300005177 | Soil | MTQMPDLTRARHLDEIGWFLYHEKYRRDEFGGSYAAERLANSRLLLAEVARFLGR |
| Ga0066678_104994603 | 3300005181 | Soil | MPKIPDLTDPHYLDEVGRFLYHEKYRRDRFGGSYDDERLAHSRLLLTEVVGHLGRDVR |
| Ga0065705_101145381 | 3300005294 | Switchgrass Rhizosphere | MPFVPDLTDPRYVDEVGWFLYHEKYDRDKFGGSYDAERRAYSRLLLEEVTNSLGQ |
| Ga0070676_110360112 | 3300005328 | Miscanthus Rhizosphere | MPEVPDLTDPRYLDEIGWFLYHEKYRRDRFGGSYDAERVA |
| Ga0066388_1069623892 | 3300005332 | Tropical Forest Soil | MLRIPDLTDPRYLDELGWFLYHEKFRRDQFGGTYDEERLAYSRLLMDE |
| Ga0070675_1012479491 | 3300005354 | Miscanthus Rhizosphere | MADIPDLTDPRYLEEIGWFLYYEKYRRDQFGGSYEAERVAY |
| Ga0070671_1003355283 | 3300005355 | Switchgrass Rhizosphere | MPRIPDLSDPRYLDEVGWFLYHEKYRRDRFGGSYDAERIAYS |
| Ga0070711_1002813573 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MPQIPDLTDPRYLDEVGWFLYHEKYRRDRFGDSYDAERLAYSRLLRDEVAAALGQPPRWF |
| Ga0070694_1013663871 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MPEIPDLTDPRYLDEVGWFLHHEACERDGFTGSYREERLAYSRMFLQEVLS |
| Ga0070708_1001325684 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MPQIPDLTDPRYLDEVGWFLYHEKYRRDRFGDSYDAERLAYSRLLRDEVA |
| Ga0070708_1014072192 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MPRIPDLSDPRYLDEVGWFLYHEKHRRDRFGDSYDAERLAYS |
| Ga0070706_1015755261 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MPRIPDLSDPRYLDEVGWFLYHEKHRRDRFGGSYDAERLAYSRLLRDEVATFLGRDA |
| Ga0070707_1019019931 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MPQIPDLSDPRYLDEVGWFLYHEKYRRDRFGGSYDEERLAY |
| Ga0070699_1020221331 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MPRIPDLSDPRYLDEVGWFLYHEKHRRDRFGDSYDAERLAYSRLLRDEVAAFLGRDAGWF |
| Ga0066661_107838041 | 3300005554 | Soil | MPEIPDLTDPRYLDEVGWFLYHEKYRRDHFGGSYNAERLAYSRLLLQEVVD |
| Ga0066707_100681251 | 3300005556 | Soil | MPEIPDLTDPRYLDEVGWFLYHEKYRRDHFGGSYDAERLAYSRLLLQEVIDSLGR |
| Ga0066707_103933462 | 3300005556 | Soil | MPEIPDLPDTRYLDEVGWVLYLEKYRRDHFGGSYDAE |
| Ga0066703_103689032 | 3300005568 | Soil | MPKIPDLTDPHYLDEVGRFLYHEKYWRDRFGGSYDDERLAHSRLLLKEVVGHLGRDVRWT |
| Ga0066665_111392002 | 3300006796 | Soil | MPEIPDLSNPRYLDEVGWFLYHEKYQRDHFGGPYDAERLAYSRLLRDEVVACLGRDARWLEDK |
| Ga0066659_102917161 | 3300006797 | Soil | MPKIPDLTDPHYLDEVGRFLYHEKYRRDRFGGSYDDERLAHSRLLLKEVVGHLG |
