


| Basic Information | |
|---|---|
| Family ID | F083864 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 112 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MYAHLKSVVLGLALVTLLAGLSACAKRPMVIGGSSAPAPSAAVAPAPTR |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 112 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 86.49 % |
| % of genes near scaffold ends (potentially truncated) | 18.75 % |
| % of genes from short scaffolds (< 2000 bps) | 76.79 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (87.500 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (17.857 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.464 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.786 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 31.17% β-sheet: 0.00% Coil/Unstructured: 68.83% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 112 Family Scaffolds |
|---|---|---|
| PF00551 | Formyl_trans_N | 16.96 |
| PF02911 | Formyl_trans_C | 9.82 |
| PF00920 | ILVD_EDD | 3.57 |
| PF04392 | ABC_sub_bind | 2.68 |
| PF00885 | DMRL_synthase | 0.89 |
| PF01152 | Bac_globin | 0.89 |
| PF01943 | Polysacc_synt | 0.89 |
| PF01068 | DNA_ligase_A_M | 0.89 |
| PF13177 | DNA_pol3_delta2 | 0.89 |
| PF01842 | ACT | 0.89 |
| PF08450 | SGL | 0.89 |
| PF02254 | TrkA_N | 0.89 |
| PF07366 | SnoaL | 0.89 |
| PF00691 | OmpA | 0.89 |
| PF02575 | YbaB_DNA_bd | 0.89 |
| PF06114 | Peptidase_M78 | 0.89 |
| PF02518 | HATPase_c | 0.89 |
| COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
|---|---|---|---|
| COG0223 | Methionyl-tRNA formyltransferase | Translation, ribosomal structure and biogenesis [J] | 9.82 |
| COG0129 | Dihydroxyacid dehydratase/phosphogluconate dehydratase | Carbohydrate transport and metabolism [G] | 7.14 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 2.68 |
| COG0054 | 6,7-dimethyl-8-ribityllumazine synthase (Riboflavin synthase beta chain) | Coenzyme transport and metabolism [H] | 0.89 |
| COG0718 | DNA-binding nucleoid-associated protein YbaB/EfbC | Transcription [K] | 0.89 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.89 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.89 |
| COG2346 | Truncated hemoglobin YjbI | Inorganic ion transport and metabolism [P] | 0.89 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.89 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 87.50 % |
| Unclassified | root | N/A | 12.50 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_101433443 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1042 | Open in IMG/M |
| 3300000559|F14TC_100143214 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2798 | Open in IMG/M |
| 3300000956|JGI10216J12902_103137453 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1719 | Open in IMG/M |
| 3300002560|JGI25383J37093_10203811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Chloroflexineae → Oscillochloridaceae → Oscillochloris → Oscillochloris trichoides | 520 | Open in IMG/M |
| 3300002562|JGI25382J37095_10095737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1060 | Open in IMG/M |
| 3300002911|JGI25390J43892_10137512 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300004114|Ga0062593_100313707 | All Organisms → cellular organisms → Bacteria | 1345 | Open in IMG/M |
| 3300004267|Ga0066396_10003608 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1567 | Open in IMG/M |
