


| Basic Information | |
|---|---|
| Family ID | F083878 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 112 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MLKNFLARLRWGSLSPEQKEELKTLPLSAVFSRPYLAPKLHKHY |
| Number of Associated Samples | 70 |
| Number of Associated Scaffolds | 112 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 7.14 % |
| % of genes near scaffold ends (potentially truncated) | 33.93 % |
| % of genes from short scaffolds (< 2000 bps) | 66.07 % |
| Associated GOLD sequencing projects | 57 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Predicted Viral (45.536 % of family members) |
| NCBI Taxonomy ID | 10239 (predicted) |
| Taxonomy | All Organisms → Viruses → Predicted Viral |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (41.071 % of family members) |
| Environment Ontology (ENVO) | Unclassified (49.107 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (83.929 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.06% β-sheet: 0.00% Coil/Unstructured: 56.94% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 112 Family Scaffolds |
|---|---|---|
| PF08534 | Redoxin | 29.46 |
| PF00504 | Chloroa_b-bind | 16.96 |
| PF00111 | Fer2 | 13.39 |
| PF00124 | Photo_RC | 6.25 |
| PF13098 | Thioredoxin_2 | 6.25 |
| PF00127 | Copper-bind | 5.36 |
| PF03641 | Lysine_decarbox | 1.79 |
| PF13529 | Peptidase_C39_2 | 0.89 |
| PF00535 | Glycos_transf_2 | 0.89 |
| PF00596 | Aldolase_II | 0.89 |
| PF01755 | Glyco_transf_25 | 0.89 |
| PF04966 | OprB | 0.89 |
| PF12322 | T4_baseplate | 0.89 |
| PF13385 | Laminin_G_3 | 0.89 |
| PF00565 | SNase | 0.89 |
| PF02709 | Glyco_transf_7C | 0.89 |
| PF04820 | Trp_halogenase | 0.89 |
| PF05996 | Fe_bilin_red | 0.89 |
| COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
|---|---|---|---|
| COG1611 | Nucleotide monophosphate nucleosidase PpnN/YdgH, Lonely Guy (LOG) family | Nucleotide transport and metabolism [F] | 1.79 |
| COG3306 | Glycosyltransferase involved in LPS biosynthesis, GR25 family | Cell wall/membrane/envelope biogenesis [M] | 0.89 |
| COG3659 | Carbohydrate-selective porin OprB | Cell wall/membrane/envelope biogenesis [M] | 0.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.21 % |
| Unclassified | root | N/A | 26.79 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000116|DelMOSpr2010_c10000737 | Not Available | 20503 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10264701 | Not Available | 517 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_106688005 | Not Available | 506 | Open in IMG/M |
| 3300001830|ACM40_1030902 | Not Available | 534 | Open in IMG/M |
| 3300005805|Ga0079957_1085588 | All Organisms → Viruses → Predicted Viral | 1766 | Open in IMG/M |
| 3300005805|Ga0079957_1241697 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 843 | Open in IMG/M |
| 3300006025|Ga0075474_10017372 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 2650 | Open in IMG/M |
| 3300006026|Ga0075478_10218674 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 578 | Open in IMG/M |
| 3300006810|Ga0070754_10009740 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 6123 | Open in IMG/M |
| 3300006810|Ga0070754_10138222 | All Organisms → Viruses | 1174 | Open in IMG/M |
| 3300006810|Ga0070754_10152190 | All Organisms → Viruses → Predicted Viral | 1105 | Open in IMG/M |
| 3300006810|Ga0070754_10156702 | All Organisms → Viruses → Predicted Viral | 1084 | Open in IMG/M |
