


| Basic Information | |
|---|---|
| Family ID | F083793 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 112 |
| Average Sequence Length | 45 residues |
| Representative Sequence | KAGDSNYVPRGTIHRQQNLTDKPARYIEMRIFDKGKPASEQVAD |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 112 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.57 % |
| % of genes near scaffold ends (potentially truncated) | 97.32 % |
| % of genes from short scaffolds (< 2000 bps) | 94.64 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (66.071 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (23.214 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.036 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.536 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 26.39% Coil/Unstructured: 73.61% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 112 Family Scaffolds |
|---|---|---|
| PF04234 | CopC | 5.36 |
| PF00753 | Lactamase_B | 4.46 |
| PF07883 | Cupin_2 | 4.46 |
| PF03401 | TctC | 3.57 |
| PF01557 | FAA_hydrolase | 2.68 |
| PF00903 | Glyoxalase | 2.68 |
| PF01075 | Glyco_transf_9 | 2.68 |
| PF04343 | DUF488 | 1.79 |
| PF06707 | DUF1194 | 1.79 |
| PF13531 | SBP_bac_11 | 1.79 |
| PF04116 | FA_hydroxylase | 1.79 |
| PF10518 | TAT_signal | 1.79 |
| PF00565 | SNase | 1.79 |
| PF11164 | DUF2948 | 0.89 |
| PF13458 | Peripla_BP_6 | 0.89 |
| PF11746 | DUF3303 | 0.89 |
| PF05239 | PRC | 0.89 |
| PF17170 | DUF5128 | 0.89 |
| PF09084 | NMT1 | 0.89 |
| PF13701 | DDE_Tnp_1_4 | 0.89 |
| PF13302 | Acetyltransf_3 | 0.89 |
| PF11373 | DUF3175 | 0.89 |
| PF02954 | HTH_8 | 0.89 |
| PF00005 | ABC_tran | 0.89 |
| PF00067 | p450 | 0.89 |
| PF00871 | Acetate_kinase | 0.89 |
| PF13673 | Acetyltransf_10 | 0.89 |
| PF12697 | Abhydrolase_6 | 0.89 |
| PF00857 | Isochorismatase | 0.89 |
| PF01425 | Amidase | 0.89 |
| PF13365 | Trypsin_2 | 0.89 |
| COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
|---|---|---|---|
| COG2372 | Copper-binding protein CopC (methionine-rich) | Inorganic ion transport and metabolism [P] | 5.36 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 3.57 |
| COG0859 | ADP-heptose:LPS heptosyltransferase | Cell wall/membrane/envelope biogenesis [M] | 2.68 |
| COG3000 | Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamily | Lipid transport and metabolism [I] | 1.79 |
| COG3189 | Uncharacterized conserved protein YeaO, DUF488 family | Function unknown [S] | 1.79 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.89 |
| COG0282 | Acetate kinase | Energy production and conversion [C] | 0.89 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.89 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.89 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.89 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.89 |
| COG3426 | Butyrate kinase | Energy production and conversion [C] | 0.89 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 66.07 % |
| Unclassified | root | N/A | 33.93 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001661|JGI12053J15887_10441331 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300005332|Ga0066388_102041449 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1029 | Open in IMG/M |
| 3300005332|Ga0066388_103750588 | Not Available | 775 | Open in IMG/M |
| 3300005332|Ga0066388_104544455 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 706 | Open in IMG/M |