| 3300004633|Ga0066395_10063268 | All Organisms → cellular organisms → Bacteria | 1680 | Open in IMG/M |
| 3300005167|Ga0066672_10004981 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 5791 | Open in IMG/M |
| 3300005174|Ga0066680_10044353 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2586 | Open in IMG/M |
| 3300005174|Ga0066680_10276378 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
| 3300005174|Ga0066680_10434735 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300005177|Ga0066690_10149014 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1537 | Open in IMG/M |
| 3300005178|Ga0066688_10557414 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 737 | Open in IMG/M |
| 3300005180|Ga0066685_10084717 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2097 | Open in IMG/M |
| 3300005186|Ga0066676_10150201 | All Organisms → cellular organisms → Bacteria | 1464 | Open in IMG/M |
| 3300005186|Ga0066676_10564957 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 771 | Open in IMG/M |
| 3300005294|Ga0065705_10077103 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300005332|Ga0066388_100493610 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1861 | Open in IMG/M |
| 3300005332|Ga0066388_102021560 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1034 | Open in IMG/M |
| 3300005355|Ga0070671_101364709 | Not Available | 626 | Open in IMG/M |
| 3300005445|Ga0070708_100324806 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1450 | Open in IMG/M |
| 3300005450|Ga0066682_10312818 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1013 | Open in IMG/M |
| 3300005546|Ga0070696_101713476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 542 | Open in IMG/M |
| 3300005713|Ga0066905_100068349 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2273 | Open in IMG/M |
| 3300005713|Ga0066905_101060101 | Not Available | 718 | Open in IMG/M |
| 3300005764|Ga0066903_100384583 | All Organisms → cellular organisms → Bacteria | 2297 | Open in IMG/M |
| 3300005764|Ga0066903_101804493 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1168 | Open in IMG/M |
| 3300005983|Ga0081540_1049378 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2099 | Open in IMG/M |
| 3300006032|Ga0066696_10320119 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
| 3300006049|Ga0075417_10048016 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1834 | Open in IMG/M |
| 3300006844|Ga0075428_101998637 | Not Available | 601 | Open in IMG/M |
| 3300006845|Ga0075421_100037041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6181 | Open in IMG/M |
| 3300006852|Ga0075433_10039880 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4062 | Open in IMG/M |
| 3300006854|Ga0075425_100027463 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 6292 | Open in IMG/M |
| 3300006854|Ga0075425_103048639 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300006871|Ga0075434_100100371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2900 | Open in IMG/M |
| 3300009012|Ga0066710_100004039 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 12805 | Open in IMG/M |
| 3300009147|Ga0114129_11010163 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
| 3300009162|Ga0075423_10991517 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300009162|Ga0075423_11618199 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300009792|Ga0126374_10031519 | All Organisms → cellular organisms → Bacteria | 2489 | Open in IMG/M |
