


| Basic Information | |
|---|---|
| Family ID | F083309 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MQEEKVHVRLLIVAGVALLWMTAVFGRLGYLQLVRHSDYL |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 47.79 % |
| % of genes near scaffold ends (potentially truncated) | 99.12 % |
| % of genes from short scaffolds (< 2000 bps) | 95.58 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.230 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (23.009 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.513 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (61.947 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.88% β-sheet: 0.00% Coil/Unstructured: 44.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF04977 | DivIC | 44.25 |
| PF04999 | FtsL | 28.32 |
| PF01795 | Methyltransf_5 | 17.70 |
| PF03717 | PBP_dimer | 0.88 |
| PF02873 | MurB_C | 0.88 |
| PF02381 | MraZ | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG2919 | Cell division protein FtsB | Cell cycle control, cell division, chromosome partitioning [D] | 44.25 |
| COG4839 | Cell division protein FtsL | Cell cycle control, cell division, chromosome partitioning [D] | 44.25 |
| COG3116 | Cell division protein FtsL, interacts with FtsB and FtsQ | Cell cycle control, cell division, chromosome partitioning [D] | 28.32 |
| COG0275 | 16S rRNA C1402 N4-methylase RsmH | Translation, ribosomal structure and biogenesis [J] | 17.70 |
| COG0768 | Cell division protein FtsI, peptidoglycan transpeptidase (Penicillin-binding protein 2) | Cell cycle control, cell division, chromosome partitioning [D] | 0.88 |
| COG0812 | UDP-N-acetylenolpyruvoylglucosamine reductase | Cell wall/membrane/envelope biogenesis [M] | 0.88 |
| COG2001 | MraZ, DNA-binding transcriptional regulator and inhibitor of RsmH methyltransferase activity | Translation, ribosomal structure and biogenesis [J] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.23 % |
| Unclassified | root | N/A | 1.77 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004080|Ga0062385_11143006 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 530 | Open in IMG/M |
| 3300004139|Ga0058897_11159976 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 948 | Open in IMG/M |
| 3300005165|Ga0066869_10085666 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300005332|Ga0066388_102341258 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300005541|Ga0070733_10805460 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300005542|Ga0070732_10971670 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300005548|Ga0070665_101317753 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300005554|Ga0066661_10682939 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300005557|Ga0066704_10027125 | All Organisms → cellular organisms → Bacteria | 3453 | Open in IMG/M |
| 3300005586|Ga0066691_10558883 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300006163|Ga0070715_10486290 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300007265|Ga0099794_10379685 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300009089|Ga0099828_11052893 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300009162|Ga0075423_12617162 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300010048|Ga0126373_11648101 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300010358|Ga0126370_11758088 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300010358|Ga0126370_11798286 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300010360|Ga0126372_11691928 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300010360|Ga0126372_11881364 