| Ga0075424_1011059571 | 3300006904 | Populus Rhizosphere | MREIPDLTDPRYLDEVGWFLYHEKYRRDHFGGSYDAERLAYSRLLLQEVVDYLGRDVRWA |
| Ga0079218_110021292 | 3300007004 | Agricultural Soil | MSQIPDLTDPRYLDEIGWFLYHEKYRRGQFGGSYDAERLAYSRLLRDEVAGYLN |
| Ga0075435_1010863042 | 3300007076 | Populus Rhizosphere | MPQIPDLTDPRYLDEIGWFLYHEKYRRGQFGGSYNAERLAYSRLLRDEVTHYLDADAS |
| Ga0099793_105097441 | 3300007258 | Vadose Zone Soil | MPQIPDLTNPRYRDEVGWFLYHEKYGREKFGGSYDAERVAYSRLLLKDVLRFAERDTKW |
| Ga0066710_1008174931 | 3300009012 | Grasslands Soil | MPEIPDLTDPRYLDEVGWFLYHEKYRRDHFGGSYNAERLAYSR |
| Ga0066710_1048585432 | 3300009012 | Grasslands Soil | MPEIPDLTDPRYLDEVGWFLYHEKYRRDHFGGSYDAERLAYSRLLLQEVVDSLGRDVRWV |
| Ga0066793_100752093 | 3300009029 | Prmafrost Soil | MPQIPDLTNPRYRDEVGWFLHHEKYGREQFGGSYDAERVAYSRLLLEDVLRFAERDPNGCPIKQS* |
| Ga0105095_103120721 | 3300009053 | Freshwater Sediment | MPQIPDLTDPRYLDEIGWFLYHEKYRRGQFGGSYTAERLAYSRLLRDEVARHLDTDASW |
| Ga0099827_107801593 | 3300009090 | Vadose Zone Soil | MPEIPDLSDPRYLDEVGWFLYHEKYRRDRFGGSYQAERLAHSRLLR |
| Ga0066709_1037650251 | 3300009137 | Grasslands Soil | MPEIPDLTDPRYLDEVGWFLYHEKYRRDHFGGSYDAERLA |
| Ga0075423_125947222 | 3300009162 | Populus Rhizosphere | MREIPDLTDPRYLDEVGWFLYHEKYRRDHFGGSYDAERLAYSRLLLQEVVDYLGRDVRWAETK |
| Ga0105248_125229681 | 3300009177 | Switchgrass Rhizosphere | MPRIPDLSDPRYLDEVGWFLYHEKYRRDRFGGSYDAERIAYSRLLRDEVLGFLDALAR* |
| Ga0126380_107988011 | 3300010043 | Tropical Forest Soil | MVHISDLADPRYLDEVGWFLYHERYERQQFGGSYDDERLEYSR |
| Ga0126382_103039302 | 3300010047 | Tropical Forest Soil | MVHISDLADPRYLDEVGWFLYHERYERQKFGGSYDDERLEYSRLLLAEVLGY |
| Ga0127460_10964041 | 3300010114 | Grasslands Soil | MPQLPDLAEPRYLDEIGWFLYHEKYRRDKFGGSYTAERLAYSQLLLDEVIFFLGQ |
| Ga0127499_11832952 | 3300010141 | Grasslands Soil | MLRIPDLADPRYLDEVGWFLYHERFERHQFGGSYDDER |
| Ga0126377_102387351 | 3300010362 | Tropical Forest Soil | MFRIPDLTDPRYLHEIGWFLYHERFGRDQFGGPYDHERL |
| Ga0134122_131617431 | 3300010400 | Terrestrial Soil | MPDIPDLTDPRYLEEIGWFLYYEKYRRDQFGGSYEAERLAYSSLLLAEVAEHLGRDVSWVEGKT |
| Ga0137392_107429692 | 3300011269 | Vadose Zone Soil | MPKIPDLTDPRYLDEVGWFLYHEKYRRDHFGGSYDAERLAYS |
| Ga0137383_107616242 | 3300012199 | Vadose Zone Soil | MLYIPDLADPRYLDEIGWFLYHEKYERTQFGGSYDEER |
| Ga0137363_100265264 | 3300012202 | Vadose Zone Soil | MPKIPDLTDPRYLDEVGWFLYHERYRRDLFGGSYDAERLAYSRLLL |