| 3300009792|Ga0126374_10683491 | Not Available | 769 | Open in IMG/M |
| 3300010043|Ga0126380_10168928 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1426 | Open in IMG/M |
| 3300010043|Ga0126380_11150934 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300010046|Ga0126384_10023188 | All Organisms → cellular organisms → Bacteria | 4034 | Open in IMG/M |
| 3300010046|Ga0126384_10165609 | All Organisms → cellular organisms → Bacteria | 1717 | Open in IMG/M |
| 3300010336|Ga0134071_10242112 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300010359|Ga0126376_10059403 | All Organisms → cellular organisms → Bacteria | 2745 | Open in IMG/M |
| 3300010359|Ga0126376_10569876 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
| 3300010366|Ga0126379_11474544 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 786 | Open in IMG/M |
| 3300010398|Ga0126383_10431379 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1362 | Open in IMG/M |
| 3300012096|Ga0137389_10012291 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 5760 | Open in IMG/M |
| 3300012189|Ga0137388_10004703 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 8995 | Open in IMG/M |
| 3300012205|Ga0137362_10304230 | Not Available | 1380 | Open in IMG/M |
| 3300012211|Ga0137377_10021163 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5758 | Open in IMG/M |
| 3300012211|Ga0137377_10995516 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 769 | Open in IMG/M |
| 3300012361|Ga0137360_10576747 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 962 | Open in IMG/M |
| 3300012582|Ga0137358_10273214 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
| 3300012685|Ga0137397_10071270 | All Organisms → cellular organisms → Bacteria | 2516 | Open in IMG/M |
| 3300012685|Ga0137397_11120374 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 572 | Open in IMG/M |
| 3300012922|Ga0137394_10904656 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300012944|Ga0137410_10302121 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1268 | Open in IMG/M |
| 3300012971|Ga0126369_10047192 | All Organisms → cellular organisms → Bacteria | 3658 | Open in IMG/M |
| 3300012986|Ga0164304_10923990 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 684 | Open in IMG/M |
| 3300014969|Ga0157376_10894611 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 906 | Open in IMG/M |
| 3300017792|Ga0163161_11945549 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 523 | Open in IMG/M |
| 3300017939|Ga0187775_10016566 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1965 | Open in IMG/M |
| 3300018431|Ga0066655_10003735 | All Organisms → cellular organisms → Bacteria | 5995 | Open in IMG/M |
| 3300018431|Ga0066655_10509537 | Not Available | 798 | Open in IMG/M |
| 3300018433|Ga0066667_11052924 | Not Available | 703 | Open in IMG/M |
| 3300019789|Ga0137408_1275918 | All Organisms → cellular organisms → Bacteria | 6785 | Open in IMG/M |
| 3300024222|Ga0247691_1067056 | Not Available | 542 | Open in IMG/M |
| 3300025910|Ga0207684_10059190 | All Organisms → cellular organisms → Bacteria | 3252 | Open in IMG/M |
| 3300025910|Ga0207684_10536120 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1002 | Open in IMG/M |
| 3300025923|Ga0207681_10252227 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1378 | Open in IMG/M |