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300010361|Ga0126378_13208429 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300010366|Ga0126379_11412347 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300010376|Ga0126381_102649789 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300010376|Ga0126381_102670962 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300010398|Ga0126383_12752737 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300010858|Ga0126345_1033479 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300010858|Ga0126345_1200909 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 903 | Open in IMG/M |
| 3300010865|Ga0126346_1189878 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2301 | Open in IMG/M |
| 3300011120|Ga0150983_10806438 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300011120|Ga0150983_12847764 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300011120|Ga0150983_15624065 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300012199|Ga0137383_10425541 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300012202|Ga0137363_10561474 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 962 | Open in IMG/M |
| 3300012210|Ga0137378_10632592 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| 3300012361|Ga0137360_11810613 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300012683|Ga0137398_10699749 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300012685|Ga0137397_10892737 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300012685|Ga0137397_11197262 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300012918|Ga0137396_11130195 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300012924|Ga0137413_10822488 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300012944|Ga0137410_11096876 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300012960|Ga0164301_10488890 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 885 | Open in IMG/M |
| 3300012971|Ga0126369_10933332 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
| 3300012971|Ga0126369_11766031 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300012971|Ga0126369_12906471 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300015054|Ga0137420_1197335 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1030 | Open in IMG/M |
| 3300016294|Ga0182041_10959231 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300016319|Ga0182033_10090069 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2226 | Open in IMG/M |
| 3300016387|Ga0182040_10257294 | All Organisms → cellular organisms → Bacteria | 1315 | Open in IMG/M |
| 3300016387|Ga0182040_11131673 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300017947|Ga0187785_10362661 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300017961|Ga0187778_11366679 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300018004|Ga0187865_1129327 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 901 | Open in IMG/M |
| 3300018006|Ga0187804_10192062 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300018034|Ga0187863_10434048 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300018060|Ga0187765_10370984 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300018088|Ga0187771_10924442 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300018088|Ga0187771_11761179 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300018089|Ga0187774_11135368 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300019268|Ga0181514_1517741 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1066 | Open in IMG/M |
| 3300019284|Ga0187797_1415136 | Not Available | 564 | Open in IMG/M |