| Ga0137374_107790062 | 3300012204 | Vadose Zone Soil | MPEIPDLSNPRYLDEVGWFLYHEKYRRDHFGGSYDAERLAYSRLLR |
| Ga0137374_107852063 | 3300012204 | Vadose Zone Soil | MLRIPDLADPRYLDEVGWFLYHERYERHQFGGSYDDKRRQYSHLLLAEVLGYCGQNQ |
| Ga0137362_113860862 | 3300012205 | Vadose Zone Soil | MLRIPDLADPRYLDEVGWFLYHERYERHQFGGSYDD |
| Ga0137380_110180651 | 3300012206 | Vadose Zone Soil | MSFIPDLTDPRYLDEVGWFLYHEIYGRSQFGGSYDEERLAYSRLL |
| Ga0137381_106746611 | 3300012207 | Vadose Zone Soil | MPDLTDPRYLDEVGWFLYHEKYERDRFGGSYDAERLAYSRLLLNEVVGY |
| Ga0137367_110352652 | 3300012353 | Vadose Zone Soil | MPEIPDLSNPRYLDEVGWFLYHEKYRRDHFGGSYDAERLAYSRLLRDEVVACLGGDVRWLEGK |
| Ga0137375_109038292 | 3300012360 | Vadose Zone Soil | MPDIPDLTDPRYLEEIGWFLYYEKYRRDQFDGPYDAER |
| Ga0137373_100992072 | 3300012532 | Vadose Zone Soil | MPEIPDLSNPRYLDEVGWFLYHEKYRRDHFGGSYDAERLAYSRLLRDEVVACLGGDVRWLEG* |
| Ga0137373_102669803 | 3300012532 | Vadose Zone Soil | MPEIPDLSNPRYLDEVGWFLYHEKYRRDHFGGSYDAERLAYSRLLRDEVVACLGGDVRELESK |
| Ga0157310_104419622 | 3300012916 | Soil | MPELPDLRDPRYLDELGWFVHYAERRRDEYGASYDEERLANSRLLLDEVLEFCGR |
| Ga0137395_109095032 | 3300012917 | Vadose Zone Soil | MPEIPDLTDPRYLDEVGWFLYHEKYRRDHFGGSYDAERLAHSRLL |
| Ga0137396_111327481 | 3300012918 | Vadose Zone Soil | MPQIPDLTDPRYLDEVGWFLYHERYARDQFGGSYDAEQLAY |
| Ga0137419_110675921 | 3300012925 | Vadose Zone Soil | MPKIPDLTDPRYLDEVGWFLYHEKYRRDRFGGSYDAER |
| Ga0126375_113656791 | 3300012948 | Tropical Forest Soil | MPNVPDFADPRYLDEVGWFLFHEKYQREQFGRTYTEERLAYSELFMDEVLG |
| Ga0164301_105063322 | 3300012960 | Soil | MPLIPDLAHPRYRDEVGWFLYHEKYGCDTFGGSYDAERIAYSRLLLEEALRYAERDT |
| Ga0173480_112204861 | 3300015200 | Soil | MADIPDLTDPRYLEEIGWFLYYEKYRRDQFGGSYEAERVAYSRLLLAEVADHLGRDVSWV |
| Ga0134089_105665031 | 3300015358 | Grasslands Soil | MPQIPDLTDPRYLDEVGWFLYHEKYERDRFGGSYDAERLAYSRLLLDEVVGY |
| Ga0134085_101215673 | 3300015359 | Grasslands Soil | MPDLTDPRYLDEVGWFLYHEKYERDRFGGSYDAERLAYSRLLLNEVVG |
| Ga0132256_1037738952 | 3300015372 | Arabidopsis Rhizosphere | MPKIPDLSDPRYLDEVKYRRDRFGGSYDAERLAYSRLLRDEILACLGRPP |
| Ga0187822_102869842 | 3300017994 | Freshwater Sediment | MPNIPDLTDSRYLDEVGWFIYHEKYRRDQFGGSYESERVQYSRLLLEEITGILGWD |
| Ga0190268_110805601 | 3300018466 | Soil | MPQIPDLTDPRYLDEIGWFLYHEKYRRGQFGGSYNAERLAYSRLLRDEVVGYLDTDASWLERK |
