


| Basic Information | |
|---|---|
| Family ID | F083910 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 112 |
| Average Sequence Length | 40 residues |
| Representative Sequence | EGKQVQVEDIRPSYAAVNVIEKALARYQKEREHLRAKDGH |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 112 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.68 % |
| % of genes near scaffold ends (potentially truncated) | 97.32 % |
| % of genes from short scaffolds (< 2000 bps) | 91.96 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.536 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (25.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.571 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.214 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.18% β-sheet: 0.00% Coil/Unstructured: 58.82% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 112 Family Scaffolds |
|---|---|---|
| PF00837 | T4_deiodinase | 48.21 |
| PF01479 | S4 | 8.93 |
| PF01202 | SKI | 3.57 |
| PF03965 | Penicillinase_R | 2.68 |
| PF00849 | PseudoU_synth_2 | 2.68 |
| PF00719 | Pyrophosphatase | 1.79 |
| PF00251 | Glyco_hydro_32N | 0.89 |
| PF02371 | Transposase_20 | 0.89 |
| PF08281 | Sigma70_r4_2 | 0.89 |
| PF01795 | Methyltransf_5 | 0.89 |
| PF01738 | DLH | 0.89 |
| COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
|---|---|---|---|
| COG0564 | Pseudouridine synthase RluA, 23S rRNA- or tRNA-specific | Translation, ribosomal structure and biogenesis [J] | 2.68 |
| COG1187 | Pseudouridylate synthase RsuA, specific for 16S rRNA U516 and 23S rRNA U2605 | Translation, ribosomal structure and biogenesis [J] | 2.68 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 2.68 |
| COG3682 | Transcriptional regulator, CopY/TcrY family | Transcription [K] | 2.68 |
| COG0221 | Inorganic pyrophosphatase | Energy production and conversion [C] | 1.79 |
| COG0275 | 16S rRNA C1402 N4-methylase RsmH | Translation, ribosomal structure and biogenesis [J] | 0.89 |
| COG1621 | Sucrose-6-phosphate hydrolase SacC, GH32 family | Carbohydrate transport and metabolism [G] | 0.89 |
| COG2152 | Predicted glycosyl hydrolase, GH43/DUF377 family | Carbohydrate transport and metabolism [G] | 0.89 |
| COG3507 | Beta-xylosidase | Carbohydrate transport and metabolism [G] | 0.89 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.54 % |
| Unclassified | root | N/A | 4.46 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_100247289 | All Organisms → cellular organisms → Bacteria | 1672 | Open in IMG/M |
| 3300002914|JGI25617J43924_10124245 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 907 | Open in IMG/M |
| 3300004152|Ga0062386_101440498 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae | 574 | Open in IMG/M |
| 3300004633|Ga0066395_10600589 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 645 | Open in IMG/M |
| 3300005554|Ga0066661_10023525 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3312 | Open in IMG/M |
| 3300005569|Ga0066705_10193298 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1270 | Open in IMG/M |
| 3300005591|Ga0070761_10755558 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300005712|Ga0070764_10992157 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300005764|Ga0066903_102443474 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae | 1011 | Open in IMG/M |
| 3300005841|Ga0068863_100245364 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1729 | Open in IMG/M |
| 3300005921|Ga0070766_10849345 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
| 3300005993|Ga0080027_10462109 | Not Available | 514 | Open in IMG/M |
| 3300006032|Ga0066696_10427030 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 866 | Open in IMG/M |