| 3300020579|Ga0210407_10590383 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300020579|Ga0210407_10688976 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300020579|Ga0210407_10711302 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300020580|Ga0210403_10600683 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300021088|Ga0210404_10352496 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300021170|Ga0210400_11270082 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300021178|Ga0210408_11512630 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300021402|Ga0210385_10179514 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1530 | Open in IMG/M |
| 3300021407|Ga0210383_10333487 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1306 | Open in IMG/M |
| 3300021420|Ga0210394_10965137 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300021433|Ga0210391_11093743 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300021477|Ga0210398_10604468 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300021479|Ga0210410_10398873 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1232 | Open in IMG/M |
| 3300022533|Ga0242662_10086262 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300022709|Ga0222756_1057051 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300022724|Ga0242665_10083679 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 917 | Open in IMG/M |
| 3300022726|Ga0242654_10190686 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300024288|Ga0179589_10553568 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300025905|Ga0207685_10343906 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300025910|Ga0207684_10849265 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300025922|Ga0207646_10733173 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300026095|Ga0207676_11661130 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300026320|Ga0209131_1193719 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300026557|Ga0179587_10598555 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300026868|Ga0207818_1004362 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1360 | Open in IMG/M |
| 3300026928|Ga0207779_1040042 | Not Available | 537 | Open in IMG/M |
| 3300026988|Ga0207834_1022673 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300027047|Ga0208730_1025845 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300027616|Ga0209106_1037853 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1071 | Open in IMG/M |
| 3300027678|Ga0209011_1083876 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300027684|Ga0209626_1159306 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 597 | Open in IMG/M |
| 3300028138|Ga0247684_1017811 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1117 | Open in IMG/M |
| 3300028379|Ga0268266_11746428 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300028863|Ga0302218_10078403 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1035 | Open in IMG/M |
| 3300031231|Ga0170824_103518681 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2379 | Open in IMG/M |
| 3300031446|Ga0170820_11972647 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300031474|Ga0170818_109542565 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2082 | Open in IMG/M |
| 3300031763|Ga0318537_10127321 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300031820|Ga0307473_10345093 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300031831|Ga0318564_10276078 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300031910|Ga0306923_11817208 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300031912|Ga0306921_11705206 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300031941|Ga0310912_10571773 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 880 | Open in IMG/M |