| 3300006868|Ga0075481_10218889 | Not Available | 677 | Open in IMG/M |
| 3300006869|Ga0075477_10314880 | Not Available | 620 | Open in IMG/M |
| 3300006870|Ga0075479_10172444 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Tevenvirinae → Tequatrovirus | 876 | Open in IMG/M |
| 3300006870|Ga0075479_10382453 | Not Available | 545 | Open in IMG/M |
| 3300006874|Ga0075475_10018822 | All Organisms → Viruses → Predicted Viral | 3410 | Open in IMG/M |
| 3300006916|Ga0070750_10233081 | All Organisms → Viruses | 804 | Open in IMG/M |
| 3300006916|Ga0070750_10434047 | Not Available | 545 | Open in IMG/M |
| 3300007538|Ga0099851_1000173 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 25980 | Open in IMG/M |
| 3300007538|Ga0099851_1009988 | Not Available | 3900 | Open in IMG/M |
| 3300007538|Ga0099851_1017840 | All Organisms → Viruses → Predicted Viral | 2881 | Open in IMG/M |
| 3300007538|Ga0099851_1269031 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Tevenvirinae → Tequatrovirus | 606 | Open in IMG/M |
| 3300007539|Ga0099849_1078811 | All Organisms → Viruses → Predicted Viral | 1335 | Open in IMG/M |
| 3300007541|Ga0099848_1009657 | All Organisms → Viruses → Predicted Viral | 4281 | Open in IMG/M |
| 3300007541|Ga0099848_1010513 | All Organisms → Viruses → Predicted Viral | 4086 | Open in IMG/M |
| 3300007960|Ga0099850_1121727 | All Organisms → Viruses → Predicted Viral | 1065 | Open in IMG/M |
| 3300009000|Ga0102960_1011525 | All Organisms → Viruses → Predicted Viral | 3339 | Open in IMG/M |
| 3300009000|Ga0102960_1015496 | All Organisms → Viruses → Predicted Viral | 2869 | Open in IMG/M |
| 3300009001|Ga0102963_1012426 | All Organisms → Viruses → Predicted Viral | 3625 | Open in IMG/M |
| 3300009001|Ga0102963_1019353 | All Organisms → Viruses → Predicted Viral | 2874 | Open in IMG/M |
| 3300009124|Ga0118687_10003259 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Cymopoleiavirus → unclassified Cymopoleiavirus → Synechococcus phage S-RSM4 | 5728 | Open in IMG/M |
| 3300009124|Ga0118687_10038285 | All Organisms → Viruses → Predicted Viral | 1587 | Open in IMG/M |
| 3300010296|Ga0129348_1006884 | All Organisms → Viruses → Predicted Viral | 4150 | Open in IMG/M |
| 3300010296|Ga0129348_1042315 | All Organisms → Viruses → Predicted Viral | 1650 | Open in IMG/M |
| 3300010296|Ga0129348_1084800 | All Organisms → Viruses | 1124 | Open in IMG/M |
| 3300010296|Ga0129348_1121955 | Not Available | 911 | Open in IMG/M |
| 3300010297|Ga0129345_1008064 | All Organisms → Viruses → Predicted Viral | 4108 | Open in IMG/M |
| 3300010297|Ga0129345_1062445 | All Organisms → Viruses → Predicted Viral | 1413 | Open in IMG/M |
| 3300010297|Ga0129345_1343166 | Not Available | 514 | Open in IMG/M |
| 3300010299|Ga0129342_1042631 | All Organisms → Viruses → Predicted Viral | 1799 | Open in IMG/M |
| 3300010299|Ga0129342_1049895 | All Organisms → Viruses | 1644 | Open in IMG/M |
| 3300010299|Ga0129342_1064913 | All Organisms → Viruses → Predicted Viral | 1408 | Open in IMG/M |
| 3300010299|Ga0129342_1173934 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 775 | Open in IMG/M |
| 3300010300|Ga0129351_1041663 | All Organisms → Viruses → Predicted Viral | 1890 | Open in IMG/M |
| 3300010318|Ga0136656_1000442 | All Organisms → Viruses | 14457 | Open in IMG/M |
