


| Basic Information | |
|---|---|
| Family ID | F083978 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 112 |
| Average Sequence Length | 45 residues |
| Representative Sequence | PDLERLQDLLRDLRGPSPTVEMNTRTTIVLGTVFEKPGFVPTELD |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 112 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.89 % |
| % of genes near scaffold ends (potentially truncated) | 99.11 % |
| % of genes from short scaffolds (< 2000 bps) | 87.50 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (27.679 % of family members) |
| Environment Ontology (ENVO) | Unclassified (45.536 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.786 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 16.44% β-sheet: 0.00% Coil/Unstructured: 83.56% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 112 Family Scaffolds |
|---|---|---|
| PF00892 | EamA | 83.93 |
| PF07883 | Cupin_2 | 4.46 |
| PF00857 | Isochorismatase | 3.57 |
| PF03992 | ABM | 3.57 |
| PF00924 | MS_channel | 1.79 |
| PF02540 | NAD_synthase | 0.89 |
| PF01850 | PIN | 0.89 |
| PF00491 | Arginase | 0.89 |
| COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
|---|---|---|---|
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 3.57 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 3.57 |
| COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 1.79 |
| COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 1.79 |
| COG0010 | Arginase/agmatinase family enzyme | Amino acid transport and metabolism [E] | 0.89 |
| COG0171 | NH3-dependent NAD+ synthetase | Coenzyme transport and metabolism [H] | 0.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002561|JGI25384J37096_10200049 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 588 | Open in IMG/M |
| 3300002912|JGI25386J43895_10077795 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300002912|JGI25386J43895_10128114 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 628 | Open in IMG/M |
| 3300003267|soilL1_10075835 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1176 | Open in IMG/M |
| 3300005166|Ga0066674_10039875 | All Organisms → cellular organisms → Bacteria | 2097 | Open in IMG/M |
| 3300005178|Ga0066688_10864510 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300005435|Ga0070714_100259200 | All Organisms → cellular organisms → Bacteria | 1610 | Open in IMG/M |
| 3300005447|Ga0066689_10873965 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 556 | Open in IMG/M |
| 3300005518|Ga0070699_100650865 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300005545|Ga0070695_101117393 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300005549|Ga0070704_102172902 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300005561|Ga0066699_10268149 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
| 3300005566|Ga0066693_10010741 | All Organisms → cellular organisms → Bacteria | 2576 | Open in IMG/M |
| 3300005569|Ga0066705_10404009 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 856 | Open in IMG/M |
| 3300006032|Ga0066696_10987609 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300006046|Ga0066652_100100424 | All Organisms → cellular organisms → Bacteria | 2332 | Open in IMG/M |
| 3300006797|Ga0066659_10003434 | All Organisms → cellular organisms → Bacteria | 7543 | Open in IMG/M |