| 3300031945|Ga0310913_10297879 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1137 | Open in IMG/M |
| 3300031945|Ga0310913_10337816 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1065 | Open in IMG/M |
| 3300032009|Ga0318563_10419924 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300032052|Ga0318506_10548293 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300032063|Ga0318504_10505495 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300032180|Ga0307471_100950724 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella | 1026 | Open in IMG/M |
| 3300032205|Ga0307472_101394412 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300032515|Ga0348332_10449001 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300033134|Ga0335073_11144687 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300033158|Ga0335077_11320473 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.01% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.27% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.50% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.08% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.31% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.31% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.54% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.54% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.65% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.65% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.65% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 2.65% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.77% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.89% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.89% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.89% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.89% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004139 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF230 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005165 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010858 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010865 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300018004 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300019268 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022709 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026868 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 32 (SPAdes) | Environmental | Open in IMG/M |
| 3300026928 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 44 (SPAdes) | Environmental | Open in IMG/M |
| 3300026988 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 5 (SPAdes) | Environmental | Open in IMG/M |
| 3300027047 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042 (SPAdes) | Environmental | Open in IMG/M |
| 3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028138 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25 | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028863 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062385_111430062 | 3300004080 | Bog Forest Soil | MEQEKVHVRLLILAGFVLFWMTAVFGRVAYLQLFLHSDYLTRASKQQRH |
| Ga0058897_111599761 | 3300004139 | Forest Soil | MQQDRVHVRMLIIAGVALLWMGAVFGRLTYLELFRHSDYLARALRQQQRTFE |
| Ga0066869_100856662 | 3300005165 | Soil | MQQNKIHVRILILAGLALLWMGAVFGRLAYLQLARHSEYMARGLR |