| 3300005332|Ga0066388_106101756 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300005336|Ga0070680_101977001 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300005340|Ga0070689_100374909 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1198 | Open in IMG/M |
| 3300005435|Ga0070714_101730208 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300005446|Ga0066686_10394223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 946 | Open in IMG/M |
| 3300005534|Ga0070735_10623967 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 639 | Open in IMG/M |
| 3300005538|Ga0070731_11156943 | Not Available | 511 | Open in IMG/M |
| 3300005764|Ga0066903_104711521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 726 | Open in IMG/M |
| 3300005843|Ga0068860_102237101 | Not Available | 567 | Open in IMG/M |
| 3300005994|Ga0066789_10190856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 865 | Open in IMG/M |
| 3300006028|Ga0070717_10767927 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 12AC_lac13 | 876 | Open in IMG/M |
| 3300006047|Ga0075024_100734576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 545 | Open in IMG/M |
| 3300006050|Ga0075028_100625296 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 641 | Open in IMG/M |
| 3300006918|Ga0079216_10540508 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300009012|Ga0066710_101947364 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 876 | Open in IMG/M |
| 3300009012|Ga0066710_104288203 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300009038|Ga0099829_10660732 | Not Available | 869 | Open in IMG/M |
| 3300009088|Ga0099830_11539097 | Not Available | 554 | Open in IMG/M |
| 3300009089|Ga0099828_11693487 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300009147|Ga0114129_12235312 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 658 | Open in IMG/M |
| 3300009177|Ga0105248_12319939 | Not Available | 611 | Open in IMG/M |
| 3300009524|Ga0116225_1315583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. ICBG1293 | 697 | Open in IMG/M |
| 3300009792|Ga0126374_11386377 | Not Available | 572 | Open in IMG/M |
| 3300009839|Ga0116223_10907597 | Not Available | 502 | Open in IMG/M |
| 3300010043|Ga0126380_10383513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1037 | Open in IMG/M |
| 3300010047|Ga0126382_10673218 | Not Available | 863 | Open in IMG/M |
| 3300010360|Ga0126372_12128490 | Not Available | 609 | Open in IMG/M |
| 3300010366|Ga0126379_13328520 | Not Available | 538 | Open in IMG/M |
| 3300010366|Ga0126379_13858863 | Not Available | 502 | Open in IMG/M |
| 3300011269|Ga0137392_11196704 | Not Available | 618 | Open in IMG/M |
| 3300011420|Ga0137314_1062442 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 903 | Open in IMG/M |
| 3300011435|Ga0137426_1202479 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300011441|Ga0137452_1005018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4000 | Open in IMG/M |
| 3300011443|Ga0137457_1150719 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 772 | Open in IMG/M |
| 3300012041|Ga0137430_1014615 | All Organisms → cellular organisms → Bacteria | 1996 | Open in IMG/M |
| 3300012200|Ga0137382_10415121 | Not Available | 950 | Open in IMG/M |