| 3300010354|Ga0129333_10286553 | All Organisms → Viruses → Predicted Viral | 1476 | Open in IMG/M |
| 3300010354|Ga0129333_10355803 | All Organisms → Viruses → Predicted Viral | 1302 | Open in IMG/M |
| 3300010354|Ga0129333_11207380 | Not Available | 628 | Open in IMG/M |
| 3300010389|Ga0136549_10011112 | Not Available | 6003 | Open in IMG/M |
| 3300011268|Ga0151620_1006304 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 4352 | Open in IMG/M |
| 3300011268|Ga0151620_1008358 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Synechococcus phage S-CBM2 | 3741 | Open in IMG/M |
| 3300012504|Ga0129347_1019075 | Not Available | 890 | Open in IMG/M |
| 3300012504|Ga0129347_1069133 | All Organisms → Viruses | 945 | Open in IMG/M |
| 3300012520|Ga0129344_1024085 | All Organisms → Viruses → Predicted Viral | 1401 | Open in IMG/M |
| 3300012520|Ga0129344_1257212 | Not Available | 626 | Open in IMG/M |
| 3300012528|Ga0129352_10441880 | All Organisms → Viruses | 770 | Open in IMG/M |
| 3300012965|Ga0129346_1060174 | Not Available | 992 | Open in IMG/M |
| 3300012966|Ga0129341_1082164 | Not Available | 612 | Open in IMG/M |
| 3300012967|Ga0129343_1036228 | All Organisms → Viruses → Predicted Viral | 2909 | Open in IMG/M |
| 3300012967|Ga0129343_1114736 | All Organisms → Viruses → Predicted Viral | 1128 | Open in IMG/M |
| 3300012967|Ga0129343_1164535 | All Organisms → Viruses → Predicted Viral | 1172 | Open in IMG/M |
| 3300017949|Ga0181584_10218612 | All Organisms → Viruses → Predicted Viral | 1246 | Open in IMG/M |
| 3300017949|Ga0181584_10309058 | All Organisms → Viruses → Predicted Viral | 1009 | Open in IMG/M |
| 3300017949|Ga0181584_10454933 | Not Available | 794 | Open in IMG/M |
| 3300017952|Ga0181583_10102127 | All Organisms → Viruses → Predicted Viral | 1960 | Open in IMG/M |
| 3300017952|Ga0181583_10473329 | All Organisms → Viruses | 769 | Open in IMG/M |
| 3300017952|Ga0181583_10838895 | Not Available | 538 | Open in IMG/M |
| 3300017956|Ga0181580_10074708 | All Organisms → Viruses → Predicted Viral | 2520 | Open in IMG/M |
| 3300017958|Ga0181582_10077952 | All Organisms → Viruses → Predicted Viral | 2433 | Open in IMG/M |
| 3300017962|Ga0181581_10496331 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 755 | Open in IMG/M |
| 3300017964|Ga0181589_10485440 | Not Available | 801 | Open in IMG/M |
| 3300017964|Ga0181589_10938032 | Not Available | 529 | Open in IMG/M |
| 3300017967|Ga0181590_10061856 | All Organisms → Viruses → Predicted Viral | 2975 | Open in IMG/M |
| 3300018421|Ga0181592_10138762 | All Organisms → Viruses → Predicted Viral | 1863 | Open in IMG/M |
| 3300021335|Ga0213867_1048442 | All Organisms → Viruses → Predicted Viral | 1632 | Open in IMG/M |
| 3300021425|Ga0213866_10022982 | Not Available | 3689 | Open in IMG/M |
| 3300021958|Ga0222718_10097910 | All Organisms → Viruses → Predicted Viral | 1735 | Open in IMG/M |
| 3300021959|Ga0222716_10026257 | All Organisms → Viruses → Predicted Viral | 4285 | Open in IMG/M |
| 3300021959|Ga0222716_10042730 | All Organisms → Viruses → Predicted Viral | 3248 | Open in IMG/M |
| 3300021959|Ga0222716_10074659 | All Organisms → Viruses → Predicted Viral | 2344 | Open in IMG/M |
| 3300021960|Ga0222715_10004036 | All Organisms → Viruses | 12922 | Open in IMG/M |
| 3300021960|Ga0222715_10052496 | All Organisms → Viruses → Predicted Viral | 2805 | Open in IMG/M |