| Ga0066388_1023412582 | 3300005332 | Tropical Forest Soil | MEQEKVHVRLLIIAGTALFWMAAILGRVAYLQLFRHSEYL |
| Ga0070733_108054601 | 3300005541 | Surface Soil | MEQEKVHVRLLILAGVAFLWMTAVFGRLTYVQLFQHKVYLLL |
| Ga0070732_109716701 | 3300005542 | Surface Soil | MQQDRAHVRLLILAGVALFWMVAVFGRLSYLQLFRHGEYLA |
| Ga0070665_1013177531 | 3300005548 | Switchgrass Rhizosphere | MQEEKVHVRLLMVAGVALLWMTAVFGRLGYLQLIR |
| Ga0066661_106829392 | 3300005554 | Soil | MRQNRVHVRLLMVAGVALLWTTAVFGRLSYLQLFAHG |
| Ga0066704_100271256 | 3300005557 | Soil | MRQNRVHVRLLLIAGVALLWTTAVFGRLSYLQLFAHGE |
| Ga0066691_105588831 | 3300005586 | Soil | MRQNRVHVRLLMVAGAALLWTTAVFGRLSYLQLFAHGEYMAR |
| Ga0070715_104862901 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MQEEKIHVRLLIVAGVALLWMTAVFGRLGYLQIIRHSDYLVRAQR |
| Ga0099794_103796852 | 3300007265 | Vadose Zone Soil | MEQEKVHVRLLILAGVAFLWMTAVFGRLTYLQLIRHSEYMSRAMRQQRRTIEI |
| Ga0099828_110528932 | 3300009089 | Vadose Zone Soil | MRDRIAADRLLIVAGVGLIWMAAIFGRLGYLQLFRHSEY |
| Ga0075423_126171622 | 3300009162 | Populus Rhizosphere | MQEEKVHVRLLIVAGVALLWMMAVFGRLGYLQLIRHSDYLAR |
| Ga0126373_116481011 | 3300010048 | Tropical Forest Soil | MEQEKVHVRLLILAGVAFFWMTAVSLRLTYLQLFRH |
| Ga0126370_117580883 | 3300010358 | Tropical Forest Soil | MQEQKVHVRLLIVAGVAVFWMTAVFGRLGYLQLVRHSEY |
| Ga0126370_117982861 | 3300010358 | Tropical Forest Soil | MEQEKVHVRLLILAGVALFWMIAVFGRLTYLQFFRHSDYMSQAI |
| Ga0126372_116919282 | 3300010360 | Tropical Forest Soil | MEQEKVHVRLLILAGVGFFWMFAVFGRLTYLQFFRHSEYMSQAMRQQRHTIDIY |
| Ga0126372_118813641 | 3300010360 | Tropical Forest Soil | MQEEKVHVRLLIVAGVALLWMTAVFGRLGYLQLVRHSDYLARAQR |
| Ga0126378_132084291 | 3300010361 | Tropical Forest Soil | MEQEKVHVRLLILAGVALFWMIAVFGRLTYLQFFRHSDYMSQAIRQQRHTIDIYPKRGAI |
| Ga0126379_114123471 | 3300010366 | Tropical Forest Soil | MEQEKVHVRLLILAGVAFLWMAGVFGRLTYLQLIRHTEYMSQATRQQR |
| Ga0126381_1026497893 | 3300010376 | Tropical Forest Soil | MQEEKVHVRLLIVAGVALLWMTAVFGRLGYLQLFRHSD |
| Ga0126381_1026709622 | 3300010376 | Tropical Forest Soil | MQQEKVHARLLVLAGFLLFWMTAVFGRVAYLQLFLHSDYLA |
| Ga0126383_127527372 | 3300010398 | Tropical Forest Soil | MEQEKVHVRLLILAGVALFWMIAVFGRLTYLQFFRHSDYMSQ |
| Ga0126345_10334791 | 3300010858 | Boreal Forest Soil | MQKNRVHVRLLIIGGIAFLWMVAVFGRLSYLQLYRHSEYL |
| Ga0126345_12009093 | 3300010858 | Boreal Forest Soil | MRQDRVHVRLLIIAGVAFLWMGAVFGRLTYLQLFRHSDYL |
| Ga0126346_11898785 | 3300010865 | Boreal Forest Soil | MEQEKVHVRLLIVVGVAFLWMTAVFGRLTYLQLIRHSEYMS |
| Ga0150983_108064382 | 3300011120 | Forest Soil | MRQDRAHVRLLIIAGVALLWMGAVFGRLTYLELFRHSDYLARALRQ |
| Ga0150983_128477642 | 3300011120 | Forest Soil | MRQNRVHVRLLIVAGVALVWTTAVFGRLSYLQLIK |
| Ga0150983_156240652 | 3300011120 | Forest Soil | MAAKRILIVGLLATIWMTAVLGRLGYLQLLRHSDYMARAQRQQ |
| Ga0137383_104255413 | 3300012199 | Vadose Zone Soil | MRDRIAADRLLIVAGVGLIWMAAIFGRLGYLQLFRHSEYMAR |
| Ga0137363_105614741 | 3300012202 | Vadose Zone Soil | MQEEKVHVRLLIVAGVALVWMTMVFGRLVYLQLIRHSDYL |
| Ga0137378_106325921 | 3300012210 | Vadose Zone Soil | MRDRIAADRLLIVAGVGLIWMAAIFGRLGYLQLFRHSE |
| Ga0137360_118106132 | 3300012361 | Vadose Zone Soil | MEQEKIHVRLLILAGVAFLWMTAVFGRLTYLQLIRHSEYMSRAMRQQRRTIEID |
| Ga0137398_106997492 | 3300012683 | Vadose Zone Soil | MRQNRVHVRLLMVAGVVLLWTTAVFGRLSYLQLFA |
| Ga0137397_108927371 | 3300012685 | Vadose Zone Soil | MRQNRVHVRLLMVAGVALLWTTAVFGRLSYLQLFA |
| Ga0137397_111972621 | 3300012685 | Vadose Zone Soil | MEQEKLHFRLLILAGVAFLWMTAVFGRLTYLQLIRHSEYMS |
| Ga0137396_111301951 | 3300012918 | Vadose Zone Soil | MRQNRVHVRVLLVAGVALLWATAVFGRLSYLQLVK |