| 3300012202|Ga0137363_10263802 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1403 | Open in IMG/M |
| 3300012202|Ga0137363_11593751 | Not Available | 545 | Open in IMG/M |
| 3300012203|Ga0137399_10661726 | Not Available | 879 | Open in IMG/M |
| 3300012208|Ga0137376_11003871 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300012210|Ga0137378_10230758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1723 | Open in IMG/M |
| 3300012210|Ga0137378_11240575 | Not Available | 662 | Open in IMG/M |
| 3300012210|Ga0137378_11323455 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 636 | Open in IMG/M |
| 3300012212|Ga0150985_105654704 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300012351|Ga0137386_10426188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 955 | Open in IMG/M |
| 3300012357|Ga0137384_10668568 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 845 | Open in IMG/M |
| 3300012357|Ga0137384_10924138 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 703 | Open in IMG/M |
| 3300012469|Ga0150984_105060715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. | 1757 | Open in IMG/M |
| 3300012469|Ga0150984_107280259 | Not Available | 580 | Open in IMG/M |
| 3300012683|Ga0137398_10250642 | Not Available | 1179 | Open in IMG/M |
| 3300012917|Ga0137395_10582468 | Not Available | 808 | Open in IMG/M |
| 3300012924|Ga0137413_11548594 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300012925|Ga0137419_11410016 | Not Available | 588 | Open in IMG/M |
| 3300012944|Ga0137410_10031409 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3712 | Open in IMG/M |
| 3300012971|Ga0126369_11887386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 686 | Open in IMG/M |
| 3300012971|Ga0126369_13058632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 548 | Open in IMG/M |
| 3300013306|Ga0163162_11356219 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300014168|Ga0181534_10981291 | Not Available | 509 | Open in IMG/M |
| 3300014838|Ga0182030_11006594 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300015242|Ga0137412_10100479 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2351 | Open in IMG/M |
| 3300015242|Ga0137412_11133664 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300016294|Ga0182041_10472775 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1081 | Open in IMG/M |
| 3300016294|Ga0182041_11368730 | Not Available | 649 | Open in IMG/M |
| 3300016294|Ga0182041_12203798 | Not Available | 515 | Open in IMG/M |
| 3300016341|Ga0182035_11038740 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 727 | Open in IMG/M |
| 3300016341|Ga0182035_12074085 | Not Available | 517 | Open in IMG/M |
| 3300016387|Ga0182040_11016989 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300017936|Ga0187821_10455741 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300017970|Ga0187783_10511881 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300018052|Ga0184638_1236010 | Not Available | 634 | Open in IMG/M |
| 3300018086|Ga0187769_10334633 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1134 | Open in IMG/M |
| 3300018468|Ga0066662_10219166 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1524 | Open in IMG/M |
| 3300019789|Ga0137408_1194332 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300020021|Ga0193726_1301557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 620 | Open in IMG/M |