| 3300021960|Ga0222715_10246358 | All Organisms → Viruses → Predicted Viral | 1042 | Open in IMG/M |
| 3300021961|Ga0222714_10000512 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Tevenvirinae → Tequatrovirus | 44119 | Open in IMG/M |
| 3300021961|Ga0222714_10029346 | All Organisms → Viruses → Predicted Viral | 4123 | Open in IMG/M |
| 3300021964|Ga0222719_10247493 | All Organisms → Viruses → Predicted Viral | 1187 | Open in IMG/M |
| 3300022057|Ga0212025_1029821 | Not Available | 915 | Open in IMG/M |
| 3300022069|Ga0212026_1056560 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 593 | Open in IMG/M |
| 3300022071|Ga0212028_1067765 | Not Available | 668 | Open in IMG/M |
| 3300022187|Ga0196899_1041932 | All Organisms → Viruses → Predicted Viral | 1544 | Open in IMG/M |
| 3300022187|Ga0196899_1100034 | Not Available | 860 | Open in IMG/M |
| 3300022198|Ga0196905_1003749 | Not Available | 5517 | Open in IMG/M |
| 3300022200|Ga0196901_1058812 | All Organisms → Viruses | 1417 | Open in IMG/M |
| 3300022935|Ga0255780_10010060 | All Organisms → Viruses | 7507 | Open in IMG/M |
| 3300022937|Ga0255770_10043946 | All Organisms → Viruses → Predicted Viral | 2910 | Open in IMG/M |
| 3300023116|Ga0255751_10326687 | All Organisms → Viruses | 789 | Open in IMG/M |
| 3300024289|Ga0255147_1000224 | Not Available | 21089 | Open in IMG/M |
| 3300024570|Ga0255276_1165707 | All Organisms → Viruses | 573 | Open in IMG/M |
| 3300025646|Ga0208161_1009637 | All Organisms → Viruses → Predicted Viral | 4099 | Open in IMG/M |
| 3300025647|Ga0208160_1023655 | All Organisms → Viruses → Predicted Viral | 1918 | Open in IMG/M |
| 3300025653|Ga0208428_1001383 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 10222 | Open in IMG/M |
| 3300025653|Ga0208428_1176077 | Not Available | 559 | Open in IMG/M |
| 3300025674|Ga0208162_1043135 | All Organisms → Viruses → Predicted Viral | 1559 | Open in IMG/M |
| 3300025674|Ga0208162_1071168 | All Organisms → Viruses | 1100 | Open in IMG/M |
| 3300025751|Ga0208150_1113550 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 878 | Open in IMG/M |
| 3300025815|Ga0208785_1033034 | All Organisms → Viruses → Predicted Viral | 1570 | Open in IMG/M |
| 3300026085|Ga0208880_1048010 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 923 | Open in IMG/M |
| 3300026138|Ga0209951_1013883 | All Organisms → Viruses → Predicted Viral | 1784 | Open in IMG/M |
| 3300026183|Ga0209932_1019839 | All Organisms → Viruses → Predicted Viral | 1767 | Open in IMG/M |
| 3300027917|Ga0209536_101218583 | Not Available | 923 | Open in IMG/M |
| 3300031565|Ga0307379_11097059 | Not Available | 669 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 41.07% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 14.29% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 14.29% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 8.93% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 5.36% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.79% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.79% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.79% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.79% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.79% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 1.79% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.89% |