| 3300006059|Ga0075017_100944943 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300006059|Ga0075017_101506573 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300006804|Ga0079221_10223955 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1048 | Open in IMG/M |
| 3300006806|Ga0079220_11200520 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 626 | Open in IMG/M |
| 3300006806|Ga0079220_11545126 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300007265|Ga0099794_10602559 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300007265|Ga0099794_10740986 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300009038|Ga0099829_11653708 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300009088|Ga0099830_10011285 | All Organisms → cellular organisms → Bacteria | 5472 | Open in IMG/M |
| 3300009088|Ga0099830_10776987 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 790 | Open in IMG/M |
| 3300009088|Ga0099830_10835974 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 760 | Open in IMG/M |
| 3300009090|Ga0099827_11803371 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300009143|Ga0099792_10201245 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1133 | Open in IMG/M |
| 3300010048|Ga0126373_11334750 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 783 | Open in IMG/M |
| 3300010335|Ga0134063_10205646 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 928 | Open in IMG/M |
| 3300010343|Ga0074044_10153653 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1539 | Open in IMG/M |
| 3300010359|Ga0126376_11007469 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 834 | Open in IMG/M |
| 3300010359|Ga0126376_11025336 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 827 | Open in IMG/M |
| 3300010361|Ga0126378_10130006 | All Organisms → cellular organisms → Bacteria | 2537 | Open in IMG/M |
| 3300010361|Ga0126378_11204008 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 855 | Open in IMG/M |
| 3300011120|Ga0150983_15460190 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
| 3300011269|Ga0137392_10711423 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 831 | Open in IMG/M |
| 3300011271|Ga0137393_10707983 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 862 | Open in IMG/M |
| 3300011271|Ga0137393_10875246 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 767 | Open in IMG/M |
| 3300012203|Ga0137399_11351006 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
| 3300012205|Ga0137362_11385450 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300012207|Ga0137381_10515913 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1043 | Open in IMG/M |
| 3300012361|Ga0137360_10781167 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 822 | Open in IMG/M |
| 3300012361|Ga0137360_11072134 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
| 3300012683|Ga0137398_10176898 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1398 | Open in IMG/M |
| 3300012685|Ga0137397_10884815 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 662 | Open in IMG/M |
| 3300012923|Ga0137359_11421787 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300012927|Ga0137416_12017744 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300012929|Ga0137404_10020083 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4805 | Open in IMG/M |
| 3300012930|Ga0137407_12009905 | Not Available | 552 | Open in IMG/M |
| 3300014165|Ga0181523_10181576 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1225 | Open in IMG/M |
| 3300016294|Ga0182041_10002017 | All Organisms → cellular organisms → Bacteria | 10436 | Open in IMG/M |