| 3300020170|Ga0179594_10296339 | Not Available | 612 | Open in IMG/M |
| 3300021401|Ga0210393_11317738 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 579 | Open in IMG/M |
| 3300021405|Ga0210387_11445112 | Not Available | 590 | Open in IMG/M |
| 3300021478|Ga0210402_10860608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium 13_1_20CM_3_63_8 | 833 | Open in IMG/M |
| 3300021479|Ga0210410_11325681 | Not Available | 612 | Open in IMG/M |
| 3300021861|Ga0213853_10306979 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1294 | Open in IMG/M |
| 3300024331|Ga0247668_1031176 | All Organisms → cellular organisms → Bacteria | 1094 | Open in IMG/M |
| 3300025926|Ga0207659_11044765 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300025934|Ga0207686_11800185 | Not Available | 507 | Open in IMG/M |
| 3300025939|Ga0207665_10875731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 712 | Open in IMG/M |
| 3300026496|Ga0257157_1046161 | Not Available | 729 | Open in IMG/M |
| 3300027765|Ga0209073_10251708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga | 687 | Open in IMG/M |
| 3300027843|Ga0209798_10076769 | All Organisms → cellular organisms → Bacteria | 1718 | Open in IMG/M |
| 3300027854|Ga0209517_10491601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. ICBG1293 | 670 | Open in IMG/M |
| 3300027882|Ga0209590_10836725 | Not Available | 583 | Open in IMG/M |
| 3300027903|Ga0209488_10067839 | All Organisms → cellular organisms → Bacteria | 2641 | Open in IMG/M |
| 3300027915|Ga0209069_10089076 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1480 | Open in IMG/M |
| 3300028796|Ga0307287_10124157 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300028811|Ga0307292_10248090 | Not Available | 739 | Open in IMG/M |
| 3300028906|Ga0308309_11868458 | Not Available | 507 | Open in IMG/M |
| 3300029636|Ga0222749_10472253 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 675 | Open in IMG/M |
| 3300029984|Ga0311332_11429359 | Not Available | 560 | Open in IMG/M |
| 3300030114|Ga0311333_11189684 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300031708|Ga0310686_116269427 | Not Available | 518 | Open in IMG/M |
| 3300031740|Ga0307468_102033529 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 551 | Open in IMG/M |
| 3300031879|Ga0306919_10118597 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1891 | Open in IMG/M |
| 3300031912|Ga0306921_10120116 | All Organisms → cellular organisms → Bacteria | 3062 | Open in IMG/M |
| 3300031912|Ga0306921_10501821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1411 | Open in IMG/M |
| 3300031942|Ga0310916_10270389 | Not Available | 1435 | Open in IMG/M |
| 3300031947|Ga0310909_10895187 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 729 | Open in IMG/M |
| 3300032059|Ga0318533_11076565 | Not Available | 589 | Open in IMG/M |
| 3300032063|Ga0318504_10098317 | All Organisms → cellular organisms → Bacteria | 1308 | Open in IMG/M |
| 3300033290|Ga0318519_10446119 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 775 | Open in IMG/M |