| 3300026309|Ga0209055_1065748 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1523 | Open in IMG/M |
| 3300026310|Ga0209239_1123587 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1070 | Open in IMG/M |
| 3300026315|Ga0209686_1167641 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 630 | Open in IMG/M |
| 3300026317|Ga0209154_1315688 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 513 | Open in IMG/M |
| 3300026324|Ga0209470_1143350 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
| 3300026358|Ga0257166_1043282 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 634 | Open in IMG/M |
| 3300026529|Ga0209806_1252399 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 594 | Open in IMG/M |
| 3300026532|Ga0209160_1153468 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1048 | Open in IMG/M |
| 3300026532|Ga0209160_1164720 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 978 | Open in IMG/M |
| 3300026537|Ga0209157_1153077 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1033 | Open in IMG/M |
| 3300027681|Ga0208991_1111028 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 820 | Open in IMG/M |
| 3300027873|Ga0209814_10012224 | All Organisms → cellular organisms → Bacteria | 3389 | Open in IMG/M |
| 3300027873|Ga0209814_10095463 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1259 | Open in IMG/M |
| 3300027874|Ga0209465_10101339 | Not Available | 1412 | Open in IMG/M |
| 3300027903|Ga0209488_10253858 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1318 | Open in IMG/M |
| 3300027909|Ga0209382_10534922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1286 | Open in IMG/M |
| (restricted) 3300031150|Ga0255311_1036942 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1021 | Open in IMG/M |
| (restricted) 3300031197|Ga0255310_10189305 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 573 | Open in IMG/M |
| (restricted) 3300031248|Ga0255312_1082028 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300031543|Ga0318516_10294243 | Not Available | 938 | Open in IMG/M |
| 3300031720|Ga0307469_10729037 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 902 | Open in IMG/M |
| 3300031720|Ga0307469_10989868 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 784 | Open in IMG/M |
| 3300031720|Ga0307469_11442599 | Not Available | 657 | Open in IMG/M |
| 3300031720|Ga0307469_12491690 | Not Available | 505 | Open in IMG/M |
| 3300031740|Ga0307468_100431457 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1019 | Open in IMG/M |
| 3300031740|Ga0307468_102448258 | Not Available | 510 | Open in IMG/M |
| 3300031820|Ga0307473_10477985 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300031944|Ga0310884_10445844 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300032180|Ga0307471_101353690 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300032205|Ga0307472_100038856 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2851 | Open in IMG/M |
| 3300032770|Ga0335085_11358071 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 747 | Open in IMG/M |
| 3300034659|Ga0314780_082114 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 706 | Open in IMG/M |
| 3300034662|Ga0314783_158843 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 528 | Open in IMG/M |