| 3300016422|Ga0182039_11005065 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 748 | Open in IMG/M |
| 3300017823|Ga0187818_10363091 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
| 3300017933|Ga0187801_10017578 | All Organisms → cellular organisms → Bacteria | 2401 | Open in IMG/M |
| 3300017943|Ga0187819_10131295 | All Organisms → cellular organisms → Bacteria | 1493 | Open in IMG/M |
| 3300017955|Ga0187817_10573226 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300017961|Ga0187778_10494974 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 811 | Open in IMG/M |
| 3300017995|Ga0187816_10219472 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300018007|Ga0187805_10194640 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 925 | Open in IMG/M |
| 3300018086|Ga0187769_10575958 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 851 | Open in IMG/M |
| 3300020006|Ga0193735_1006002 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3882 | Open in IMG/M |
| 3300020199|Ga0179592_10339757 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 662 | Open in IMG/M |
| 3300020579|Ga0210407_11251879 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300020580|Ga0210403_10602872 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 887 | Open in IMG/M |
| 3300020581|Ga0210399_10518258 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 990 | Open in IMG/M |
| 3300021086|Ga0179596_10594009 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
| 3300021088|Ga0210404_10218777 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1027 | Open in IMG/M |
| 3300021168|Ga0210406_10923995 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300021170|Ga0210400_11309333 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
| 3300021171|Ga0210405_10192451 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1617 | Open in IMG/M |
| 3300021171|Ga0210405_10313473 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1239 | Open in IMG/M |
| 3300021181|Ga0210388_10132500 | All Organisms → cellular organisms → Bacteria | 2155 | Open in IMG/M |
| 3300021478|Ga0210402_11237151 | Not Available | 674 | Open in IMG/M |
| 3300021479|Ga0210410_10696859 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300021559|Ga0210409_10437310 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1167 | Open in IMG/M |
| 3300021560|Ga0126371_11180456 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300022726|Ga0242654_10338989 | Not Available | 563 | Open in IMG/M |
| 3300026296|Ga0209235_1059052 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1801 | Open in IMG/M |
| 3300026301|Ga0209238_1003924 | All Organisms → cellular organisms → Bacteria | 5956 | Open in IMG/M |
| 3300026328|Ga0209802_1305823 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300026361|Ga0257176_1020899 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 946 | Open in IMG/M |
| 3300026530|Ga0209807_1321706 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300026552|Ga0209577_10202333 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1524 | Open in IMG/M |
| 3300026557|Ga0179587_10319854 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1002 | Open in IMG/M |
| 3300027528|Ga0208985_1069237 | Not Available | 681 | Open in IMG/M |
| 3300027643|Ga0209076_1038191 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1349 | Open in IMG/M |
| 3300027671|Ga0209588_1068707 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1145 | Open in IMG/M |
| 3300027727|Ga0209328_10182214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → Pseudorhodoplanes sinuspersici | 635 | Open in IMG/M |