| 3300033433|Ga0326726_10154694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2093 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 23.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.04% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.14% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 4.46% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.46% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.57% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.68% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.68% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.68% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.79% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.79% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.79% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.79% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.79% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.79% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.89% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.89% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.89% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.89% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.89% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.89% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.89% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.89% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.89% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.89% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011420 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT199_2 | Environmental | Open in IMG/M |
| 3300011435 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2 | Environmental | Open in IMG/M |
| 3300011441 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2 | Environmental | Open in IMG/M |
| 3300011443 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2 | Environmental | Open in IMG/M |
| 3300012041 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT754_2 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026496 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027843 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12053J15887_104413311 | 3300001661 | Forest Soil | KPPQVLKAGEHNHVPRGTVHRQQNLTDKPARYIEMRIFDKDKPASEAVTN* |
| Ga0066388_1020414494 | 3300005332 | Tropical Forest Soil | PQVLKAGDSNYVPRGTIHRQQNLTDKPARYIEMRIFDKDKPASEQVPD* |
| Ga0066388_1037505883 | 3300005332 | Tropical Forest Soil | VLKAGDSNYVARGTVHRQQNLSDKPARYIVTNIFDKGEPTAEPVRE* |
| Ga0066388_1045444551 | 3300005332 | Tropical Forest Soil | PHVLKAGDSNYVPRGTIHRQQNLTDKPTRYIEMRIFDKDKPASEAVAE* |
| Ga0066388_1061017562 | 3300005332 | Tropical Forest Soil | NYVPRGTIHRQQNLSDKPARYIVMNIFDKGKPVAEPVPQ* |
| Ga0070680_1019770012 | 3300005336 | Corn Rhizosphere | GEYNYVPRGTVHRQQNLSNRPARYIEMRIFDKGVPASEPAP* |
| Ga0070689_1003749092 | 3300005340 | Switchgrass Rhizosphere | FTIKGKPPQVLKAGDWNYVPRGTVHRQQNLSGKPARYIEMRVFDKGKPASEAVPE* |
| Ga0070714_1017302081 | 3300005435 | Agricultural Soil | VKGKPPQVLKSGDWNYVPRGTVHRQQNLSGKPARYIEMRIFDKGKPAAEQVRD* |
| Ga0066686_103942231 | 3300005446 | Soil | KAGDSNYVPRGTIHRQQNLTDKPARYIEMRIFDKGKPASEQVAD* |
| Ga0070735_106239671 | 3300005534 | Surface Soil | QPPKVLKAGDWNYVPRGTVHRQQNLSGKPARYIEMRIFDKGKPAAEQVPG* |
| Ga0070731_111569431 | 3300005538 | Surface Soil | VPRGTIHRQQNLTDKPARYIEMRIFDRGKPAAEQVAE* |
| Ga0066903_1047115212 | 3300005764 | Tropical Forest Soil | PRGTIHRQQNLSDKPARYIVTGIFDKGKPVAEPVP* |
| Ga0068860_1022371012 | 3300005843 | Switchgrass Rhizosphere | DSNYVPRGTIHRQQNLTDKPARYIEMRIFDKGKPASEAVTD* |