| 3300034668|Ga0314793_116387 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 573 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 17.86% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.61% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 11.61% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.71% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 8.04% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 8.04% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 7.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.57% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.68% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 2.68% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.89% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.89% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.89% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300024222 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK32 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026358 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-B | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031150 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4 | Environmental | Open in IMG/M |
| 3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
| 3300031248 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300034659 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034662 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034668 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1014334432 | 3300000364 | Soil | MKSVALGLAFITLLTGLSACARRPVVVGGSPAPAPSAAVTPAPTR* |
| F14TC_1001432145 | 3300000559 | Soil | MYAHLKSVALGLALVTLLAGLSACAKRPMVLGNSSAPAPSAAVTPAPTR* |
| JGI10216J12902_1031374533 | 3300000956 | Soil | MYAHLKSVALGLALVTLLAGLSACAKRPMVIGGSSAPAPSAAATPAPTR* |
| JGI25383J37093_102038111 | 3300002560 | Grasslands Soil | MYAHLKSVVLGLALVTLLAGLSACAKRPMVIGGSSAPAPSAAVAPAPTR* |
| JGI25382J37095_100957371 | 3300002562 | Grasslands Soil | MKAHLKSVVLGLALVTVLAGLSACAKRPMVIGGSSAPAPSAAVAPSPTR* |
| JGI25390J43892_101375121 | 3300002911 | Grasslands Soil | MNTQLKSVALGLALISLLTGLSACAKRPLVIGGSPAPAPSAAV |
| Ga0062593_1003137072 | 3300004114 | Soil | MKTLKSVVLGLALVTLLTGLSACAKRPLVLGNSSAPAPSAAVTPAPTR* |
| Ga0066396_100036081 | 3300004267 | Tropical Forest Soil | MKTHVKSVVLGLALITLLTGLSACAKRPLVIGGSPAPSPSAAVAPDTTR* |
| Ga0066395_100632682 | 3300004633 | Tropical Forest Soil | MKTHVKSVVLGLALITLLTGLSACAKRPLVVGGSPAPSPSAAVAPDTTR* |
| Ga0066672_100049813 | 3300005167 | Soil | MKAHLKSVVLGLALVTVLAGLSACAKRPMVIGGSSAPAPSAAVAPAPTR* |
| Ga0066680_100443536 | 3300005174 | Soil | MYAHLKSVVLGLALVTLFAGLSACAKRPMVIGGSSAPAPSAAVAPAPNR* |
| Ga0066680_102763782 | 3300005174 | Soil | MYAHLKSVVLGLALVTLLAGLSACAKRPMVIGGSSAPSPSAAVAPAPAR* |
| Ga0066680_104347351 | 3300005174 | Soil | MKAHLKSVVLGLALVTVLAGLSACAKRPMVIGGSSAPAPSAAVAP |
| Ga0066690_101490142 | 3300005177 | Soil | MNTQLKSVALGLALISLLTGLSACAKRPLVIGGSPAPAPSAAVTPAPTR* |
| Ga0066688_105574141 | 3300005178 | Soil | MYAHLKSVVLGLALVTLFAGLSACAKRPMVIGGSSAPAPSAAVAPAPTR* |
| Ga0066685_100847171 | 3300005180 | Soil | MNTHLKSMALGLALITLLTGLSACAKRPLVVGGSPAPAPSAAVTPVPTR* |
| Ga0066676_101502013 | 3300005186 | Soil | MNASLKTMVLGLALVTVLAGLSACAKRPMVIGGSSAPAPSASVTPAPTR* |
| Ga0066676_105649571 | 3300005186 | Soil | MKTLKSVVLGLALVTLLTGLSACAKRPMVLGNSSAPAPSAAVTPAPTR* |
| Ga0065705_100771032 | 3300005294 | Switchgrass Rhizosphere | MKALKSMALGLALVSVLAGLSACAKRPVVLGSSPAPAPSAAATPAR* |