| Marine Plankton | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton | 0.89% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.89% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.89% |
| Marine Methane Seep Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300001830 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM40, ROCA_DNA028_0.2um_3l | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009124 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsf | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010389 | Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsf | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300012504 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012520 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012528 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012965 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012966 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012967 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017949 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017952 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017958 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017962 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017964 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300021335 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540 | Environmental | Open in IMG/M |
| 3300021425 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284 | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022057 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2) | Environmental | Open in IMG/M |
| 3300022069 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v2) | Environmental | Open in IMG/M |
| 3300022071 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022935 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaG | Environmental | Open in IMG/M |
| 3300022937 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG | Environmental | Open in IMG/M |
| 3300023116 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG | Environmental | Open in IMG/M |
| 3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300024570 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025751 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025815 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026085 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_SurfaceB_ad_5m_LV_B (SPAdes) | Environmental | Open in IMG/M |
| 3300026138 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026183 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSpr2010_1000073736 | 3300000116 | Marine | MLKYIIARLRWGKLSQEDKEILKTMPVSQVFSRPYLNPKLYTQY* |
| DelMOSpr2010_102647011 | 3300000116 | Marine | WGKLSKEQKEELKTLTLKQVLSRPYLAPKLYHHW* |
| JGIcombinedJ13530_1066880052 | 3300001213 | Wetland | MLKYILAYIRWGDLTPEQENKLETLSLKEVLNTPYLI |
| ACM40_10309021 | 3300001830 | Marine Plankton | LARLRWGSLSPEQKEQLKTLPFRQVFFRPYLSPKLHKNYEKTLYS* |
| Ga0079957_10855884 | 3300005805 | Lake | MLKYILAYIRWGDLTPEQENKLETLSLKEVLNTPYLIRKY* |
| Ga0079957_12416974 | 3300005805 | Lake | ALARLRWGSLSPEQKEKLKLLSFRDVLKTPYLIRRF* |
| Ga0075474_100173724 | 3300006025 | Aqueous | MFKYIIARLRWGSLSPEKIEKLNTMTFSQVFTSPYLIRKYYG* |
| Ga0075478_102186742 | 3300006026 | Aqueous | MLKYILARLRWGSLSPEQKEKLKTLSIKEVFNSPYLIRKYYG* |
| Ga0070754_1000974014 | 3300006810 | Aqueous | MVKYIFAQIRWGSLSPEQKEKVKALSFKELFSIPYLTPKFYINY* |