| Ga0066789_101908564 | 3300005994 | Soil | VPRGTIHRQQNLSDKPARYIEMRIFDKGKPPSEVMKD* |
| Ga0070717_107679271 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | YVPRGTVHRQQNLSGKPARYIEMRIFDKGKPAAEQVRD* |
| Ga0075024_1007345761 | 3300006047 | Watersheds | NYVPRGTIHRQQNLSDKPARYIEMRVFDKDKPASEAVGG* |
| Ga0075028_1006252962 | 3300006050 | Watersheds | AGDSNYVPRGTIHRQQNLSDKPARYIEMRVFDKGKPPSEAME* |
| Ga0079216_105405081 | 3300006918 | Agricultural Soil | VVKRGEYNYVPRGTIHRQQNLSGRPARYIEMRIFDKGKPASEQMGK* |
| Ga0066710_1019473642 | 3300009012 | Grasslands Soil | GQPPQVLKAGDHNYVPRGTIHRQQNLTDKPARYIEMRIFDKGVPASEQVAE |
| Ga0066710_1042882032 | 3300009012 | Grasslands Soil | GQPPQVLKAGDHNYVPRGTIHRQQNLTDKPARYIEMRIFDKGVPASEQVGE |
| Ga0099829_106607322 | 3300009038 | Vadose Zone Soil | LKAGDSNYVPRGAIHRQQNLTDKPARYIEMRIFDKDKPASEAVAE* |
| Ga0099830_115390971 | 3300009088 | Vadose Zone Soil | NYVPRGTVHRQQNLSGKQARYIEMRIFAKDKPASEPAPN* |
| Ga0099828_116934872 | 3300009089 | Vadose Zone Soil | TFTIKGQPPVVLKAGEGNYVSRGTIHRQQNLSDKPARYIVLNILDKGKPVAEPVPE* |
| Ga0114129_122353122 | 3300009147 | Populus Rhizosphere | FTIKGKPPQVLKAGEYNYVPRGTVHRQQNLSGRPARYIEMRIFDKGVPASVPEP* |
| Ga0105248_123199392 | 3300009177 | Switchgrass Rhizosphere | PGDSNYVPRGTIHRQQNLTDKPARYIEMRIFDKGKPASEAVTD* |
| Ga0116225_13155831 | 3300009524 | Peatlands Soil | PQVLKAGDSNYVPRGIIHRQQNLTDKPARYVEMRIFDKGKPAAEQIAGE* |
| Ga0126374_113863771 | 3300009792 | Tropical Forest Soil | LKAGDSNYVARGTVHRQQNLSDRPARYIVINIFDKGKPTAEPVRE* |
| Ga0116223_109075971 | 3300009839 | Peatlands Soil | PPQVLKAGESNYVPRGTIHRQQNLTDKPARYVEMRIFDKGKPAAEQIAGE* |
| Ga0126380_103835131 | 3300010043 | Tropical Forest Soil | LKAGEGNYVSRGTIHRQQNLSDKPTRYIVVNIFDKGEQAAEPVPE* |
| Ga0126382_106732181 | 3300010047 | Tropical Forest Soil | PQVLKAGDHNYVPRGTVHRQQNLSNRPARYIEMRIFDKGVPASEPVN* |
| Ga0126372_121284901 | 3300010360 | Tropical Forest Soil | PPQVLKAGDSNYVPRGTIHRQQNLTDKPARYIEMRIFDKGKPASEQVAE* |
| Ga0126379_133285202 | 3300010366 | Tropical Forest Soil | SNYVPRGTIHRQQNLTDKPARYIEMRIFDKDKPAAEQVTQ* |
| Ga0126379_138588631 | 3300010366 | Tropical Forest Soil | YVPRGTIHRQQNLSDKPARYIEMRIFDKGKPAAEAVAE* |
| Ga0137392_111967042 | 3300011269 | Vadose Zone Soil | RGAIHRQQNLTDKPARYIEMRIFDKDKPASEAVAE* |
| Ga0137314_10624422 | 3300011420 | Soil | TVQGKPPQVLKAGEYNYVPRGTIHRQQNLSGRPARYIEMRIFDKDKPASEQMGK* |
| Ga0137426_12024791 | 3300011435 | Soil | KAGEYNYVPRGTIHRQQNLSGRPARYIEMRIFDKDKPASEQMGK* |
| Ga0137452_10050187 | 3300011441 | Soil | YNYVPRGTIHRQQNLSGRPARYIEMRIFDKDKPASEQMGK* |
| Ga0137457_11507191 | 3300011443 | Soil | NYVPRGTIHRQQNLSGRPARYIEMRIFDKDKPASEQMGK* |
| Ga0137430_10146151 | 3300012041 | Soil | VPRGTIHRQQNLSGRPARYIEMRIFDKDKPASEQMGK* |
| Ga0137382_104151211 | 3300012200 | Vadose Zone Soil | FNYVPRGTVHRQQNLTNRPARYIEMRIFDKGKPASETVKE* |
| Ga0137363_102638021 | 3300012202 | Vadose Zone Soil | NYVPRGAIHRQQNLTDKPARYIEMRIFDKGKPASEPG* |
| Ga0137363_115937512 | 3300012202 | Vadose Zone Soil | GTIHRQQNLSDKPARYIEMRIFDKDKPASEAVGE* |
| Ga0137399_106617261 | 3300012203 | Vadose Zone Soil | GQPPRVLKAGDSNHVPRGTIHRQQNLTDKPARYIEMRIFDKGKPASEAVGE* |
| Ga0137376_110038711 | 3300012208 | Vadose Zone Soil | DYNYVPRGTVHRQQNLSGKPSRYIEMRIFDKDKPASEQVVN* |
| Ga0137378_102307581 | 3300012210 | Vadose Zone Soil | NYVPRGTVHSQQTLSGKQARYIEMRIFDKDKTASEPAPK* |