| 3300027853|Ga0209274_10560037 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300027895|Ga0209624_10845420 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 599 | Open in IMG/M |
| 3300027903|Ga0209488_11041151 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300028138|Ga0247684_1033786 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 816 | Open in IMG/M |
| 3300030056|Ga0302181_10517778 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300030521|Ga0307511_10399306 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
| 3300031240|Ga0265320_10530971 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300031573|Ga0310915_10721357 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 703 | Open in IMG/M |
| 3300031679|Ga0318561_10115259 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1424 | Open in IMG/M |
| 3300031720|Ga0307469_11789662 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300031753|Ga0307477_10121118 | All Organisms → cellular organisms → Bacteria | 1824 | Open in IMG/M |
| 3300031754|Ga0307475_11204743 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300031763|Ga0318537_10111895 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1013 | Open in IMG/M |
| 3300031781|Ga0318547_10741254 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300031910|Ga0306923_10532811 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1325 | Open in IMG/M |
| 3300032180|Ga0307471_103363126 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300032205|Ga0307472_100503420 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1045 | Open in IMG/M |
| 3300032205|Ga0307472_101358612 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300032261|Ga0306920_102999410 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 637 | Open in IMG/M |
| 3300032893|Ga0335069_11685395 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
| 3300032954|Ga0335083_10285194 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1458 | Open in IMG/M |
| 3300033134|Ga0335073_10552171 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1300 | Open in IMG/M |
| 3300033158|Ga0335077_11909417 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300033289|Ga0310914_10347178 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1342 | Open in IMG/M |
| 3300033289|Ga0310914_10810414 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 835 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 25.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.75% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.36% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.36% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.36% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.46% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.57% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.57% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.57% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.68% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.68% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.79% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.79% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.79% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.89% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.89% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.89% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.89% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.89% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026361 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-B | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027528 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028138 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25 | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Host-Associated | Open in IMG/M |