| Ga0066662_109291472 | 3300018468 | Grasslands Soil | MPQIPDLTDPRYLDEVGWFLYHEKYERDRFGGSYDAERLAYSRLLLDEVVGYLGRDTNWF |
| Ga0066662_126071002 | 3300018468 | Grasslands Soil | MPQMPDLTDPRYLDEVGWFLYHEKYERDRFGGSYDAERLAYSRLLLMERCS |
| Ga0184645_11298252 | 3300019233 | Groundwater Sediment | MSFIPDLTDPRYLDEVGWFLYHEKYGRPQFGGSYDEE |
| Ga0193729_11112341 | 3300019887 | Soil | MPRIPDLSDPRYLDEVGWFLYHEKHRRDRFGGSYNAERLAYSRLLRDEVAAF |
| Ga0210409_112443462 | 3300021559 | Soil | MPEIPDLSDPRYLDEVGWFLYHEKYRRDRFGGSYDAERLAHSRLL |
| Ga0224505_101848511 | 3300022214 | Sediment | MPKIPDLTDPRYLDEVGWFLYHEKYERDKFGGSYDNERIAYSRLLLEEVLKYMGRD |
| Ga0247797_10106011 | 3300023057 | Soil | MPEVPDLTDPRYLDEIGWFLYHEKYRRDRFGGSYDAERVANSRLLR |
| Ga0209108_100659801 | 3300025165 | Soil | MTRIPNFADPRYLDEVGWFLYHEKYRRDQFGGSYDTERLA |
| Ga0207688_104240391 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MPRIPDLSDPRYLDEVGWFLYHEKYRRDRFGGSYDAERIAYSRLLRDEVLGF |
| Ga0207699_104597893 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MPQIPDLTDPRYLDEVGWFLYHEKYRRDRFGDSYDAERLAYSRLLRDEVAAALGQPPRWFEDR |
| Ga0207684_100123021 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MPQIPDLTDPRYLDEVGWFLYHEKYRRDRFGDSYDAERLAYSRLLRDEVAAALG |
| Ga0207694_107470171 | 3300025924 | Corn Rhizosphere | MPRIPDLSDPRYLDEVGWFLYHEKYRRDRFGGSYDAERIAYSRLLRDEVLG |
| Ga0207700_109635922 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MPQIPDLTDPRYLDEVGWFLYHEKYRRDRFGGSYDAERLAYSRLLRDEVAAALGQPPRW |
| Ga0207644_102795661 | 3300025931 | Switchgrass Rhizosphere | MPRIPDLSDPRYLDEVGWFLYHEKYRRDRFGGSYDAERIAYSRLLRDEVLGFL |
| Ga0207711_119803091 | 3300025941 | Switchgrass Rhizosphere | MPRIPDLSDPRYLDEVGWFLYHEKYRRDRFGGSYDAERIAYSRLLRDEVLGFLGRP |
| Ga0207674_122150171 | 3300026116 | Corn Rhizosphere | MPQIPDLTDPRYLDEIGWFLYHEKYRRGQFGDSYNAERLAYSRL |
| Ga0207675_1003079833 | 3300026118 | Switchgrass Rhizosphere | MADIPDLTDPRYLEEIGWFLYYEKYRRDQFGGSYEAERVA |
| Ga0207675_1020981171 | 3300026118 | Switchgrass Rhizosphere | MPHIPDLTDPRYLEEIGWFLYYEKYRRDQFGGSYEAERLAYSRLLLAEVAEYLGRD |
| Ga0207683_113138601 | 3300026121 | Miscanthus Rhizosphere | MADIPDLTDPRYLEEIGWFLYYEKYRRDQFGGSYEAERVAYSRLLLAEV |
| Ga0209265_10758392 | 3300026308 | Soil | MPQIPDLAEPRYLDEIGWFLYHEKYRRDKFGGSYTAERLAYSQLLLD |
| Ga0257166_10094721 | 3300026358 | Soil | MPRIPDLSDPRYLDEVGWFLYHEKHRRDRFGGSYDAERLAYSRLLRDEVATFLGRDARWF |