| Ga0137378_112405751 | 3300012210 | Vadose Zone Soil | PPQVLKAGDYNYVPRGTVHRQQNLSGKPARYIEMRIFDKDKPASEEVKN* |
| Ga0137378_113234551 | 3300012210 | Vadose Zone Soil | TIHRQQNLSDKPARYIEMRVFDKGKPPSEVMGDSASTQ* |
| Ga0150985_1056547041 | 3300012212 | Avena Fatua Rhizosphere | RGTVHRQQNLTDKPARYIEMRIFDKDKPASEAVTN* |
| Ga0137386_104261883 | 3300012351 | Vadose Zone Soil | VKGKPPQVLKAGDYNYVPRGTVHRQQNLSGKQARYIEMRIFDKDKPASEPAPN* |
| Ga0137384_106685682 | 3300012357 | Vadose Zone Soil | TVKGKPPQVLKAGDYNYVPRGTVHRQQNLSGKQARYIEMRIFDKGKPASEPAAD* |
| Ga0137384_109241381 | 3300012357 | Vadose Zone Soil | GQSPVVLTAGDSNYVPRGIIHRQQNFSDKLARYIVMNIFEKGKPTAEPVPE* |
| Ga0150984_1050607153 | 3300012469 | Avena Fatua Rhizosphere | QPPQVLKAGDSNYVPRGTIHRQQNLSGQPARYIEMRVFDKDKPASEQIKD* |
| Ga0150984_1072802592 | 3300012469 | Avena Fatua Rhizosphere | LKAGDSNHVARGIIHRQQNLSGKPARYIVLNILDKGKPTAEPVPE* |
| Ga0137398_102506421 | 3300012683 | Vadose Zone Soil | GQPPRVLKAGDSNHAPRGTIHRQQNLTDKPARYIEMRIFDKGKPASEAVGE* |
| Ga0137395_105824681 | 3300012917 | Vadose Zone Soil | PRGTVHRQQNLSGKQARYIEMRIFDKDKPASEPAPN* |
| Ga0137413_115485942 | 3300012924 | Vadose Zone Soil | GKPPQVLKAGDYNYVPRGTVHRQQNLSGKQARYIEMRIFDKGKPASEPAAD* |
| Ga0137419_114100161 | 3300012925 | Vadose Zone Soil | SNRVARGIVHRQQNLSDKPARYIVLNIFDKGKPTAEPVPE* |
| Ga0137410_100314091 | 3300012944 | Vadose Zone Soil | EVTFTIKGKPAQVLKAGDYNYVPRGTVHRQQNLTNRPSRYIEMRIFDKGKPASEPG* |
| Ga0126369_118873861 | 3300012971 | Tropical Forest Soil | VPRGTVHRQQNLTDKPARYIEMRIFDKGKPASEAVTD* |
| Ga0126369_130586322 | 3300012971 | Tropical Forest Soil | KAGDSNYVPRGTVHRQQNLTDKPARYIEMRIFDKGKPASEPVTD* |
| Ga0163162_113562191 | 3300013306 | Switchgrass Rhizosphere | VLKAGDWNYVPRGTVHRQQNLSGKPARYIEMRVFDKGKPASEAVPE* |
| Ga0181534_109812911 | 3300014168 | Bog | QVLKAGESNYVPRGTIHRQQNLGDKPARYIEMRVFDKGKPASEQMTD* |
| Ga0182030_110065941 | 3300014838 | Bog | QPPQVLKAGESNYVPRGTIHRQQNLGDKPARYIEMRVFDKGKPASEQMTD* |
| Ga0137412_101004791 | 3300015242 | Vadose Zone Soil | EGDVTYTTKGQPPVVINAGDSNYVARGTIHRQQNLSDKLARYIVLNILDNGKPVAEPVPE |
| Ga0137412_111336642 | 3300015242 | Vadose Zone Soil | FTVKGKPPQVLKAGDYNYVPRGTVHRQQNLSGKQARYIEMRIFDKGKPASEPAAD* |
| Ga0182041_104727751 | 3300016294 | Soil | PPFVLRAGEGNYVARGIVHRQQNLSDKPARYVVINILDKGKPVAEPVPE |
| Ga0182041_113687301 | 3300016294 | Soil | MPFVLKAGDSNYVARGTVHRQQNLSDKPARYIVINIFDKGKPTAEPVRE |
| Ga0182041_122037982 | 3300016294 | Soil | DWNYVPRGAVHRQQNLGDKPARYIEMRVFDKGVPAAEQVTQ |
| Ga0182035_110387401 | 3300016341 | Soil | VLKAGDSNYVPRGTIHRQQNLTDKPARYIEMRIFDKDKPASEAVAE |
| Ga0182035_120740851 | 3300016341 | Soil | AGEGNYVPRGIVHRQQNLSDKPARYVVINIFDKGKLAAEPVP |
| Ga0182040_110169892 | 3300016387 | Soil | VPRGTIHRQQNLTDKPARYIEMRIFDKDKPAAEQVTQ |
| Ga0187821_104557412 | 3300017936 | Freshwater Sediment | LKVGDWNYVPRGTVHRQQNLSDKPARYIEMRVFDKGVPAAEQVAE |
| Ga0187783_105118812 | 3300017970 | Tropical Peatland | PVVLKAGDGNYVPRGIIHRQQNLSDKPARYIVINIFDKGKPTAEPVQE |
| Ga0184638_12360101 | 3300018052 | Groundwater Sediment | PPQVLKAGESNYVPRGTIHRQQNLTDRPARYIEMRIFDKGKPASEPVVD |
| Ga0187769_103346331 | 3300018086 | Tropical Peatland | VLKVGESNYVPRGTVHRQQNLSDKPARYIEMRIFDK |
| Ga0066662_102191663 | 3300018468 | Grasslands Soil | VLKAGDHNYVPRGTIHRQQNLTDKPARYIEMRVFDKGVPASEQVGE |
| Ga0137408_11943321 | 3300019789 | Vadose Zone Soil | DSNYVPRGTVHRQQNLTDKPTRYIEMRIFDKDKPASEQVVE |