| 3300006797|Ga0066659_10298623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1228 | Open in IMG/M |
| 3300006804|Ga0079221_10515664 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 780 | Open in IMG/M |
| 3300006852|Ga0075433_11945508 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300006904|Ga0075424_101217047 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300007255|Ga0099791_10526312 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 575 | Open in IMG/M |
| 3300007258|Ga0099793_10050687 | All Organisms → cellular organisms → Bacteria | 1829 | Open in IMG/M |
| 3300007265|Ga0099794_10398329 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 719 | Open in IMG/M |
| 3300009137|Ga0066709_103406069 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 578 | Open in IMG/M |
| 3300009162|Ga0075423_12656545 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 548 | Open in IMG/M |
| 3300010080|Ga0127448_109530 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 719 | Open in IMG/M |
| 3300010142|Ga0127483_1019148 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 513 | Open in IMG/M |
| 3300010304|Ga0134088_10553738 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 569 | Open in IMG/M |
| 3300010322|Ga0134084_10250505 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 639 | Open in IMG/M |
| 3300010333|Ga0134080_10083717 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1295 | Open in IMG/M |
| 3300010333|Ga0134080_10262852 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 764 | Open in IMG/M |
| 3300010333|Ga0134080_10295410 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 725 | Open in IMG/M |
| 3300010337|Ga0134062_10016953 | All Organisms → cellular organisms → Bacteria | 2745 | Open in IMG/M |
| 3300010373|Ga0134128_10772851 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1065 | Open in IMG/M |
| 3300011417|Ga0137326_1008442 | All Organisms → cellular organisms → Bacteria | 2350 | Open in IMG/M |
| 3300011441|Ga0137452_1015242 | All Organisms → cellular organisms → Bacteria | 2350 | Open in IMG/M |
| 3300012198|Ga0137364_10309749 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1174 | Open in IMG/M |
| 3300012200|Ga0137382_10060657 | All Organisms → cellular organisms → Bacteria | 2392 | Open in IMG/M |
| 3300012200|Ga0137382_10165690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1505 | Open in IMG/M |
| 3300012202|Ga0137363_10532895 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 988 | Open in IMG/M |
| 3300012202|Ga0137363_11338769 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300012204|Ga0137374_11104909 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 564 | Open in IMG/M |
| 3300012206|Ga0137380_10623878 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 941 | Open in IMG/M |
| 3300012206|Ga0137380_11635950 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 528 | Open in IMG/M |
| 3300012207|Ga0137381_10153251 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1984 | Open in IMG/M |
| 3300012207|Ga0137381_10591619 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 967 | Open in IMG/M |
| 3300012208|Ga0137376_10908929 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300012208|Ga0137376_11514116 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 562 | Open in IMG/M |