| Ga0070754_101382223 | 3300006810 | Aqueous | MLKYILARLRWGSLSLQQKEILKDMSFIQVFKRPYLDPKLVKHY* |
| Ga0070754_101521904 | 3300006810 | Aqueous | MLKKIIATLRWGKLSKEQKEELKTLTLKQVLSRPYLAPKLYHHW* |
| Ga0070754_101567021 | 3300006810 | Aqueous | MLKYILAKLRWGSLSPEQKEELKTLPISEVFSRPYLAPKLHKHY* |
| Ga0075481_102188892 | 3300006868 | Aqueous | MLKYILARLRWGSLSPEHKEKLKTLSLKEVFDTPYLIRKY* |
| Ga0075477_103148801 | 3300006869 | Aqueous | HIMLKYILARLRWGSLSPEQKEKLKTLSIKEVFNSPYLIRKYYG* |
| Ga0075479_101724441 | 3300006870 | Aqueous | YILARLRWGSLSPEQKEKLKTLSFLEVFTLPYLVPKLYKHY* |
| Ga0075479_103824532 | 3300006870 | Aqueous | MLKNFLARLRWGSLSPEQKEELKTLPISAVFTRPYLAPKLHKHY* |
| Ga0075475_100188227 | 3300006874 | Aqueous | MLKNILATLRWGSLSPEQKEELKTMSLRQVLNRPYLAPKLHKHY* |
| Ga0070750_102330811 | 3300006916 | Aqueous | LKKIIATLRWGKLSKEQKEELKTLTLKQVLSRPYLAPKLYHHW* |
| Ga0070750_104340472 | 3300006916 | Aqueous | MLKNIIAFLRWGNLNKEQKEELKSLSIKEVFGRPYLAPKLHKHY* |
| Ga0099851_100017343 | 3300007538 | Aqueous | MLKKIIATLRWGKLSKEQKEELKTLTLKQVFSRPYLAPKLYHHW* |
| Ga0099851_100998811 | 3300007538 | Aqueous | MLKYILASLRWGNLSNEEREVLKTLPLSQVLKRPYLAPKLQKHC* |
| Ga0099851_10178407 | 3300007538 | Aqueous | MLKYIFARLRWGSLSPEQKEKLKTLSLKEVFDTPYLIRKY* |
| Ga0099851_12690313 | 3300007538 | Aqueous | RHTLLKMLKNILARLRWGSLSPQQKEQLETISLGQVIKRPYLCPKLHKHY* |
| Ga0099849_10788111 | 3300007539 | Aqueous | LLKMLKNFLARLRWGSLSPEQKEELQTLPISAVFTRPYLAPKLYKHY* |
| Ga0099848_10096574 | 3300007541 | Aqueous | MKYFLARLRWGSLSPEQKEELKTLPISAVFTRPYLAPKLHKHY* |
| Ga0099848_10105134 | 3300007541 | Aqueous | MLKYFLAEIRWGSLSPEQKEELKTLPLSEVFKRPYLAPKLQKHY* |
| Ga0099850_11217274 | 3300007960 | Aqueous | MLKNIIAFLRWGNLNKEQKEELKTLSIREVFGRPYLAPKLHKHY* |
| Ga0102960_10115255 | 3300009000 | Pond Water | MLKTIIAMLRWGNLSPEQKQKLETLSLKEVLNTPYLIRKY* |
| Ga0102960_101549612 | 3300009000 | Pond Water | MLKYIIARLRWGSLSPEHKERLKTLSLKEVFNTPYLIRKY* |
| Ga0102963_10124268 | 3300009001 | Pond Water | MLKVLIAKLRWGKLSPEQKQKLETLSLKEVFNAPYLIRKY* |
| Ga0102963_10193532 | 3300009001 | Pond Water | MLKYIIARLRWGSLSPEHKEKLKTLSLKEVFDTPYLIRKY* |
| Ga0118687_100032597 | 3300009124 | Sediment | MLKNLLARLRWGSLSPEQKEQLKTMSLRQVLNRPYLCPKLHKHY* |
| Ga0118687_100382851 | 3300009124 | Sediment | YIIARLRWGSLSPEHKERLKTLSLKEVFDTPYLIRKY* |
| Ga0129348_10068844 | 3300010296 | Freshwater To Marine Saline Gradient | MKYFLARLRWGSLSPEQKEQLKTLPLSAVFTRPYLAPKLYKHY* |
| Ga0129348_10423153 | 3300010296 | Freshwater To Marine Saline Gradient | MLKYILAKLRWGSLSPEQKEELKTLPISEVFSRPYLAPKLYKHY* |
| Ga0129348_10848003 | 3300010296 | Freshwater To Marine Saline Gradient | MLKNFLARLRWGSLSPEQKEELKTLPLSAVFSRPYLAPKLHKHY* |
| Ga0129348_11219552 | 3300010296 | Freshwater To Marine Saline Gradient | MKYIFARLRWGSLSPEQKEQLKTMSLRQVLNRPYLCPKLHKHY* |
| Ga0129345_10080643 | 3300010297 | Freshwater To Marine Saline Gradient | MFKNFLARLRWGSLSPEQKEELKTLPLSAVFTRPYLAPKLHKHY* |
| Ga0129345_10624454 | 3300010297 | Freshwater To Marine Saline Gradient | MIKNILASIRWGSLSPEQKEELKTMPLLEVFTRPYLIPKLHKHY* |
| Ga0129345_13431662 | 3300010297 | Freshwater To Marine Saline Gradient | MLKNLLARLRWGSLSPEQKEELKTLSFRQVLNRPYLR |
| Ga0129342_10426314 | 3300010299 | Freshwater To Marine Saline Gradient | YMIKKFLARLRWGSLSPEQKEELKTLPLLKVFTRPYLAPKLYKNY* |
| Ga0129342_10498951 | 3300010299 | Freshwater To Marine Saline Gradient | MLKQLLAHLRWGSLTLEQKEELKTLSFKEVFTRPYLDPKLHKHY |
| Ga0129342_10649131 | 3300010299 | Freshwater To Marine Saline Gradient | LARLRWGSLTLEQKEELKTLSFKEVFTRPYLDPKLHKHY* |