| Ga0193726_13015571 | 3300020021 | Soil | QPPHVLKAGEYNHVPRGTVHRQQNLTDKPARYIEMRVFDKGKPASEAVGE |
| Ga0179594_102963391 | 3300020170 | Vadose Zone Soil | YVPRGTIHRQQNLTDKPARYIEMRIFDKGKPASEAVTD |
| Ga0210393_113177381 | 3300021401 | Soil | PPVVLKAGEGNHVARGIVHRQQNLSDKPARYIVLNILDKGKPVAEPVPE |
| Ga0210387_114451122 | 3300021405 | Soil | VLKVGDSNYVPRGTVHRQQNLGDKPARYIEMRIFDKGKPASEQMTQ |
| Ga0210402_108606081 | 3300021478 | Soil | PIVLKVGDSNYVPRGVIHRQQNLSDKPARYIEMRIFDKGKPPSEIMGN |
| Ga0210410_113256811 | 3300021479 | Soil | VVLKAGEGNYVARGIVHRQQNLSDKPARYIVLNILDTGKPVAEPVPQ |
| Ga0213853_103069791 | 3300021861 | Watersheds | KGQPPQVLKAGDHNYVPRGTIHRQQNLSDKPARYIEMRVFDKDKPASEAVGG |
| Ga0247668_10311761 | 3300024331 | Soil | NYVPRGTIHRQQNLSGKPARYVEMRIFDKGKPAAEQVKD |
| Ga0207659_110447652 | 3300025926 | Miscanthus Rhizosphere | NYVPRGTVHRQQNTSNRPARYIEMRIFDKGVPASEPVN |
| Ga0207686_118001851 | 3300025934 | Miscanthus Rhizosphere | VPRGTVHRQQNLSGKPARYIEMRIFDKGKPASEAVGG |
| Ga0207665_108757312 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VLKAGEYNYVPRGTVHRQQNLTGKPARYIEMRIFDKGKPASESVP |
| Ga0257157_10461612 | 3300026496 | Soil | PPQVLKAGDSNYVPRGAIHRQQNLTDKPARYIEMRIFDKDKPASEAVAE |
| Ga0209073_102517082 | 3300027765 | Agricultural Soil | VLKAGDYNYVPRGTVHRQQNLSGKPARYIEMRIFDKGKPASEAVAD |
| Ga0209798_100767691 | 3300027843 | Wetland Sediment | APQVLKAGEYNYVPRGTVHRQQNLSGKQARYIEMRIFDKGVPASEPMGK |
| Ga0209517_104916012 | 3300027854 | Peatlands Soil | PQVLKAGDSNYVPRGTIHRQQNLTDKPARYIEMRVFDKGKPAAEQITGE |
| Ga0209590_108367252 | 3300027882 | Vadose Zone Soil | QPPVVLKAGDSNRVARGIVHRQQNLSDKPARYIVLNIFDKGKPTAEPVPE |
| Ga0209488_100678391 | 3300027903 | Vadose Zone Soil | PPQVLKAGDSNYVPRGTIHRQQNLTDKPARYIEMRIFDKDKPASEAVAE |
| Ga0209069_100890761 | 3300027915 | Watersheds | NYVPRGTIHRQQNLSDKPARYIEMRVFDKDKPASEAVGG |
| Ga0307287_101241572 | 3300028796 | Soil | NYVPRGTVHRQQNLTDKPTRYIEMRIFDKDKPASEQVVE |
| Ga0307292_102480901 | 3300028811 | Soil | VPRGTIHRQQNLTDKPARYIEMRIFDKDKPASEQMAE |
| Ga0308309_118684581 | 3300028906 | Soil | IVLKAGDSNYVPRGIIHRQQNLSDKPARYIVMGVFDRGKPVAELVPE |
| Ga0222749_104722532 | 3300029636 | Soil | GDSNYVPRGTIHRQQNLSDKPARYIEMRIFDKGKPPTEVMKD |
| Ga0311332_114293592 | 3300029984 | Fen | YVPRGTVHRQQNLSDKPARYIEMRIFDKDKPAAEQVN |
| Ga0311333_111896841 | 3300030114 | Fen | LKAGESNYVPRGTIHRQQNLSDKPARYVEMRIFDKDKPAAEQVN |
| Ga0310686_1162694271 | 3300031708 | Soil | NYVARGIVHRQQNLSDKPARYIVINILDKGKPVAEPVPE |
| Ga0307468_1020335291 | 3300031740 | Hardwood Forest Soil | PQVLKAGDSNHVPRGTIHRQQNLTDKPARYIEMRIFDKDKPASEQVPE |
| Ga0306919_101185971 | 3300031879 | Soil | NYVARGIVHRQQNLSDKPARYVVINILDKGKPVAEPVPE |
| Ga0306921_101201161 | 3300031912 | Soil | VPRGTIHRQQNLTDKPARYIEMRIFDKDKPAAEQIGQ |
| Ga0306921_105018211 | 3300031912 | Soil | VKGQPPKVLKAGDWNYVPRDTVHRQQNLGDKPARYIEIRVFDKGVPAAEQVTQ |
| Ga0310916_102703892 | 3300031942 | Soil | GDSNYVPRGTIHRQQNLTDKPARYIEMRIFDKDKPAAEQIGQ |
| Ga0310909_108951871 | 3300031947 | Soil | VKGQPPKVLKVGDWNYVPRGTVHRQQNLSDKPARYIEMRVFDKGVPAAEQVAE |
| Ga0318533_110765651 | 3300032059 | Soil | RGTIHRQQNLTDKPARYIEMRIFDKDKPAAEQIGQ |
| Ga0318504_100983173 | 3300032063 | Soil | NYVPRGTVHRQQNLSDKPARYIEMRVFDKGVPAAEQVAE |
| Ga0318519_104461192 | 3300033290 | Soil | EANYVARGIVHRQQNLSDKPARYVVINILDKGKPVAEPVPE |
| Ga0326726_101546943 | 3300033433 | Peat Soil | KGKPPQVLKAGEYNYVPRGTIHRQQNLSGKPARYIEMRIFDKGKPASEAVGE |
| ⦗Top⦘ |