| 3300012211|Ga0137377_11842945 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 523 | Open in IMG/M |
| 3300012350|Ga0137372_10176087 | All Organisms → cellular organisms → Bacteria | 1729 | Open in IMG/M |
| 3300012351|Ga0137386_10563773 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 820 | Open in IMG/M |
| 3300012356|Ga0137371_10269828 | All Organisms → cellular organisms → Bacteria | 1327 | Open in IMG/M |
| 3300012357|Ga0137384_10576093 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 920 | Open in IMG/M |
| 3300012362|Ga0137361_10723967 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 908 | Open in IMG/M |
| 3300012384|Ga0134036_1078375 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 571 | Open in IMG/M |
| 3300012400|Ga0134048_1122747 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 536 | Open in IMG/M |
| 3300012402|Ga0134059_1328458 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 526 | Open in IMG/M |
| 3300012410|Ga0134060_1403329 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 501 | Open in IMG/M |
| 3300012683|Ga0137398_10562730 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 787 | Open in IMG/M |
| 3300012685|Ga0137397_10134142 | All Organisms → cellular organisms → Bacteria | 1829 | Open in IMG/M |
| 3300012918|Ga0137396_11070440 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 579 | Open in IMG/M |
| 3300012922|Ga0137394_10985682 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 701 | Open in IMG/M |
| 3300012944|Ga0137410_10064639 | All Organisms → cellular organisms → Bacteria | 2639 | Open in IMG/M |
| 3300012972|Ga0134077_10557314 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 514 | Open in IMG/M |
| 3300012977|Ga0134087_10482299 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 620 | Open in IMG/M |
| 3300015245|Ga0137409_10565149 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 965 | Open in IMG/M |
| 3300015357|Ga0134072_10040977 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1253 | Open in IMG/M |
| 3300015359|Ga0134085_10372490 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 637 | Open in IMG/M |
| 3300015373|Ga0132257_103484403 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 572 | Open in IMG/M |
| 3300017656|Ga0134112_10076879 | All Organisms → cellular organisms → Bacteria | 1236 | Open in IMG/M |
| 3300017656|Ga0134112_10142457 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 919 | Open in IMG/M |
| 3300017656|Ga0134112_10241186 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 715 | Open in IMG/M |
| 3300017656|Ga0134112_10480608 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 524 | Open in IMG/M |
| 3300018482|Ga0066669_10695487 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 896 | Open in IMG/M |
| 3300018482|Ga0066669_10785761 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 842 | Open in IMG/M |
| 3300019259|Ga0184646_1412364 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 528 | Open in IMG/M |
| 3300019789|Ga0137408_1143651 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 981 | Open in IMG/M |
| 3300022694|Ga0222623_10172989 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 840 | Open in IMG/M |
| 3300025155|Ga0209320_10390328 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 561 | Open in IMG/M |