| Ga0066388_1004936106 | 3300005332 | Tropical Forest Soil | LGLALITLLTGLSACAKRPLVIGGSPAPSPSAAVAPDTTR* |
| Ga0066388_1020215602 | 3300005332 | Tropical Forest Soil | MKTRLKAVVLGLALVTLLTGLSACAKRPMVIGGASAPAPSAAVTTQPAR* |
| Ga0070671_1013647091 | 3300005355 | Switchgrass Rhizosphere | MKTRLKAVVLGLALVTLLTGLSACAKRPMVIGGSSPAPAPSAAVTPQPTR* |
| Ga0070708_1003248061 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | GRLMYAHLKSVVLGLALVTLFAGLSACAKRPMVIGGSSAPAPSAAVAPAPTR* |
| Ga0066682_103128183 | 3300005450 | Soil | MNTQLKSVALALALISLLTGLSACAKRPLVIGGSPAPAPSAAVTPAPTR* |
| Ga0070696_1017134761 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MAMKTLKSVVLGLALVTLLTGLSACAKRPMVLGNSSAPAPSAAVTPAPTR* |
| Ga0066905_1000683492 | 3300005713 | Tropical Forest Soil | MKTHVKSVVLGLALITLLTGLSACAKRPLVVGGSPAPSPSAAVAPAPTR* |
| Ga0066905_1010601011 | 3300005713 | Tropical Forest Soil | MKTHVKSVVLGLALITLLTGLSACAKRPLVVGSSPAPSPSAAVAPAPTR* |
| Ga0066903_1003845833 | 3300005764 | Tropical Forest Soil | MYAQLKPVVLGLALITLVVGLSVCAKRPVLVGGMSTPAPSAAVTPEPTR* |
| Ga0066903_1018044933 | 3300005764 | Tropical Forest Soil | MYAQLKPVVLGLALITLLAGLSACAKRPVIAGGMSAPAPSAAVTPEPTR* |
| Ga0081540_10493784 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MNALKSVMLGLALVGVLAGLSACAKRPLVIGGAPAPSPSAAVSPAPAR* |
| Ga0066696_103201192 | 3300006032 | Soil | MNTQLKSVALGLALISLLTGLSACAKRPLVIGGSPAPAPSA |
| Ga0075417_100480164 | 3300006049 | Populus Rhizosphere | MNALKSVMLGLALVGVLAGLSACAKRPLVIGGAPAPAPSAAVSPAPAR* |
| Ga0075428_1019986373 | 3300006844 | Populus Rhizosphere | MYAHLKSVALGLALVTLLAGLSACAKRPVVIGGSSAPAPSAAATPAPTR* |
| Ga0075421_1000370414 | 3300006845 | Populus Rhizosphere | MNALNSVMLGLALVGVLAGLSACAKRPLVIGGAPAPAPSAAVSPAPAR* |
| Ga0075433_100398801 | 3300006852 | Populus Rhizosphere | MKTLKSVVLGLALVTLLTGISACAKRPLVLGNSAAPAPSAAVTPAPTR* |
| Ga0075425_10002746314 | 3300006854 | Populus Rhizosphere | RMAMKTLKSVVLGLALVTLLTGISACAKRPLVLGNSAAPAPSAAVTPAPTR* |
| Ga0075425_1030486392 | 3300006854 | Populus Rhizosphere | MKTRLKAVVLGLALVTLLTGLSACAKRPMVIGGSSPAPAPSAAATPQPTR* |
| Ga0075434_1001003712 | 3300006871 | Populus Rhizosphere | MKTLKSVVLGLALVTLLTGISACAKRPLVLGNSSAPAPSAAAAPAPTR* |
| Ga0066710_10000403910 | 3300009012 | Grasslands Soil | MNTQLKSVALALALISLLTGLSACAKRPLVIGGSPAPAPSAAVTPAPTR |
| Ga0114129_110101632 | 3300009147 | Populus Rhizosphere | MKAHLKSVVLGLALVTVLAGLSACAKRPMVIGGSSAPSPSAAVAPAPAR* |
| Ga0075423_109915171 | 3300009162 | Populus Rhizosphere | MKAHLKSVVLGLALVTVLAGVSACAKRPMVIGGSSAPAPSAAVAPSPTR* |
| Ga0075423_116181991 | 3300009162 | Populus Rhizosphere | MNTQVKSVVLGLALITLLTGLSACAKRPMVIGGSSAPAPSAAATPAPTR* |
| Ga0126374_100315191 | 3300009792 | Tropical Forest Soil | MKTVALGLALVTLLGLSACARRPVVIGGAAAPAPTAAVTPAPTR* |
| Ga0126374_106834911 | 3300009792 | Tropical Forest Soil | MCGQFRSLVLGLALITVLAGLSACARRPVVIGGAPAPAPSAAVAPVLTR* |
| Ga0126380_101689283 | 3300010043 | Tropical Forest Soil | MKSMALGLALITLLAGLSACARRPVVVGGSAAPSPSAAVTPVPTR* |
| Ga0126380_111509342 | 3300010043 | Tropical Forest Soil | MKTHVKSVVLGLTLITLLTGLSACAKRPLVVGGSPAPSPSAVVAPAPI* |
| Ga0126384_100231882 | 3300010046 | Tropical Forest Soil | MKSMALGLALITLLAGLSACARRPVVIGGSAAPAPSAAVTPAPTR* |
| Ga0126384_101656093 | 3300010046 | Tropical Forest Soil | MREDRVFTHRRRMVMKTHVKSVVLGLALITLLTGLSACAKRPLVIGGSPAPSPSAAVAPDTTR* |
| Ga0134071_102421121 | 3300010336 | Grasslands Soil | MYAHLKSVVLGLALVTVLAGLSACAKRPMVIGGSSAPAPSAAVAPAPTR* |