| 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Host-Associated | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1002472893 | 3300002245 | Forest Soil | GKLVEVEDIKPAYAAVTVIERALARYQQEREKLIAKAGS* |
| JGI25617J43924_101242451 | 3300002914 | Grasslands Soil | QLEGKQVQVDDIRPAYAAVKVIETALARYKEQRETLRAKDRR* |
| Ga0062386_1014404982 | 3300004152 | Bog Forest Soil | KQLEGKQVQVEDIRPAYAALNIIEKSLARYTAQREQLRASADY* |
| Ga0066395_106005891 | 3300004633 | Tropical Forest Soil | EGKQVQVEDIRPASAAVKVIEKALARYQKEREHLRVKAGD* |
| Ga0066661_100235256 | 3300005554 | Soil | GKEVRVDDIRPAYAAVKVIENALARYKAQREALRAKDQR* |
| Ga0066705_101932983 | 3300005569 | Soil | LEGKKVEVEDIRPAYAAVTVIERALARYQQERDRLTGKVTPK* |
| Ga0070761_107555582 | 3300005591 | Soil | LLEGKKVEVEEIRPAYAALTVIERSLARYKAEREHLLAKDAHK* |
| Ga0070764_109921571 | 3300005712 | Soil | KKVEVEEIRPAYAALNVIERSLARYKAEREHLLAKDAHK* |
| Ga0066903_1024434743 | 3300005764 | Tropical Forest Soil | QDYKQLEGKQVQVEDIRPAYAAANVIEKALTRYKKEREHLRAKDHR* |
| Ga0068863_1002453645 | 3300005841 | Switchgrass Rhizosphere | LEGKKVEVEDIRPAYAAVTVIERALARYQQERDWLTGKLAVK* |
| Ga0070766_108493451 | 3300005921 | Soil | KLLEGKKVEVEEIRPAYAALTVIERSLARYKAEREHLLVKDARK* |
| Ga0080027_104621091 | 3300005993 | Prmafrost Soil | GKKVEVEDIRPAYAALTVIERALARYQQEKEKLLAEIGRSAERHG* |
| Ga0066696_104270301 | 3300006032 | Soil | EGKEVRVDDIRPAYAAVKVIENALARYKAQREALRAKDQR* |
| Ga0075017_1009449431 | 3300006059 | Watersheds | YKELEGKKVQVDDIRPAYAAAKVIEKALARYQEQREALRAKDKR* |
| Ga0075017_1015065731 | 3300006059 | Watersheds | GKQVQVEDIKPAYAAMNVIERALTRYRALREQLREEHHCPGDS* |
| Ga0079221_102239551 | 3300006804 | Agricultural Soil | LEGKQVQVEEIRPAYAALSVIEKSLNRYREHRAELLKKEGRS* |
| Ga0079220_112005201 | 3300006806 | Agricultural Soil | YKQLEGKKVEVEDIRPAYAAVAVIERSLARYRAEREHLLATDERT* |
| Ga0079220_115451262 | 3300006806 | Agricultural Soil | EGKQVQVEDIRPAYAAVKVIENALARYKKERDKLRLKDGH* |
| Ga0099794_106025591 | 3300007265 | Vadose Zone Soil | VEDIRPAYAAVKVIEKSLARYKEQKETLRAKDRR* |
| Ga0099794_107409861 | 3300007265 | Vadose Zone Soil | KQLEGKQVQVEDIRPAYAAIKVIENSLARYNEQRETLRAKDHL* |
| Ga0099829_116537081 | 3300009038 | Vadose Zone Soil | VKQVQVDDIRPAYAAVKVIEQALARYKEQRETLRAKDLR* |
| Ga0099830_100112859 | 3300009088 | Vadose Zone Soil | DYKQLEGKQVQVEDILPAYAAVKVIENALARYKEQREALRAKDHR* |
| Ga0099830_107769873 | 3300009088 | Vadose Zone Soil | VQVEDIRPAYAAMNIIEKSLARYTALRDELRASANY* |
| Ga0099830_108359741 | 3300009088 | Vadose Zone Soil | LEGKQVQVDDIRPAYAAVTVIEKALARYKAQSEPLRAKEHH* |
| Ga0099827_118033711 | 3300009090 | Vadose Zone Soil | VQVDDIRPAYAAVKVIEKALAQYKEKRESLRAKDGH* |
| Ga0099792_102012454 | 3300009143 | Vadose Zone Soil | LEGKRVEVEDIRPAYAALTVIERALARYKQEREKLMEKNVK* |
| Ga0126373_113347501 | 3300010048 | Tropical Forest Soil | KQLEGKQVQVEDIRPAYAALSVIEKALARYKALRDELRSAIGS* |
| Ga0134063_102056461 | 3300010335 | Grasslands Soil | YKQLEGKEVRVDDIRPAYAAVKVIENALARYKAQREALRAKDQR* |
| Ga0074044_101536534 | 3300010343 | Bog Forest Soil | VEVEEIRPAYAALNVIEKALASYKAERERLLPKGYHK* |
| Ga0126376_110074691 | 3300010359 | Tropical Forest Soil | VEDIRPAYAAANVIEKALARYKQERARLRAMDNH* |
| Ga0126376_110253361 | 3300010359 | Tropical Forest Soil | YKQLEGKKVEVEDIRPAYAAVTVIERALARYQKEKDILLGKLAAR* |
| Ga0126378_101300064 | 3300010361 | Tropical Forest Soil | GKAVQVEEIRPAYAAAAIIERSLARYHEHRKELLKRDAHG* |
| Ga0126378_112040081 | 3300010361 | Tropical Forest Soil | EGKQVQVEDIRPSYAAVNVIEKALARYQKEREHLRAKDGH* |
| Ga0150983_154601901 | 3300011120 | Forest Soil | KLLEGKKVEVEEIRPAYAALTVIERSLARYKAEREHLLAKDARK* |