| 3300025929|Ga0207664_10343563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1320 | Open in IMG/M |
| 3300026296|Ga0209235_1250957 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 548 | Open in IMG/M |
| 3300026298|Ga0209236_1020199 | All Organisms → cellular organisms → Bacteria | 3730 | Open in IMG/M |
| 3300026300|Ga0209027_1000119 | All Organisms → cellular organisms → Bacteria | 22573 | Open in IMG/M |
| 3300026307|Ga0209469_1116387 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 682 | Open in IMG/M |
| 3300026310|Ga0209239_1042017 | All Organisms → cellular organisms → Bacteria | 2102 | Open in IMG/M |
| 3300026310|Ga0209239_1198818 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 725 | Open in IMG/M |
| 3300026310|Ga0209239_1252620 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 608 | Open in IMG/M |
| 3300026315|Ga0209686_1040432 | All Organisms → cellular organisms → Bacteria | 1746 | Open in IMG/M |
| 3300026318|Ga0209471_1073018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1529 | Open in IMG/M |
| 3300026325|Ga0209152_10017886 | All Organisms → cellular organisms → Bacteria | 2431 | Open in IMG/M |
| 3300026327|Ga0209266_1188985 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 766 | Open in IMG/M |
| 3300026329|Ga0209375_1163975 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 914 | Open in IMG/M |
| 3300026335|Ga0209804_1289439 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 564 | Open in IMG/M |
| 3300026523|Ga0209808_1276885 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 537 | Open in IMG/M |
| 3300026547|Ga0209156_10121333 | All Organisms → cellular organisms → Bacteria | 1282 | Open in IMG/M |
| 3300026548|Ga0209161_10102757 | All Organisms → cellular organisms → Bacteria | 1720 | Open in IMG/M |
| 3300027671|Ga0209588_1038071 | All Organisms → cellular organisms → Bacteria | 1549 | Open in IMG/M |
| 3300027725|Ga0209178_1193521 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 717 | Open in IMG/M |
| 3300027725|Ga0209178_1419957 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 511 | Open in IMG/M |
| 3300027875|Ga0209283_10521949 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 762 | Open in IMG/M |
| 3300027903|Ga0209488_10339251 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1118 | Open in IMG/M |
| 3300028711|Ga0307293_10225993 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 595 | Open in IMG/M |
| 3300032180|Ga0307471_100367894 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1554 | Open in IMG/M |
| 3300032180|Ga0307471_100503677 | All Organisms → cellular organisms → Bacteria | 1359 | Open in IMG/M |
| 3300032205|Ga0307472_100016336 | All Organisms → cellular organisms → Bacteria | 3923 | Open in IMG/M |
| 3300032205|Ga0307472_101185018 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 728 | Open in IMG/M |
| 3300032828|Ga0335080_10652347 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1102 | Open in IMG/M |
| 3300032954|Ga0335083_10774840 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 772 | Open in IMG/M |
| 3300033813|Ga0364928_0149902 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 571 | Open in IMG/M |
| 3300034177|Ga0364932_0252303 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 667 | Open in IMG/M |