| Ga0137413_108224882 | 3300012924 | Vadose Zone Soil | MEQEKVHVRLLILAGVAFLWMTAVFGRLTYLQLIRHSEYMSRAMRQQRRTIEIDP |
| Ga0137410_110968762 | 3300012944 | Vadose Zone Soil | MRQNRVHVRLLMVAGVALLWTTAVFGRLSYLQLFAHGE |
| Ga0164301_104888901 | 3300012960 | Soil | MQQDRAHVRLLILAGVALFWMVAVFGRLSYLQLFRHGEY |
| Ga0126369_109333323 | 3300012971 | Tropical Forest Soil | MEQEKVHVRLLTVAGIALFWMAAIFGRVAFLQLFRHSE |
| Ga0126369_117660313 | 3300012971 | Tropical Forest Soil | MQEEKVHVRLMIIAGVALLWMAAVFGRLGYLQLVRHSAYL |
| Ga0126369_129064711 | 3300012971 | Tropical Forest Soil | MQEEKVHVRLLIVAGVALLWMTAVFGRLGYLQLVRHSDYL |
| Ga0137420_11973353 | 3300015054 | Vadose Zone Soil | MEQEKIHVRLLILAGVAFLWMTAVFGRLTYLQLIRHSE |
| Ga0182041_109592311 | 3300016294 | Soil | MRAERTHVRVLIVGIVALLWTTAVLGRLAYLQLFRHSEYLARA |
| Ga0182033_100900694 | 3300016319 | Soil | MEQEKVHVRLLILAGVAFLWMAAVFGRLTYLQLIRHTEYMSQATRQQRHTIDIYPKRGAI |
| Ga0182040_102572942 | 3300016387 | Soil | LCYRSASRDPGTMEQEKVHVRLLILAGVAFLWMAAVFGRLTYLQLIRHTEYMSQATRQQRHTIDIYPKRGAI |
| Ga0182040_111316732 | 3300016387 | Soil | MEQEKVHVRLLTVAGIALFWMAAIFGRVAFLQLFRHSEYLARAAKQQRKR |
| Ga0187785_103626612 | 3300017947 | Tropical Peatland | MEQEKVHVRLLILAGVAFLWMTAVFGRLTYLQFIRH |
| Ga0187778_113666791 | 3300017961 | Tropical Peatland | MQQDRVHVRLLILAGVALFWMTAVFGRVAYLQLFRHTEYLAR |
| Ga0187865_11293273 | 3300018004 | Peatland | MQQDRVHVRLLILAGVALFWMTAVLGRVAYLQLFRH |
| Ga0187804_101920623 | 3300018006 | Freshwater Sediment | MEQEKVHVRLLIFAGVALFWIAAVFGRVGYLQLFRHGEYLARAM |
| Ga0187863_104340482 | 3300018034 | Peatland | MQQDRVHARLLILAAVALFWMTAVFGRVAYLQLFCHGEYLARASRQQRRVIEITPMRGAI |
| Ga0187765_103709843 | 3300018060 | Tropical Peatland | MEQERVHVRLLIIAGIALFWMAAILGRVTYLQLFCH |
| Ga0187771_109244421 | 3300018088 | Tropical Peatland | MEQEKVHVRLLIVAGVALFWMTAVFGRVAYLQLFRHGDYLARAM |
| Ga0187771_117611791 | 3300018088 | Tropical Peatland | MEQEKVHVRLLILAGVALFWMTAVFGRVAYLQLFRHGDYLA |
| Ga0187774_111353681 | 3300018089 | Tropical Peatland | MEQEKVHVRLLILAGFLLFWIIAVFGRVAYLQLFLHGDYLA |
| Ga0181514_15177413 | 3300019268 | Peatland | MQQDRVHVRLLIIAGVAFLWMGAVAGRLSYLQLFRHSEY |
| Ga0187797_14151362 | 3300019284 | Peatland | MEQEKVHVRLLIVAGVALFWMTAVSGRVAYLQLLRHGDYLARAMRQQRRTIEITPK |
| Ga0210407_105903831 | 3300020579 | Soil | MRQDRVHVRLLIIAGVALLWMGAVFARLTYLELFRHSDYLARALR |
| Ga0210407_106889761 | 3300020579 | Soil | MQQDRVHVRLLIIASAAFLWIAAVGVRLTYLQLYRHSEALSR |
| Ga0210407_107113023 | 3300020579 | Soil | MQQDRAHVRLLILAGVALFWMVAVFGRLSYLQLFR |
| Ga0210403_106006831 | 3300020580 | Soil | MEQEKVHVRLLILAGVAFLWMTAVFGRLTYLQLIRHSEYMSRAMRQQRR |
| Ga0210404_103524961 | 3300021088 | Soil | MRQNRAHDRLLIVAGVALLWTTAVFGRLSYLQLFRH |
| Ga0210400_112700822 | 3300021170 | Soil | MRQNRVHVRLLLIAGVALLWTTAIFGRLSYLQLFAHGEYMA |
| Ga0210408_115126302 | 3300021178 | Soil | MRQDRVHVRLLIIAGVALLWMGAVFGRLTYLELFRHSDYLARALRQQQRT |
| Ga0210385_101795143 | 3300021402 | Soil | MQQDRVHVRLLIIAGVAILWMGAVFGRLTYLQLFRHSDYLS |
| Ga0210383_103334871 | 3300021407 | Soil | MQQDQEKVHGRLLLIAGVALLWMLCVFGRVAYLQLFL |
| Ga0210394_109651372 | 3300021420 | Soil | MRQNRVHVRLLMVAGVALLWTTAVFGRLSYLQLIKH |
| Ga0210391_110937431 | 3300021433 | Soil | MEQEKVHVRLLFLAGFVLFWMSAVFGRVAYLQLFRHSEY |
| Ga0210398_106044681 | 3300021477 | Soil | MEQEKVHVRLLILAGVAFLWMTAVFGRLTYLQLIRHSEYMSRAMRQQR |
| Ga0210410_103988731 | 3300021479 | Soil | MRQDRVHVRLLIIAGVALLWMGAVFGRLTYLELFRHSDYLA |
| Ga0242662_100862621 | 3300022533 | Soil | MEQEKVHVRLLIVVGVAFLWMTAVFGRLTYLQLIRHSEYMSR |
| Ga0222756_10570512 | 3300022709 | Soil | MRQDRVHVRLLIIAGVAFLWMGAVFGRLTYLQLFRHSEYLS |
| Ga0242665_100836793 | 3300022724 | Soil | MRQNRVHVRLLMVAGVALLWTTAVFGRLSYLQLIK |