| Ga0137392_107114231 | 3300011269 | Vadose Zone Soil | QLEGKQVQVEDIRPAYAAIKVIENSLARYKQERDKLRAKDGR* |
| Ga0137393_107079833 | 3300011271 | Vadose Zone Soil | VQVEDIRPAYAAVNVIEKALARYQQQREQLRAKDKG* |
| Ga0137393_108752461 | 3300011271 | Vadose Zone Soil | GKQVQVDDIRPAYAAIKVIEKALAQYEEKREILRAKDGH* |
| Ga0137399_113510061 | 3300012203 | Vadose Zone Soil | YKQLEGKQVQVEDIRPAYAAVKVIEKSLARYKEQRETLRAKDRH* |
| Ga0137362_113854502 | 3300012205 | Vadose Zone Soil | VQVEDIRPAYAAMNIIEKSLARYTALREELRASANY* |
| Ga0137381_105159131 | 3300012207 | Vadose Zone Soil | KQVQVEDIRPAYAAVKVIENALARYKRERDKLRSKDGRE* |
| Ga0137360_107811673 | 3300012361 | Vadose Zone Soil | VQVDDIRPAYAAVTVIEKALARYKEQSAALRAKERH* |
| Ga0137360_110721341 | 3300012361 | Vadose Zone Soil | GKQVQVDDIRPAYAAVKVIENALARYQDQRETLRAKDHR* |
| Ga0137398_101768981 | 3300012683 | Vadose Zone Soil | QLEGKQVQVDDIRPAYAAVKVIEKALAQYKEKREMLRAKDGH* |
| Ga0137397_108848151 | 3300012685 | Vadose Zone Soil | KQLEGKQVQVEDIRPAYAAVKVIEQSLARYKEQRETLRAKGRH* |
| Ga0137359_114217871 | 3300012923 | Vadose Zone Soil | EVEDIRPAYAAITVIERALARYQQEREKLLSKEAG* |
| Ga0137416_120177442 | 3300012927 | Vadose Zone Soil | YKQLEGKQVQVEDIRPAYAAVKVIENALARYKEQRGTLRAKDQR* |
| Ga0137404_100200837 | 3300012929 | Vadose Zone Soil | LEGKKVEVEDIRPAYAALTVIERALARYQQEREKLMSNVSR* |
| Ga0137407_120099052 | 3300012930 | Vadose Zone Soil | YKQLEGRQVQVEDIRPAYAALNIIEKSLARYAALRDQRRASANY* |
| Ga0181523_101815761 | 3300014165 | Bog | KQVQVEDIKPAYAAMNIIEKSLARYKALRDQLRADAH* |
| Ga0182041_100020171 | 3300016294 | Soil | DYKQLEGKQVQVEGIRSAHAAVKVIEKALARYKKERDRLRAQDAR |
| Ga0182039_110050653 | 3300016422 | Soil | YKQLEGKQVQVEDIRPAYAAMSVIDKALTRYNALREQLRAEQF |
| Ga0187818_103630912 | 3300017823 | Freshwater Sediment | VQVEDIRPAYAAVNVIEKALGRYKEHREALRAKDRQ |
| Ga0187801_100175785 | 3300017933 | Freshwater Sediment | QVQVEDIRPAYAAANIIDKALARYKVLRDELRAAHQ |
| Ga0187819_101312952 | 3300017943 | Freshwater Sediment | VQVEDIRPAYAAVNVIEKALARYKEHREALRAKDRQ |
| Ga0187817_105732261 | 3300017955 | Freshwater Sediment | KQLEGKQVQVEDIRPAYAAVNVIEKALARYKENRDTLRAADNC |
| Ga0187778_104949743 | 3300017961 | Tropical Peatland | EGKQVQVEDIRPAYAAANVIERALASYKEHREALRAKDSR |
| Ga0187816_102194722 | 3300017995 | Freshwater Sediment | EGKQVQVEDIRPAYAAVNVIEKALARYKENRDTLRAADNC |
| Ga0187805_101946401 | 3300018007 | Freshwater Sediment | YKQLEGKQVQVEDIKPAYAAINVIEKALNRYKAMRDELLAGHH |
| Ga0187769_105759583 | 3300018086 | Tropical Peatland | KQVQVEDIRPAYAAVNVIEKALARYKEHRKELRAKDGY |
| Ga0193735_10060027 | 3300020006 | Soil | KEVRVDDIRPAYAAVKVIENALARYRDQREVLRAKDHH |
| Ga0179592_103397571 | 3300020199 | Vadose Zone Soil | QVEDIRPAYAAMNIIEKSLARYTALREELRASADY |
| Ga0210407_112518791 | 3300020579 | Soil | LEGKQVQVDDIRPAYAAVKVIEQALARYKDQRQTLRAKDHL |
| Ga0210403_106028723 | 3300020580 | Soil | QVQVEDIRPAYAAMNIIEKSLARYAALRDQLRASANY |
| Ga0210399_105182584 | 3300020581 | Soil | QDYKQLEGKQVQVEDIKPAYAALVVIEKALALYQQLRDKLIAGEPH |
| Ga0179596_105940092 | 3300021086 | Vadose Zone Soil | QVDDIRPAYAAVKVIEKALAQYKEKREILRAKDGH |
| Ga0210404_102187773 | 3300021088 | Soil | KVEVEEIRPAYAALTVIERSLARYKAEREHLLAKDARK |
| Ga0210406_109239951 | 3300021168 | Soil | QVQVEEIRPAYAAVNVIEKSLARYQQERSRLRARDGQ |
| Ga0210400_113093331 | 3300021170 | Soil | QLEGKRVEVEDIRPAYAALTVIERSLARYQQERDRLIAKAAAK |
| Ga0210405_101924511 | 3300021171 | Soil | LEGIKVEVEDIRPAYAALTVIERSLARYQQEREKLLPKISRP |
| Ga0210405_103134731 | 3300021171 | Soil | LPNHRLLDIKPAYAALVVIERALARYQQLRDKLIAGEPH |
| Ga0210388_101325001 | 3300021181 | Soil | KQLEGKKVEVEDIRPAYAAITVIERALARYQQERDQLLPKISRP |
| Ga0210402_112371511 | 3300021478 | Soil | SDYKQLEGKKVEVEDIRPAYAAITVIERALASYQRHRDELRTHDSR |
| Ga0210410_106968592 | 3300021479 | Soil | KQLEGKQVQVEDIRPAYAAVNVIEKALARYKQERGRLMAKDGL |