| 3300034178|Ga0364934_0214787 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 729 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 27.68% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 17.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 16.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 10.71% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.57% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.68% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.68% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 2.68% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.68% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.79% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.79% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.79% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.89% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.89% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.89% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
| 3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010080 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010142 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300011417 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT500_2 | Environmental | Open in IMG/M |
| 3300011441 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012384 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012400 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012402 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012410 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300025155 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 4 | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033813 | Sediment microbial communities from East River floodplain, Colorado, United States - 30_j17 | Environmental | Open in IMG/M |
| 3300034177 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17 | Environmental | Open in IMG/M |
| 3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25384J37096_102000491 | 3300002561 | Grasslands Soil | DLERLQDLLRDLRGPSPTVEMSTRTTIVLGTVFEKPGFVPTELD* |
| JGI25386J43895_100777952 | 3300002912 | Grasslands Soil | EDCYILKVAAPDLESLQGVLRDLRGPSAKMQMSTRTTIVLGTVFEKPGFVPVEPD* |
| JGI25386J43895_101281142 | 3300002912 | Grasslands Soil | QDLLRDLRGPSPTIEMNTRTTIVLGTVFEKPGFVPTELD* |
| soilL1_100758352 | 3300003267 | Sugarcane Root And Bulk Soil | KVVASDLEGVQEILRDLRGPNAQMNTRTTIVLSTLFEKPGFIATEPD* |
| Ga0066674_100398751 | 3300005166 | Soil | PDIESLQDLLRDLRGPGKKEMSTRTTIVLGTVFEKPGFTPVEPD* |
| Ga0066688_108645102 | 3300005178 | Soil | LKVAAPDLESLQGVLKDLRGSSKTQMSTRTTIVLGTVFEKPGFIPMEPD* |
| Ga0070714_1002592004 | 3300005435 | Agricultural Soil | EDCYILKVAAPDLESLQGLLRDLRGPSRQARMDTRTTIVLSTLFEKPGFVPVELD* |
| Ga0066689_108739652 | 3300005447 | Soil | VAAPDLERLQDLLRDLRGPSPTVEMNTRTTIVLGTVFEKPGFVPTELD* |
| Ga0070699_1006508652 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | KVVAPDLEGVQAILRDLRGPNSQMNTRTTIVLSTLFEKPGFIPTEPD* |
| Ga0070695_1011173931 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | LEGVQEILRDLRGPNAQMNTRTTIVLSTLFEKPGFIPTEPD* |
| Ga0070704_1021729021 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | ILKVVAEDLEGVQTILRDLRGPNTQMNTRTTIVLSTVFEKPGYIPTEPD* |
| Ga0066699_102681493 | 3300005561 | Soil | ILKVVASDLEGVQAILRDLRGPNTQMNTRTTIVLSTLFEKPGFIATEPD* |
| Ga0066693_100107411 | 3300005566 | Soil | GVLKDLRGSSKTQMSTRTTIVLGTVFEKPGFIPVEPD* |