| Ga0129342_11739343 | 3300010299 | Freshwater To Marine Saline Gradient | MLKNILARLRWGSLSPEQKEELKTMSLKQVFSRPYLVPKLH |
| Ga0129351_10416632 | 3300010300 | Freshwater To Marine Saline Gradient | MLKSILASLRWGSLSPEQKEELKTLPLLKVFTRPYLAPKLYKNY* |
| Ga0136656_100044225 | 3300010318 | Freshwater To Marine Saline Gradient | MIKNILASIRWGSLSPEQKEELKTMPLSEVFTRPYLIPKLHKHY* |
| Ga0129333_102865535 | 3300010354 | Freshwater To Marine Saline Gradient | MFKNIISYLRWGSLSSEQKEKLKSLSLKKVFTTPYLIRRY* |
| Ga0129333_103558034 | 3300010354 | Freshwater To Marine Saline Gradient | MLKYFLAEIRWGSLSPEQKEELKTLSLSEVFKRPYLTPKLQKHY* |
| Ga0129333_112073801 | 3300010354 | Freshwater To Marine Saline Gradient | MLKNLLAELRWGPLTPEQQKELDTLPIKEVLRRPYL |
| Ga0136549_100111128 | 3300010389 | Marine Methane Seep Sediment | MLKLIFARLRWGKLSQEQKEELKTLSLGQTLARPYLVPKLFKHY* |
| Ga0151620_10063046 | 3300011268 | Freshwater | MFKYILAYIRWGDLTPEQENKLETLSLKEVLNTPYLIRRY* |
| Ga0151620_10083587 | 3300011268 | Freshwater | MPAKMFKYILARLRWGSLSLQQKEKLQSLSFKEVLNVPYLIRKY* |
| Ga0129347_10190753 | 3300012504 | Aqueous | MKYFLARLRWGSLSPEQKEQLKTMSLRQVLNRPYLCPKLHK |
| Ga0129347_10691331 | 3300012504 | Aqueous | MIKNILASIRWGSLSPEQKEELKTMPLSEVFTRPYLIPK |
| Ga0129344_10240852 | 3300012520 | Aqueous | MFKNFLARLRWGSLSPEQKEELKTLPLSAVFTRPYLAPKLYKHY* |
| Ga0129344_12572121 | 3300012520 | Aqueous | MLKNLLARLRWGSLSPEQKEELKTMSLRQVLNRPYLCPKLHTHY* |
| Ga0129352_104418801 | 3300012528 | Aqueous | RWGSLSPEQKEELKTLPLLKVFTRPYLAPKLYKNY* |
| Ga0129346_10601744 | 3300012965 | Aqueous | MLKNLLARLRWGSLSPEQKEELKTLSFRQVLNRTYL |
| Ga0129341_10821644 | 3300012966 | Aqueous | KKIIATLRWGKLSKEQKEELKTHTLKQVLSRPYLAPKLYHHW* |
| Ga0129343_10362286 | 3300012967 | Aqueous | MKYFLARLRWGSLSPEQKEQLKTMSLRQVLNRPYLCPKLHKHY* |
| Ga0129343_11147363 | 3300012967 | Aqueous | MIKKFLARLRWGSLSPEQKEELKTLPLLKVFTRPYLAPKLYKNY* |
| Ga0129343_11645352 | 3300012967 | Aqueous | MLKQLLAHLRWGSLTLEQKEELKTLSFKEVFTRPYLDPKLHKHY* |
| Ga0181584_102186122 | 3300017949 | Salt Marsh | MLKKIIATLRWGKLSKEQKEELKTLTLKQVLSRPYLAPKLYHHW |
| Ga0181584_103090584 | 3300017949 | Salt Marsh | MLKYILAKLRWGSLSPEQKEELKTLPISEVFSRPYLAPKLHKHY |
| Ga0181584_104549332 | 3300017949 | Salt Marsh | MFKNFLARLRWGSLSPEQKEELKTLPLSAVFTRPYLAPKLHKHY |
| Ga0181583_101021271 | 3300017952 | Salt Marsh | MLKYILAKLRWGSLSPEQKEELKTLPISEVFSRPYLAPKL |
| Ga0181583_104733292 | 3300017952 | Salt Marsh | MLKNIIASLRWGKLNQEEKDELKKISLKEVLDRPYLVPKLHKHY |
| Ga0181583_108388951 | 3300017952 | Salt Marsh | MFKNFLARLRWGSLSPKQKEELKTLPLSAVFSRPYLAPK |
| Ga0181580_100747085 | 3300017956 | Salt Marsh | MLKNFLARLRWGSLSPEQKEELKTLPISAVFTRPYLAPKLHKHY |
| Ga0181582_1007795211 | 3300017958 | Salt Marsh | MIKYILARLRWGSLSPEHKEKLKTLSLKEVFDTPYLIRKY |
| Ga0181581_104963313 | 3300017962 | Salt Marsh | MLKNFLARLRWGSLSPEQKEELKTLPLSAVFSRPYLAPKLHKHY |
| Ga0181589_104854403 | 3300017964 | Salt Marsh | MKYFLARLRWGSLSPEQKEELKTLPLSAVFTRPYLAPKLHKHY |
| Ga0181589_109380321 | 3300017964 | Salt Marsh | LKKFLARLRWGSLSPEQKEELKTLPISAVFTRPYLAPKLHKHY |
| Ga0181590_100618564 | 3300017967 | Salt Marsh | MLKVLIAKLRWGKLSPEQKQKLETLSLKEVFNATYLIRKY |
| Ga0181592_101387624 | 3300018421 | Salt Marsh | MLKVLIAKLRWGKLSPEQKQKLEILSLKEVFNATYLIRKY |
| Ga0213867_10484424 | 3300021335 | Seawater | MLKYIIARLRWGKLSQEDKEILKTMPVSQVFSRPYLNPKLYTQY |
| Ga0213866_1002298215 | 3300021425 | Seawater | MIKYLLAFIRWGSLSPEQKEKVKALSLKELFSTPYLTPKLYINY |