| Ga0126376_100594033 | 3300010359 | Tropical Forest Soil | MREDRVFTHRRRMVMKTHVKSVVLGVALITLLTGLSACAKRPLVIGGSPAPSPSAAVAPDTTR* |
| Ga0126376_105698762 | 3300010359 | Tropical Forest Soil | MCGQLRSLVLGLALITVLAGLSACARRPVVIGGAPAPAPSAAVAPVLTR* |
| Ga0126379_114745443 | 3300010366 | Tropical Forest Soil | MKTHVKSVVLGIALITLLTGLSACAKRPLVIGGSPAPSPSAAVAPDTTR* |
| Ga0126383_104313791 | 3300010398 | Tropical Forest Soil | SAEREDRVFTHRRRMVMKTHVKSVVLGLALITLLTGLSACAKRPLVIGGSPAPSPSAAVAPDTTR* |
| Ga0137389_100122912 | 3300012096 | Vadose Zone Soil | MYAQLKSVVLGLALITLLAGLSACAKRPMVVGGSSVPVPSAAVTPVPTQ* |
| Ga0137388_100047034 | 3300012189 | Vadose Zone Soil | MYAQLKSVVLGLALITLLAGLSACAKRPMVVGGSSVPAPSAAVTPAPTR* |
| Ga0137362_103042302 | 3300012205 | Vadose Zone Soil | MNTQLKSVVLGLALITLLTGLSACAKRPVVIGGSPAPAPSAAVTPAPTR* |
| Ga0137377_100211634 | 3300012211 | Vadose Zone Soil | MYAHLKSVVLGLALVTLLAGLSACAKRPMVIGGSSAPAPSAAVAPTPTR* |
| Ga0137377_109955163 | 3300012211 | Vadose Zone Soil | EFTKRRRMAMKTLKSVVLGLALVTLLTGLSACAKRPMVLGNSSAPAPSAAVTPAPTR* |
| Ga0137360_105767471 | 3300012361 | Vadose Zone Soil | MKTLKSVVLGLALVTLLTGLSACAKRPMVLGNSSAPAPSAAAAPAPTR* |
| Ga0137358_102732142 | 3300012582 | Vadose Zone Soil | MNTQLKSVVLGLALITLLTGLSACAKRPMVIGGSPAPAPSAAVTPAPTR* |
| Ga0137397_100712703 | 3300012685 | Vadose Zone Soil | MNASLKTMVLGLALVTVLAGLSACAKRPLVVGGSSAPPPSASVTPAPTR* |
| Ga0137397_111203742 | 3300012685 | Vadose Zone Soil | VLGLALVTLLTGLSACAKRPMVIGGASAPAPSAAVAPAPTR* |
| Ga0137394_109046561 | 3300012922 | Vadose Zone Soil | MYAHLKSVVLGLALVTLLMGLSACAKRPMVIGGGSAPAPSAAVAPAPTR* |
| Ga0137410_103021213 | 3300012944 | Vadose Zone Soil | MNASLKTMVLGLALVTVLAGLSACAKRPMVIGGSSAPAPSASATPAPAR* |
| Ga0126375_116953812 | 3300012948 | Tropical Forest Soil | MNALKSVMLGLALVGVLAGLSACAKRPLVIGGAPAPSPSAA |
| Ga0126369_100471923 | 3300012971 | Tropical Forest Soil | MREDRVFTHRRRMVMKTHVKSVVLGLALITLLTGLSACAKRPLVVGGSPAPSPSAAVAPDTTR* |
| Ga0164304_109239901 | 3300012986 | Soil | MKTLRSVVLGLALVTLLTGLSACAKRPLVLGNSSAPAPSAAVAPAPTR* |
| Ga0157376_108946111 | 3300014969 | Miscanthus Rhizosphere | KEEAMKTRLKAVVLGLALVTLLTGLSACAKRPMVIGGSSPAPAPSAAVTPQPTR* |
| Ga0163161_119455492 | 3300017792 | Switchgrass Rhizosphere | MKTLKSVVLGLALVTLLTGLSACAKRPMVLGNSSAPAPSAAVTPAPTR |
| Ga0187775_100165663 | 3300017939 | Tropical Peatland | MNTRLKAAVLGFALFSLLTGLSACAKRPMVIGSSSAPAPTASVAPEPTR |
| Ga0066655_100037356 | 3300018431 | Grasslands Soil | MNTHLKSMALGLALITLLTGLSACAKRPLVVGGSPAPAPSAAVTPVPTR |
| Ga0066655_105095371 | 3300018431 | Grasslands Soil | MYAHLKSVVLGLALVTLLAGLSACAKRPMVIGGSSAPAPSAAVAPAPTR |
| Ga0066667_110529241 | 3300018433 | Grasslands Soil | MKAHLKSVVLGLALVTVLAGLSACAKRPMVIGGSSAPAPSAAVAPAPTR |
| Ga0137408_127591810 | 3300019789 | Vadose Zone Soil | MNAHMKSVVLGLALVTVLAGLSACAKRPMVVGGSSAPAPSAAVAPEPTR |
| Ga0247691_10670561 | 3300024222 | Soil | MKTRLKAVVLGLALVTLLTGLSACAKRPMVIGGSSPAPAPSAAVTPQPT |
| Ga0207684_100591904 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MKAHLKSVVLGLALVTVLAGLSACAKRPMVIGGSSAPAPSAAVAPSPTR |
| Ga0207684_105361201 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | LTRKEGGRLMYAHLKSVVLGLALVTLFAGLSACAKRPMVIGGSSAPAPSAAVAPAPTR |
| Ga0207681_102522273 | 3300025923 | Switchgrass Rhizosphere | MKTLKSVVLGLALVTLLTGLSACAKRPLVLGNSSAPAPSAAVTPAPTR |
| Ga0209055_10657482 | 3300026309 | Soil | MYAHLKSVVLGLALVTLLAGLSACAKRPMVIGGSSAPSPSAAVAPAPAR |