| Ga0066705_104040092 | 3300005569 | Soil | APDLERLQDLLRDLRGPSPTVEMNTRTTIVLGTVFEKPGFVPTELD* |
| Ga0066696_109876091 | 3300006032 | Soil | YMLKVAAPDLESLQGVLKDLRGSSKTQMSTRTTIVLGTVFEKPGFIPVEPD* |
| Ga0066652_1001004241 | 3300006046 | Soil | KVVAPDLEGVQAILRDLRGPNSQMNTRTTIVLSTLFEKPGFIPAEPD* |
| Ga0066659_100034341 | 3300006797 | Soil | QGLLRDLRGPGKKEMSTRTTIVLGTVFEKPGFTPVEPD* |
| Ga0066659_102986231 | 3300006797 | Soil | YVLKVAAPDLERLQDLLRDLRGPSPTVEMSTRTTIVLGTVFEKPGFVPTELD* |
| Ga0079221_105156641 | 3300006804 | Agricultural Soil | QKLLGDLRGPSPSPQMSTRTTIVLGTVFEKPGFVPAELD* |
| Ga0075433_119455082 | 3300006852 | Populus Rhizosphere | YILKVVASDLEGVQEILRDLRGPNSQMNTRTTIVLSTVFEKPGFIPTEPD* |
| Ga0075424_1012170471 | 3300006904 | Populus Rhizosphere | KVVAPDLEGVQEILRDLRGPNSQMNTRTTIVLSTVFEKSGFIPTEPD* |
| Ga0099791_105263121 | 3300007255 | Vadose Zone Soil | ILRDLRGPNSQMNTRTTIVLSTLFEKPGFIPTEPD* |
| Ga0099793_100506874 | 3300007258 | Vadose Zone Soil | ESLQGVLRDLRGPSAKTQMSTRTTIVLSTVFEKPGFVPVEPD* |
| Ga0099794_103983292 | 3300007265 | Vadose Zone Soil | EGVQEILRDLRGPNSQMNTRTTIVLSTLFEKPGFLATEPD* |
| Ga0066709_1034060691 | 3300009137 | Grasslands Soil | ILTDLRGPNSQMNTRTTIVLSTLFEKPGFIPAEPD* |
| Ga0075423_126565451 | 3300009162 | Populus Rhizosphere | LEGVQEILRDLRGPNSQMNTRTTIVLSTLFEKPGFIPAEPD* |
| Ga0127448_1095301 | 3300010080 | Grasslands Soil | VLKVAAPDLERLQNLLRDLRGPSPTVEMNTRTTIVLGTVFEKPGFVPTELD* |
| Ga0127483_10191482 | 3300010142 | Grasslands Soil | EDCYILKVAAPDLESLQGILRDLRGPAAKTQMSTRTTIVLGTVFEKPGFIPVEPD* |
| Ga0134088_105537382 | 3300010304 | Grasslands Soil | LKVAAPDLERLQNLLRDLRGPSPTVEMNTRTTIVLGTVFEKPGFVPTELD* |
| Ga0134084_102505051 | 3300010322 | Grasslands Soil | GVLKHLRGSSKTQMSTRTTIVLGTVFEKPGFIPVEPD* |
| Ga0134080_100837171 | 3300010333 | Grasslands Soil | CYILKVAAPDLESLQGILRDLRGPSAKMQMSTRTTIVLGTVFEKPGFVPVEPD* |
| Ga0134080_102628521 | 3300010333 | Grasslands Soil | DLERLQDLLRDLRGPSPTVEMNTRTTIVLGTVFEKPGFVPTELD* |
| Ga0134080_102954101 | 3300010333 | Grasslands Soil | ILKVVAPDLEGVQEILRDLRGPNSQMNTRTTIVLSTVFEKSGFVPTEPD* |
| Ga0134062_100169535 | 3300010337 | Grasslands Soil | LKVAAPDLESLQGLLRDIRGPDPHARMDTRTTIVLGTVFEKPGFVPVELD* |
| Ga0134128_107728511 | 3300010373 | Terrestrial Soil | AAPDLERLQDLLRDLRGPSPTIEMNTRTTIVLGTVFEKPGFVPTELD* |
| Ga0137326_10084425 | 3300011417 | Soil | SILRDLRGPNAQMNTRTTIVLSTVFEKPGFIPTEPD* |
| Ga0137452_10152425 | 3300011441 | Soil | GVQSILRDLRGPNAQMNTRTTIVLSTVFEKPGYIPTEPD* |
| Ga0137364_103097492 | 3300012198 | Vadose Zone Soil | DCYVLKVAAPDLERLQDLLRDLRGPSPTVEMNTRTTIVLGTVFEKPGFVPTELD* |
| Ga0137382_100606571 | 3300012200 | Vadose Zone Soil | LLRDLRGPSPSVEMSTRTTIVLGTVFEKPGFVPTELD* |
| Ga0137382_101656901 | 3300012200 | Vadose Zone Soil | ILKVAAPDLESLQGILRDLRGPSAKTQLSTRTTIVLGTGFEKPGFVPVELD* |
| Ga0137363_105328952 | 3300012202 | Vadose Zone Soil | DLRGPSPTIEMNTRTTIVLGTVFEKPGFVPTELD* |
| Ga0137363_113387691 | 3300012202 | Vadose Zone Soil | VVAPDLEGVQEILRDLRGPNTQMNTRTTIVLSTLFEKPGFVPAEPD* |
| Ga0137374_111049091 | 3300012204 | Vadose Zone Soil | DLEHLQELLRQLRGPGKQEMSTRTTIVLGTVFEKPGFVPVELD* |
| Ga0137380_106238782 | 3300012206 | Vadose Zone Soil | YILKVAAPDLESLQGVLKHLRGSSKTQMSTRTTIVLGTVFEKPGFIPVEPD* |
| Ga0137380_116359501 | 3300012206 | Vadose Zone Soil | KVAAPDLERLQNLLRDLRGPSPTVEMNTRTTIVLGTVFEKPGFVPTELD* |
| Ga0137381_101532511 | 3300012207 | Vadose Zone Soil | EGVQAVLRDLRGPNSQMNTRTTIVLSTLFEKPGLIPTEPD* |