| Ga0257157_10924202 | 3300026496 | Soil | MPRIPDLSDPRYLDEVGWFLYHEKHRRDRFGGSYDAERLA |
| Ga0257161_10465822 | 3300026508 | Soil | MPRIPDLSDPRYLDEVGWFLYHEKHRRDRFGGSYDAERLAYSRLLRDEVAT |
| Ga0209899_11150481 | 3300027490 | Groundwater Sand | MPQLPDLTDPRYLDEVGWFLYHEKYERDRFGGSYDAERLAYSRLLLN |
| Ga0256866_12144421 | 3300027650 | Soil | MPQIPDLSDPRYLDEVGWFLYHEKYRRDGFGGSYRAERLAHSRLLRDEVVACLREDARWFEGR |
| Ga0209971_11872931 | 3300027682 | Arabidopsis Thaliana Rhizosphere | MIKNPDLTDPRYLDEVGWFLYHEKYGRDQFGGPYDAERRAYSRLFLDEVTR |
| Ga0209819_100075723 | 3300027722 | Freshwater Sediment | MAFIPDLTDPRYLDEIGWFLHHEKYGRDSFGGSYDAERRAY |
| Ga0209689_11554682 | 3300027748 | Soil | MPQLPDLAEPRYLDEIGWFLYHEKYRRDKFGGSYTAERLAYSQLLLDEVIFFLGQDSIWMEG |
| Ga0209073_101564893 | 3300027765 | Agricultural Soil | MPRIPDLSDPRYLDEVGWFLYHEKYRRDRFGGSYDAERIAYSRLLRDE |
| Ga0209811_101493052 | 3300027821 | Surface Soil | MADIPDLTDPRYLEEIGWFLYYEKYRRDQFGGSYEAERLAYSRLLLAEVADQRPH |
| Ga0209180_100954831 | 3300027846 | Vadose Zone Soil | MPEIPDLTDPRYLDEVGWFLYHEKYRRDHFGGSYDAERLAYSRLLLEEVVGYLG |
| Ga0209590_100812121 | 3300027882 | Vadose Zone Soil | MPKIPDLTDPRYLDEVGWFLYHEKYRRDHFGGSYDAERLAYSRLLLQEVVDSLGRDVRWVES |
| (restricted) Ga0255057_100536261 | 3300027997 | Seawater | MPKTPDLTNPRYLDEVGWFLYHEKHERDKFGGSYDEERLEYSRLLLKEVLRYL |
| Ga0247819_107833801 | 3300028608 | Soil | VPFIPDFTDPRYVDEVGWFLYHEKYGRDEFGGSYDAERRAY |
| Ga0257175_10166982 | 3300028673 | Soil | MPQMPDLTDPRYLDEVGWFLYHEKYERDRFGGPYDAERLAYSRL |
| Ga0257175_11012352 | 3300028673 | Soil | MPRIPDLSDPRYLDEVGWFLYHEKHRRDRFGGSYDAERLAYSRLLRDEVATFLGR |
| Ga0307292_101162702 | 3300028811 | Soil | MAEIPDLTDPRYLDEVGWFLYHEKYRRDQFGGSYDAERIAYSRLL |
| Ga0299914_106931131 | 3300031228 | Soil | MPFIPDLTDPRYLDEVGWFLYHEKYGRDKFGGSYDAERLAYSRL |
| Ga0307407_116869501 | 3300031903 | Rhizosphere | VPFIPDFTDPRYVDEVGWFLYHEKYGRNEFGGSYDAERRAYSRL |
| Ga0326597_112769161 | 3300031965 | Soil | MTAIPDLNDPRYLDEIGWFLYHEKYGRDRFGGSYDAER |
| Ga0364930_0226665_3_116 | 3300033814 | Sediment | MTGIPDLNDPRYLDEIGWFLYHEKYGRDRFGGSYDAER |
| Ga0364930_0249967_2_172 | 3300033814 | Sediment | MPHLPDLSDPRYRDEVGWFLYYERHGREQFGGSYDQERLAYSHTLLEEVLSHCGQDK |
| Ga0364933_206496_336_515 | 3300034150 | Sediment | MPQIPDLTDPRYLDEIGWFLYHEKYCRGQFGDSYNAERLAYSGLLRDEIARYLHTDASWF |
| ⦗Top⦘ |