| Ga0242654_101906861 | 3300022726 | Soil | MEQEKVHVRLLIVVGVAFLWMTAVFGRLTYLQLIRHSEYMSRAMRQQKR |
| Ga0179589_105535681 | 3300024288 | Vadose Zone Soil | MRQNRVHVRLLMVAGVALLWTTAVFGRLSYLQLFAHGEYL |
| Ga0207685_103439062 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MQEEKIHVRLLIVAGVALLWMTAVFGRIGYLQLIRHSDYLVRAQRHHQRT |
| Ga0207684_108492652 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MQEEKVHVRLLIVAGVALLWMTTVFGRLGYLQLIRHSDYLVR |
| Ga0207646_107331731 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MQEEKVHVRLLIVAGVALLWMTAVFGRLGYLQLVRHSTYVAR |
| Ga0207676_116611301 | 3300026095 | Switchgrass Rhizosphere | MQEEKVHVRLLIVAGVALLWMTAVLGRLGYLQLIR |
| Ga0209131_11937193 | 3300026320 | Grasslands Soil | MQEEKVHVRLLIVAGVALLWMTAVFGRLGYLQLVRHSTYVARAQRQ |
| Ga0179587_105985551 | 3300026557 | Vadose Zone Soil | MQEEKVHVRLLIVAGVALLWMTAIFGRLGYLQLVRH |
| Ga0207818_10043621 | 3300026868 | Tropical Forest Soil | MEQEKVHVRLLILAGVALFWMAAIFGRVAYLQLFRHSEYL |
| Ga0207779_10400422 | 3300026928 | Tropical Forest Soil | MQQNKVHFRILILAGLALFWMASVFGRLAYLQLARHSDYMARAMRQQRRTLDITP |
| Ga0207834_10226731 | 3300026988 | Tropical Forest Soil | MEQEKVHVRLLIIAGIALFWMAAIFGRVAYLQLFR |
| Ga0208730_10258452 | 3300027047 | Forest Soil | MEQEKVHVRLLILAGVAFLWMTAVFGRLTYLQLIRHSEYMSRAMR |
| Ga0209106_10378533 | 3300027616 | Forest Soil | MRQNRVHVRLLMVAGVALLWTTAVFGRLAYLQLFAHGEYL |
| Ga0209011_10838763 | 3300027678 | Forest Soil | MRQNRVHVRLLLVAGVALLWTTGVFGRLSYLQLIRHGEYL |
| Ga0209626_11593062 | 3300027684 | Forest Soil | MEQEKVHVRLLILAGVAFLWMTAVFGRLTYLQLIRHSEYMSRAMRQQKRTIEIDPKR |
| Ga0247684_10178111 | 3300028138 | Soil | MKEQKVHVRLLIVAGVALLWMTAVFGRLGYLQLVRHSDYLARAQRQQ |
| Ga0268266_117464281 | 3300028379 | Switchgrass Rhizosphere | MQEEKVHVRLLMVAGVALLWMTAVFGRLGYLQLIRHSDYLARAQ |
| Ga0302218_100784033 | 3300028863 | Palsa | MRQNRAHVRLLIVAGVALLWTTAVVGRLGYLQLVRHAEYLTRALR |
| Ga0170824_1035186814 | 3300031231 | Forest Soil | MQQNKADVRLLILAGVALFWILAVSGRLAYLQLFRHSEYL |
| Ga0170820_119726471 | 3300031446 | Forest Soil | MQEEKVHVRLLIVAGVALLWMTAVFGRLGYLQLVRHSS |
| Ga0170818_1095425654 | 3300031474 | Forest Soil | MQQNKADVRLLILAGVALFWILAVSGRLAYLQLFRH |
| Ga0318537_101273211 | 3300031763 | Soil | MEQEKVHVRLLIIAGTALFWMAAILGRVAYLQLFR |
| Ga0307473_103450931 | 3300031820 | Hardwood Forest Soil | MQEEKVHVRLLIVAGVALLWMTAVFGRLGYLQLVRHSTYVARA |
| Ga0318564_102760781 | 3300031831 | Soil | MEQEKVHVRLLIIAGTALFWMAAILGRVAYLQLFRHSEY |
| Ga0306923_118172082 | 3300031910 | Soil | MQEEKVHVRLLMVAGVALLWMTAVFGRLGYLQLVRHSDYLARAQRQ |
| Ga0306921_117052061 | 3300031912 | Soil | MEQEKVHVRLLILAGVAFLWMAAVFGRLTYLQLIRHTEYMSQATRQQRHTIDIYPKRGAIYD |
| Ga0310912_105717733 | 3300031941 | Soil | MQEEKVHVRLLIVAGVALLWMTAVFGRLGYLQLVRHSDYLARAQ |
| Ga0310913_102978793 | 3300031945 | Soil | MEQEKVHVRLLIIAGTALFWMAAILGRVAYLQLFRH |
| Ga0310913_103378161 | 3300031945 | Soil | MEQEKVHVRLLTVAGIALFWMAAIFGRVAFLQLFRHSEYLAR |
| Ga0318563_104199242 | 3300032009 | Soil | MEQEKVHVRLLIIAGTALFWMAAILGRVAYLQLFRHS |
| Ga0318506_105482931 | 3300032052 | Soil | MEQEKVHVRLLIIAGVALFWMAGIFGRVAYLQLFLHSEYL |
| Ga0318504_105054952 | 3300032063 | Soil | MQEEKVHVRLLMVAGVALLWMTAVFGRLGYLQLVRH |
| Ga0307471_1009507241 | 3300032180 | Hardwood Forest Soil | MEQEKVHVRLLILAGVAFLWMTAVFGRLTYLQLIHHSE |
| Ga0307472_1013944121 | 3300032205 | Hardwood Forest Soil | MRQNRVHVRLLMVAGVALLWTTAVFGRLSYLQLIKHGE |
| Ga0348332_104490012 | 3300032515 | Plant Litter | MRQDRVHVRLLIIAGVAFLWMTAVFGRLTYLQLFRHS |
| Ga0335073_111446871 | 3300033134 | Soil | MEQEKVHVRLLILAGFVLFWMTAVFGRVAYLQLFLHSDYLTRAS |
| Ga0335077_113204732 | 3300033158 | Soil | LAFPGLMEQEKVHVRLLILAGVAFFWMTAVFGRLTYLQLIRHTDYMAQAMRQKR |
| ⦗Top⦘ |