| Ga0137381_105916192 | 3300012207 | Vadose Zone Soil | LKVAAPDLESLQGVLKHLRGSSKTQMSTRTTIVLGTVFEKPGFIPVEPD* |
| Ga0137376_109089291 | 3300012208 | Vadose Zone Soil | YILKVVAPDLEGVQEILRDLRGPNSQMNTRTTIVLSTLFEKPGFIPTEPD* |
| Ga0137376_115141161 | 3300012208 | Vadose Zone Soil | LRDLKGNNKNMTTRTTIVLGTVFEKPGLVLTEPD* |
| Ga0137377_118429451 | 3300012211 | Vadose Zone Soil | GEDCYVLKVAAPDLERLQDRLRVLRGPSPTVEMSTRTTIVLGTVFEKPGFVPTELD* |
| Ga0137372_101760871 | 3300012350 | Vadose Zone Soil | PDLERLQNLLRDLRGPSPTVEMSTRTTIVLGTVFEKPGFVPTELD* |
| Ga0137386_105637731 | 3300012351 | Vadose Zone Soil | LRDLRGPSSQARMDTRTTIVLSTLFEKPGFVPVEPD* |
| Ga0137371_102698281 | 3300012356 | Vadose Zone Soil | ESLQGLLRDLRGPGKKEMSTRTTIVLGTVFEKPGFTPVEPD* |
| Ga0137384_105760932 | 3300012357 | Vadose Zone Soil | LQDLLRDLRGPSPAVEMNTRTTIVLGTVFEKPGFVPTELD* |
| Ga0137361_107239672 | 3300012362 | Vadose Zone Soil | VQEILRDLRGPNSQMNTRTTIVLSTLFEKPGFIPTEPD* |
| Ga0134036_10783751 | 3300012384 | Grasslands Soil | ILKVAAPDLESLQGILRDLRGPAAKTQMSTRTTIVLGTVFEKPGFIPVEPD* |
| Ga0134048_11227472 | 3300012400 | Grasslands Soil | CYILKVAAPDLESLQGILRDLRGPSAKMQMSTRTTIVLGTVFEKAGFVPVELD* |
| Ga0134059_13284582 | 3300012402 | Grasslands Soil | ESLQGILRDLRGPAAKTQMSTRTTIVLGTVFEKPGFTPVEPD* |
| Ga0134060_14033292 | 3300012410 | Grasslands Soil | PDLESLQGILRDLRGPAAKTQMSTRTTIVLGTVFEKPGFIPVEPD* |
| Ga0137398_105627302 | 3300012683 | Vadose Zone Soil | LEGVQEILRDLRGPNSQMNTRTTIVLSTLFEKPGFIPTEPD* |
| Ga0137397_101341421 | 3300012685 | Vadose Zone Soil | DLEGVQEILRDLRGPNAQMNTRTTIVLSTLFEKPGLIPTEPD* |
| Ga0137396_110704402 | 3300012918 | Vadose Zone Soil | EGVQDILRDLRGPNQTMNTRTTIVLSTLYEKPGLVLTEPD* |
| Ga0137394_109856821 | 3300012922 | Vadose Zone Soil | KVAAPDLERLQDLLRDLRGPSPTVEMSTRTTIVLGTVFEKPGFVPTELD* |
| Ga0137410_100646395 | 3300012944 | Vadose Zone Soil | DCYVLKVAAPDLERLQDLLRDLRGPSPTVEMSTRTTIVLGTVFEKPGFVPTELD* |
| Ga0134077_105573141 | 3300012972 | Grasslands Soil | RLQDLLRDLRGPSPTVEMSTRTTIVLGTVFEKPGFVPTELD* |
| Ga0134087_104822991 | 3300012977 | Grasslands Soil | PDLERLQDLLRDLRGPSPTVEMSTRTTIVLGTVFEKPGFVPTELD* |
| Ga0137409_105651491 | 3300015245 | Vadose Zone Soil | GVQDVLRDLRGPNSQMNTRTTIVLSTLFEKPGLIPTEPD* |
| Ga0134072_100409772 | 3300015357 | Grasslands Soil | AAPDLESLQGILRDLRGPAAKTQMSTRTTIVLGTVFEKPGFIPVEPD* |
| Ga0134085_103724902 | 3300015359 | Grasslands Soil | APDLEGVQAILRDLRGPNSQMNTRTTIVLSTLFEKPGFIPAEPD* |
| Ga0132257_1034844031 | 3300015373 | Arabidopsis Rhizosphere | KVAAPDLESLQGLLRDLRGPSRQARMDTRTTIVLSTLFEKPGFVPVELD* |
| Ga0134112_100768793 | 3300017656 | Grasslands Soil | YILKVVAPDLEGVQEILRDLRGPNSQMNTRTTIVLSTLFEKPGFIPTEPD |
| Ga0134112_101424571 | 3300017656 | Grasslands Soil | LKVVAPDLEGVQAILRDLRGPNSQMNTRTTIVLSTLFEKPGFIPTEPD |
| Ga0134112_102411862 | 3300017656 | Grasslands Soil | VAAPDLERLQDLLRDLRGPSPTVEMNTRTTIVLGTVFEKPGFVPTELD |
| Ga0134112_104806081 | 3300017656 | Grasslands Soil | YILKVAAPDIESLQGVLRDLRGPGKKEMNTRTTIVLGTVFEKPGFTPVEPD |
| Ga0066669_106954871 | 3300018482 | Grasslands Soil | LQDLLRDLRGPSPTVEMSTRTTIVLGTVFEKPGFVPTELD |
| Ga0066669_107857612 | 3300018482 | Grasslands Soil | YMLKVAAPDLESLQGVLKDLRGSSKTQMSTRTTIVLGTVFEKPGFIPVEPD |
| Ga0184646_14123642 | 3300019259 | Groundwater Sediment | EGVQEILRDLRGPNSQMNTRTTIVLSTLFEKPGFIPTEPY |
| Ga0137408_11436512 | 3300019789 | Vadose Zone Soil | RDLRGPSPTVEMNTRTTIVLGTVFEKPGFVPTELD |