| Ga0222718_100979103 | 3300021958 | Estuarine Water | MLKYIIARLRWGSLSPEHKEKLKTLSLKEVFDTPYLIRKY |
| Ga0222716_100262577 | 3300021959 | Estuarine Water | MLKNIIASLRWGKLNNEQKEELKKLSFKQVLGRPYLVPKLHKHYE |
| Ga0222716_100427302 | 3300021959 | Estuarine Water | MLKNILARLRWGSLSPEQKEELKTMSLKQVFSRPYLVPKLHKHYEKTLYS |
| Ga0222716_100746593 | 3300021959 | Estuarine Water | MKYILARLRWGSLSPEQKEKLKTMSFAEVFNRPYLTPKLHKHY |
| Ga0222715_1000403616 | 3300021960 | Estuarine Water | MPAKMFKYILARLRWGSLSLQQKEKLQSLSFKEVLNVPYLIRKY |
| Ga0222715_100524961 | 3300021960 | Estuarine Water | NFFARLRWGSLSPEQKEELKTLPLSAVFTRPYLAPKLHKHY |
| Ga0222715_102463582 | 3300021960 | Estuarine Water | MLKNLLAELRWGPLTPEQQKELDTLPIKEVLRRPYLAPKLHKHY |
| Ga0222714_1000051223 | 3300021961 | Estuarine Water | MLKYILAYIRWGDLTSAQEDKLETLSLKEVLLTPYLIRKY |
| Ga0222714_100293462 | 3300021961 | Estuarine Water | MLKNFFARLRWGSLSPEQKEELKTLPLSAVFTRPYLAPKLHKHY |
| Ga0222719_102474933 | 3300021964 | Estuarine Water | MLKNLLARLRWGSLSPEQKEQLKTMSLRQVLNRPYLCPKLHKHY |
| Ga0212025_10298214 | 3300022057 | Aqueous | MFKYIIARLRWGSLSPEKIEKLNTMTFSQVFTSPYLIRN |
| Ga0212026_10565601 | 3300022069 | Aqueous | MVKYILAEIRWGSLSPQQKEKLSTLSLVETLRSPYL |
| Ga0212028_10677652 | 3300022071 | Aqueous | MFKYIIARLRWGSLSPEKIEKLNTMTFSQVFTSPYLIRKYYG |
| Ga0196899_10419322 | 3300022187 | Aqueous | MLKYILARLRWGSLSPEQKEKLKTLSIKEVFNSPYLIRKYYG |
| Ga0196899_11000342 | 3300022187 | Aqueous | MLKKIIATLRWGKLSKEQKEELKTLTLKQVFSRPYLAPKLYHHW |
| Ga0196905_100374912 | 3300022198 | Aqueous | MLKYILASLRWGNLSNEEREVLKTLPLSQVLKRPYLAPKLQKHC |
| Ga0196901_10588123 | 3300022200 | Aqueous | MLKYFLAEIRWGSLSPEQKEELKTLPLSEVFKRPYLTPKLQKHY |
| Ga0255780_100100601 | 3300022935 | Salt Marsh | RLMLKYILAKLRWGSLSPEQKEELKTLPISEVFSRPYLAPKLHKHY |
| Ga0255770_1004394610 | 3300022937 | Salt Marsh | KNFLARLRWGSLSPEQKEELKTLPISAVFTRPYLAPKLHKHY |
| Ga0255751_103266873 | 3300023116 | Salt Marsh | MLKVLIAKLRWGKLSPEQKQKLETLSLKEVFNATYL |
| Ga0255147_100022415 | 3300024289 | Freshwater | MLKYIFAYLRWGSLSPEQKEELKTMSFKQVFTQPYLAPKLYKHW |
| Ga0255276_11657073 | 3300024570 | Freshwater | KNIHIMLKYIFAYLRWGSLSPEQKEELKTMSFKQVFTQPYLAPKLYKHW |
| Ga0208161_10096374 | 3300025646 | Aqueous | MKYFLARLRWGSLSPEQKEELKTLPISAVFTRPYLAPKLHKHY |
| Ga0208160_10236555 | 3300025647 | Aqueous | MLKYIFARLRWGSLSPEQKEKLKTLSLKEVFDTPYLIRKY |
| Ga0208428_100138316 | 3300025653 | Aqueous | MVKYIFAQIRWGSLSPEQKEKVKALSFKELFSIPYLTPKFYINY |
| Ga0208428_11760773 | 3300025653 | Aqueous | KYILAKLRWGSLSPEQKEELKTLPISEVFSRPYLAPKLYKHY |
| Ga0208162_10431352 | 3300025674 | Aqueous | MLKSILASLRWGSLSPEQKEELKTLPLLKVFTRPYLAPKLYKNY |
| Ga0208162_10711684 | 3300025674 | Aqueous | KNMLKNFLARLRWGSLSPEQKEELKTLPLSAVFSRPYLAPKLHKHY |
| Ga0208150_11135502 | 3300025751 | Aqueous | LARLRWGSLSPEQKEKLKTLSFLEVFTLPYLVPKLYKHY |
| Ga0208785_10330345 | 3300025815 | Aqueous | MFKYIIARLRWGSLSPEKIEKLNTMTFSQVFTSPYLIR |
| Ga0208880_10480101 | 3300026085 | Marine | LPKMLKYFLARLRWGSLSPEQKEELKTLPLSEVFSLPYLAPKLHKHY |
| Ga0209951_10138836 | 3300026138 | Pond Water | MLKVLIAKLRWGKLSPEQKQKLETLSLKEVFNAPYLIRKY |
| Ga0209932_10198394 | 3300026183 | Pond Water | MLKTIIAMLRWGNLSPEQKQKLETLSLKEVLNTPYLIRKY |
| Ga0209536_1012185832 | 3300027917 | Marine Sediment | MIKYFFARIRWGSLSPEQKEKVKALSFKELFSTPYLTPKLYINY |
| Ga0307379_110970593 | 3300031565 | Soil | IMLKYILARLRWGSLSPEHKEKLKTLSLKEVFNTPYLIRKY |
| ⦗Top⦘ |