| Ga0209239_11235872 | 3300026310 | Grasslands Soil | MNTQLKSVALGLALISLLTGLSACAKRPLVIGGSPAPAPSAAVTPAPTR |
| Ga0209686_11676412 | 3300026315 | Soil | VLGLALVTLLAGLSACAKRPMVIGGSSAPSPSAAVAPAPAR |
| Ga0209154_13156882 | 3300026317 | Soil | LGLALVTLLAGLSACAKRPMVIGGSSAPSPSAAVAPAPAR |
| Ga0209470_11433502 | 3300026324 | Soil | MNASLKTMVLGLALVTVLAGLSACAKRPMVIGGSSAPAPSASVTPAPTR |
| Ga0257166_10432822 | 3300026358 | Soil | MYAQLKSVVLGLALITLLAGLSACAKRPMVIGGSSAPAPSAAVAPAPTR |
| Ga0209806_12523991 | 3300026529 | Soil | LGLALVTVLAGLSACAKRPMVIGGSSAPAPSAAVAPAPTR |
| Ga0209160_11534681 | 3300026532 | Soil | MYAHLKSVVLGLALVTLFAGLSACAKRPMVIGGSSAPAPSAAVAPAPTR |
| Ga0209160_11647201 | 3300026532 | Soil | RRTTMKAHLKSVVLGLALVTVLAGLSACAKRPMVIGGSSAPAPSAAVAPSPTR |
| Ga0209157_11530771 | 3300026537 | Soil | VVLGLALVTVLAGLSACAKRPMVIGGSSAPSPSAAVAPAPAR |
| Ga0208991_11110282 | 3300027681 | Forest Soil | MYAHLKSVVLGLALVTLLTGLSACAKRPMVIGGASAPAPSAAVAPAPTR |
| Ga0209814_100122244 | 3300027873 | Populus Rhizosphere | MKALKSMALGLALVSVLAGLSACAKRPVVLGSSPAPAPSAAATPAR |
| Ga0209814_100954632 | 3300027873 | Populus Rhizosphere | MNALKSVMLGLALVGVLAGLSACAKRPLVIGGAPAPAPSAAVSPAPAR |
| Ga0209465_101013392 | 3300027874 | Tropical Forest Soil | MKTHVKSVVLGLALITLLTGLSACAKRPLVVGGSPAPSPSAAVAPDTTR |
| Ga0209488_102538583 | 3300027903 | Vadose Zone Soil | MYAQLKSVVLGLALITLLAGLSACAKRPMVVGGSSVPAPSAAVTPAPTR |
| Ga0209382_105349222 | 3300027909 | Populus Rhizosphere | MYAHLKSVALGLALVTLLAGLSACAKRPVVIGGSSAPAPSAAATPAPTR |
| (restricted) Ga0255311_10369421 | 3300031150 | Sandy Soil | MYAQLKPVVLGLALITLLAGLSACAKRPMVISGSSAPAPSAAVAPTPTR |
| (restricted) Ga0255310_101893051 | 3300031197 | Sandy Soil | MYAQLKSVVLGLALITLLAGLSACAKRPMVISGSSAPAPSAAVAPTPTR |
| (restricted) Ga0255312_10820282 | 3300031248 | Sandy Soil | MYAQLKPVVLGLALITLLAGLSACAKRPMVIGGSSAPAPSAAVAPAPTR |
| Ga0318516_102942431 | 3300031543 | Soil | MKTHVKSMVLGLALITLLTGLSACAKRPLVIGGSPAPSPSAAVAPDTTR |
| Ga0307469_107290372 | 3300031720 | Hardwood Forest Soil | MNAHLKSVALGLALVTLLAGLSACAKRPMVIGGSPAPAPSAAVAPAPTR |
| Ga0307469_109898681 | 3300031720 | Hardwood Forest Soil | MNTQLKSVVLGLALITLLTGLSACAKRPMVIGGSPAPAPSAAATPAPAR |
| Ga0307469_114425991 | 3300031720 | Hardwood Forest Soil | MKTLKSVVLGLALVTLLTGLSACAKRPLVLGNSPAPAPSAAVTPAPTR |
| Ga0307469_124916901 | 3300031720 | Hardwood Forest Soil | MKTLKSVVLGLALVTLLTGLSACAKRPMVIGGNSSAPAPSAAVTPAPTR |
| Ga0307468_1004314572 | 3300031740 | Hardwood Forest Soil | MNASLKTMVLGLALVTVLAGLSACAKRPMVIGGSSAPAPSASVTPVPTR |
| Ga0307468_1024482581 | 3300031740 | Hardwood Forest Soil | MKTLKSVVLGLALVTLLTGISACAKRPLVLGNSSAPAPSAAAAPAPTR |
| Ga0307473_104779852 | 3300031820 | Hardwood Forest Soil | MKAHLKSVVLGLALVTVLAGLSACAKRPMVIGGSSAPAPSASVTPAPTR |
| Ga0310884_104458442 | 3300031944 | Soil | MKTLKAVVLGLALVTLLTGLSACAKRPLVLGNSSAPAPSAAVAPAPTR |
| Ga0307471_1013536901 | 3300032180 | Hardwood Forest Soil | MNASLKTMVLGLALVTVLAGLSACAKRPMVIGGSSAPAPS |
| Ga0307472_1000388562 | 3300032205 | Hardwood Forest Soil | MKSVALALAFITLLTGLSACARRPVVVGGSPAPAPSAAVTPAPTR |
| Ga0335085_113580712 | 3300032770 | Soil | MKTRLKAVVLGLAVVTLLTGLSACAKRPMVIGGASAPAPSAAVTSQPAR |
| Ga0314780_082114_3_131 | 3300034659 | Soil | VVLGLALVTLLTGLSACAKRPLVLGNSSAPAPSAAVAPAPTR |
| Ga0314783_158843_377_526 | 3300034662 | Soil | AMKTLRSVVLGLALVTLLTGLSACAKRPLVLGNSSAPAPSAAVAPAPTR |
| Ga0314793_116387_62_214 | 3300034668 | Soil | MAMKTLRSVVLGLALVTLLTGLSACAKRPLVLGNSSAPAPSAAVAPAPTR |
| ⦗Top⦘ |