| Ga0210409_104373104 | 3300021559 | Soil | KQVQVEDIRPAYAALVVIERALARYQQLRDKLIAGEPH |
| Ga0126371_111804561 | 3300021560 | Tropical Forest Soil | GKAVQVEEIRPAYAAAAIIERSLARYHEHRKELLKRDAHG |
| Ga0242654_103389891 | 3300022726 | Soil | VQVEDIRPAYAAMNIIEKSLARYTALRDQLRASADY |
| Ga0209235_10590521 | 3300026296 | Grasslands Soil | DYKQLEGKQVQVEDIRPAYAAATVIEKALARYKQERDKLRSKDGRG |
| Ga0209238_10039246 | 3300026301 | Grasslands Soil | QVDDIRPAYAAAEVIEKALARYKDQREALRAKDHR |
| Ga0209802_13058232 | 3300026328 | Soil | QVQVEDIRPAYAAVKVIENALARYKKERDKLRSKDGHG |
| Ga0257176_10208991 | 3300026361 | Soil | EGKQVRVDDIRPAYAAVKVIENALARYKDQREALRAKDLR |
| Ga0209807_13217061 | 3300026530 | Soil | KQLEGKKVEVEDIRPAYAAVTVIERALARYQQERDRLTGKVTPK |
| Ga0209577_102023331 | 3300026552 | Soil | KQLEGKQVQVEDIRPAYAAIKVIENSLARYKQERNKLRAKDGR |
| Ga0179587_103198541 | 3300026557 | Vadose Zone Soil | VQVEDIRPAYAAMNIIEKSLARYTALREELRASADY |
| Ga0208985_10692371 | 3300027528 | Forest Soil | GGKKVEVEDIRPAYAALTVIERALARYQQEREKLLNKVNRT |
| Ga0209076_10381914 | 3300027643 | Vadose Zone Soil | GKQVQVEDIRPAYAAIKVIENSLARYNEQRETLRAKDHL |
| Ga0209588_10687071 | 3300027671 | Vadose Zone Soil | LEGKQVQVEDIRPAYAAVKVIEQSLARYKEQRETLRAKGRH |
| Ga0209328_101822141 | 3300027727 | Forest Soil | KQLEGKRVEVEDIRPAYAAVTVIERSLARYQQEREKLIAKEGR |
| Ga0209274_105600371 | 3300027853 | Soil | LLEGKKVEVEEIRPAYAALTVIERSLARYKAEREHLLAKDAHK |
| Ga0209624_108454202 | 3300027895 | Forest Soil | GKRVEVEDIRPAYAALTVIERSLARYQQERDRLIAKAAAK |
| Ga0209488_110411512 | 3300027903 | Vadose Zone Soil | RLHRGKRVEVEDIRPAYAAITVIERALARYQQERERLLSKEGG |
| Ga0247684_10337861 | 3300028138 | Soil | GKKVEVEEIRPAYAALTVIERALARYKAERDHLLAKDAHAGSQSAH |
| Ga0302181_105177781 | 3300030056 | Palsa | QLEGKQVQVEEIRPAYAALAVIEKSLARYQQNREHLLANAGQ |
| Ga0307511_103993062 | 3300030521 | Ectomycorrhiza | LEGKRVEVEDIRPAYAALTVIERSLARYQQEKDKLTANLVPK |
| Ga0265320_105309711 | 3300031240 | Rhizosphere | KLLEGKKVEVEEIRPAYAALNVIERSLARYKAEREHLLAKDARK |
| Ga0310915_107213571 | 3300031573 | Soil | GKQVQVEDIRPAYAAMSVIDKALTRYNALREQLRAEQF |
| Ga0318561_101152591 | 3300031679 | Soil | QDYKQLEGKQVQVEGIRSAHAAVKVIEKALARYKKERDRLRAKDAR |
| Ga0307469_117896623 | 3300031720 | Hardwood Forest Soil | VQVEDIKPAYAALVVIEKALARYQQLRDKLIAGEPH |
| Ga0307477_101211181 | 3300031753 | Hardwood Forest Soil | RVEVEDIRPAYAAVTVIERSLARYQQEREKLIAKGGR |
| Ga0307475_112047432 | 3300031754 | Hardwood Forest Soil | VEEIRPAYAALTVIERSLARYKAEREHLLAKDVCK |
| Ga0318537_101118953 | 3300031763 | Soil | QVQVEGIRSAHAAVKVIEKALARYKKERDRLRAKDAR |
| Ga0318547_107412542 | 3300031781 | Soil | AVQVEEIRPAYAALTIIERALARYQEKREELRHERAL |
| Ga0306923_105328114 | 3300031910 | Soil | YKQLEGKQVQVEDIRPAYAALSVIDKALARYKALRDELRNAISS |
| Ga0307471_1033631262 | 3300032180 | Hardwood Forest Soil | EGKRVEVEDIRPAYAAITVIERALARYQQERERLLSKEAG |
| Ga0307472_1005034203 | 3300032205 | Hardwood Forest Soil | KRVEVEDIRPAYAAATVIERALARYKQEREKLIAKANG |
| Ga0307472_1013586121 | 3300032205 | Hardwood Forest Soil | QLEGKKVEVEDIRPAYAAVTVIERALARYQQEKDTFIAKLASR |
| Ga0306920_1029994101 | 3300032261 | Soil | KQLEGQQVQVEDMRPRSAAVNVIEKVLARYPKEREYLRDKDGQ |
| Ga0335069_116853951 | 3300032893 | Soil | KQLEGKQVQVEDIRPAYAALNIIEKSLARYQALRDELVAAR |
| Ga0335083_102851941 | 3300032954 | Soil | QVQVEDIKPSYAAINVIEKALARYRALREDLIAGKDH |
| Ga0335073_105521711 | 3300033134 | Soil | QLEGKQVQVEDIRPAYAAANIIEKALARYKALRDELRSPAHA |
| Ga0335077_119094171 | 3300033158 | Soil | YKQLEGKQVQVEDIKPAYAAINVIEKALARYKQLREKLRAGYS |
| Ga0310914_103471784 | 3300033289 | Soil | GKQVQVEDIRPAYAALSVIDKALARYKALRDELRNAISS |
| Ga0310914_108104141 | 3300033289 | Soil | GKQVHVEDIRPAYAATSIIEKALLRYQALRDDLRAVHT |
| ⦗Top⦘ |