| Ga0222623_101729892 | 3300022694 | Groundwater Sediment | DLEGVQDVLRDLRGPNSQMNTRTTIVLSTVFEKPGLIPTEPD |
| Ga0209320_103903281 | 3300025155 | Soil | RFPQTRMGVQEILRDLHGPNAQMNTRTTIVLSTLFEKPGLIPTEPD |
| Ga0207664_103435631 | 3300025929 | Agricultural Soil | DLESLQGLLRDLRGPSRQARMDTRTTIVLSTLFEKPGFVPVELD |
| Ga0209235_12509571 | 3300026296 | Grasslands Soil | ILKVVAPDLEGVQEILRDLRGPNSQMNTRTTIVLSTLFEKPGFLATEPD |
| Ga0209236_10201991 | 3300026298 | Grasslands Soil | VAPDLEGVQTILRDLRGPNPQMNTRTTIVLSTLFEKPGFIPTEPD |
| Ga0209027_10001191 | 3300026300 | Grasslands Soil | DLESLQGVLRDLRGSSKTQMSTRTTIVLGTVFEKPGFIPVEPD |
| Ga0209469_11163871 | 3300026307 | Soil | YILKVAAPDLERLQDLLRDLRGPSPSVEMSTRTTIVLGTVFEKPGFVPTELD |
| Ga0209239_10420171 | 3300026310 | Grasslands Soil | VLKVAAPDLERLQDLLRDLRGPSPTVEMNTRTTIVLGTVFEKPGFVPTELD |
| Ga0209239_11988181 | 3300026310 | Grasslands Soil | PDLERLQDLLRDLRGPSPTVEMSTRTTIVLGTVFEKPGFVPTELD |
| Ga0209239_12526201 | 3300026310 | Grasslands Soil | DLEGVQAILRDLRGPNAQMNTRTTIVLSTLFEKQGFIPTEPD |
| Ga0209686_10404322 | 3300026315 | Soil | LKDLRGSSKTQMSTRTTIVLGTVFEKPGFIPVEPD |
| Ga0209471_10730181 | 3300026318 | Soil | LKVAAPDLESLQGVLKDLRGSSKTQMSTRTTIVLGTVFEKPGFIPVEPD |
| Ga0209152_100178865 | 3300026325 | Soil | GVLKDLRGSSKTQMSTRTTIVLGTVFEKPGFIPMEPD |
| Ga0209266_11889852 | 3300026327 | Soil | PDLERLQDLLRDLRGPSPTVEMNTRTTIVLGTVFEKPGFVPTELD |
| Ga0209375_11639752 | 3300026329 | Soil | CYMLKVAAPDLESLQGVLKDLRGSSKTQMSTRTTIVLGTVFEKPGFIPVEPD |
| Ga0209804_12894391 | 3300026335 | Soil | DLERLQDLLRDLRGPSPTVEMNTRTTIVLGTVFEKPGFVPTELD |
| Ga0209808_12768851 | 3300026523 | Soil | LQGLLRDLRGPGKKEMSTRTTIVLGTVFEKPGFTPVEPD |
| Ga0209156_101213331 | 3300026547 | Soil | APDLESLQGVLKDLRGSSKTQMSTRTTIVLGTVFEKPGFIPVEPD |
| Ga0209161_101027571 | 3300026548 | Soil | VQEILRDLRGPNPQMNTRTTIVLSTLFEKPGFIPTEPD |
| Ga0209588_10380714 | 3300027671 | Vadose Zone Soil | LRDLRGPSPTVEMNTRTTIVLGTVFEKPGFVPTELD |
| Ga0209178_11935212 | 3300027725 | Agricultural Soil | QKLLGDLRGPSPSPQMSTRTTIVLGTVFEKPGFVPAELD |
| Ga0209178_14199571 | 3300027725 | Agricultural Soil | LQSLLRDLRGPGSHSRMDTRTTIVLSTLFEKPGFVPVEPD |
| Ga0209283_105219492 | 3300027875 | Vadose Zone Soil | YVLKVAAPDLERLQDLLRDLRGPSPTIEMNTRTTIVLGTVFEKPGFVPTELD |
| Ga0209488_103392511 | 3300027903 | Vadose Zone Soil | VVAPDLDGLQAILRDLVGGGDQQLNTRTTIVLNTVFEKSGLTIPEAD |
| Ga0307293_102259932 | 3300028711 | Soil | PDLEGVQAVLRDLRGPNSQMNTRTTIVLSTVFEKPGFIPTEPD |
| Ga0307471_1003678941 | 3300032180 | Hardwood Forest Soil | APDLESLQTLLRDLRGPGSHSRMDTRTTIVLSTLFEKPGFVPMEPD |
| Ga0307471_1005036771 | 3300032180 | Hardwood Forest Soil | EILRDLRGPNSQMNTRTTIVLSTLFEKPGFMPTEPD |
| Ga0307472_1000163361 | 3300032205 | Hardwood Forest Soil | LLRDLRGPSRQARMDTRTTIVLSTLFEKPGFVPVELD |
| Ga0307472_1011850181 | 3300032205 | Hardwood Forest Soil | YVLKVAAPDLERLQDLLRDLRGPSPTVEMNTRTTIVLGTVFEKPGFVPTELD |
| Ga0335080_106523471 | 3300032828 | Soil | AKDLEGIQAILRTLAGSPKQLNTKTTIVLSTLFEKPALTVPGED |
| Ga0335083_107748401 | 3300032954 | Soil | DLLRDVRGATEPGPLSTRTTIVLSTLFEKPGLVPGGAT |
| Ga0364928_0149902_1_138 | 3300033813 | Sediment | VAGDLEGVQSILRDLRGPNSQMNTRTTIVLSTVFEKPGFLPTEPD |
| Ga0364932_0252303_3_110 | 3300034177 | Sediment | VLRDLRGPNSQMNTRTTIVLSTVFEKPGFIPTEPD |
| Ga0364934_0214787_3_119 | 3300034178 | Sediment | VQAVLRDLRGPNGQMNTRTTIVLSTLFEKPGLIPTEPD |
| ⦗Top⦘ |