


| Basic Information | |
|---|---|
| Family ID | F083298 |
| Family Type | Metagenome |
| Number of Sequences | 113 |
| Average Sequence Length | 43 residues |
| Representative Sequence | LRIHVLRILAFLLVCVAAVPCRAQDKVTILYDAFGESKELTKDWGFS |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 94.69 % |
| % of genes near scaffold ends (potentially truncated) | 99.12 % |
| % of genes from short scaffolds (< 2000 bps) | 92.04 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (60.177 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland (15.044 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.743 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (61.947 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 56.00% β-sheet: 0.00% Coil/Unstructured: 44.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF00069 | Pkinase | 3.54 |
| PF08281 | Sigma70_r4_2 | 2.65 |
| PF05598 | DUF772 | 2.65 |
| PF02633 | Creatininase | 2.65 |
| PF13682 | CZB | 1.77 |
| PF02784 | Orn_Arg_deC_N | 1.77 |
| PF01862 | PvlArgDC | 1.77 |
| PF13365 | Trypsin_2 | 1.77 |
| PF06439 | 3keto-disac_hyd | 1.77 |
| PF13519 | VWA_2 | 0.88 |
| PF13426 | PAS_9 | 0.88 |
| PF03551 | PadR | 0.88 |
| PF14257 | DUF4349 | 0.88 |
| PF13376 | OmdA | 0.88 |
| PF00850 | Hist_deacetyl | 0.88 |
| PF04542 | Sigma70_r2 | 0.88 |
| PF02371 | Transposase_20 | 0.88 |
| PF01740 | STAS | 0.88 |
| PF05163 | DinB | 0.88 |
| PF08327 | AHSA1 | 0.88 |
| PF12706 | Lactamase_B_2 | 0.88 |
| PF00144 | Beta-lactamase | 0.88 |
| PF11453 | DUF2950 | 0.88 |
| PF01408 | GFO_IDH_MocA | 0.88 |
| PF05988 | DUF899 | 0.88 |
| PF08448 | PAS_4 | 0.88 |
| PF00296 | Bac_luciferase | 0.88 |
| PF07676 | PD40 | 0.88 |
| PF14329 | DUF4386 | 0.88 |
| PF01872 | RibD_C | 0.88 |
| PF01548 | DEDD_Tnp_IS110 | 0.88 |
| PF00881 | Nitroreductase | 0.88 |
| PF11185 | DUF2971 | 0.88 |
| PF01527 | HTH_Tnp_1 | 0.88 |
| PF00312 | Ribosomal_S15 | 0.88 |
| PF01425 | Amidase | 0.88 |
| PF13411 | MerR_1 | 0.88 |
| PF08897 | DUF1841 | 0.88 |
| PF00278 | Orn_DAP_Arg_deC | 0.88 |
| PF14014 | DUF4230 | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 14.16 |
| COG0019 | Diaminopimelate decarboxylase | Amino acid transport and metabolism [E] | 2.65 |
| COG1166 | Arginine decarboxylase (spermidine biosynthesis) | Amino acid transport and metabolism [E] | 2.65 |
| COG1402 | Creatinine amidohydrolase/Fe(II)-dependent FAPy formamide hydrolase (riboflavin and F420 biosynthesis) | Coenzyme transport and metabolism [H] | 2.65 |
| COG0123 | Acetoin utilization deacetylase AcuC or a related deacetylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.77 |
| COG1945 | Pyruvoyl-dependent arginine decarboxylase | Amino acid transport and metabolism [E] | 1.77 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.77 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.88 |
| COG0184 | Ribosomal protein S15P/S13E | Translation, ribosomal structure and biogenesis [J] | 0.88 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.88 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.88 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.88 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.88 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.88 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.88 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.88 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.88 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.88 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.88 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.88 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.88 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.88 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.88 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 60.18 % |
| Unclassified | root | N/A | 39.82 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001087|JGI12677J13195_1008828 | Not Available | 721 | Open in IMG/M |
| 3300001166|JGI12694J13545_1025226 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300001167|JGI12673J13574_1005036 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300001593|JGI12635J15846_10106735 | All Organisms → cellular organisms → Bacteria | 1999 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100255777 | Not Available | 1638 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100792269 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 828 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101630415 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300003351|JGI26346J50198_1022305 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300004080|Ga0062385_10409806 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 813 | Open in IMG/M |
| 3300004082|Ga0062384_100489035 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 813 | Open in IMG/M |
| 3300004091|Ga0062387_100067660 | All Organisms → cellular organisms → Bacteria | 1793 | Open in IMG/M |
| 3300004091|Ga0062387_100176444 | All Organisms → cellular organisms → Bacteria | 1263 | Open in IMG/M |
| 3300004092|Ga0062389_104662680 | Not Available | 516 | Open in IMG/M |
| 3300005436|Ga0070713_100221955 | All Organisms → cellular organisms → Bacteria | 1715 | Open in IMG/M |
| 3300005591|Ga0070761_10750605 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300005602|Ga0070762_11177993 | Not Available | 530 | Open in IMG/M |
| 3300005921|Ga0070766_10530120 | Not Available | 785 | Open in IMG/M |
| 3300005921|Ga0070766_11215637 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300006050|Ga0075028_100841130 | Not Available | 562 | Open in IMG/M |
| 3300006059|Ga0075017_100097351 | Not Available | 2045 | Open in IMG/M |
| 3300006059|Ga0075017_101312919 | Not Available | 568 | Open in IMG/M |
| 3300006086|Ga0075019_10161604 | Not Available | 1313 | Open in IMG/M |
| 3300006163|Ga0070715_10786235 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 576 | Open in IMG/M |
| 3300006175|Ga0070712_100577971 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300006176|Ga0070765_100301883 | Not Available | 1480 | Open in IMG/M |
| 3300006176|Ga0070765_101673233 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 598 | Open in IMG/M |
| 3300009524|Ga0116225_1302516 | Not Available | 714 | Open in IMG/M |
| 3300009623|Ga0116133_1123630 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300009764|Ga0116134_1041519 | Not Available | 1785 | Open in IMG/M |
| 3300009792|Ga0126374_10267138 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1127 | Open in IMG/M |
| 3300009839|Ga0116223_10806407 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
| 3300010361|Ga0126378_10533459 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 1289 | Open in IMG/M |
| 3300010376|Ga0126381_100091846 | All Organisms → cellular organisms → Bacteria | 3852 | Open in IMG/M |
| 3300010376|Ga0126381_100666105 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1486 | Open in IMG/M |
| 3300010379|Ga0136449_100991213 | All Organisms → cellular organisms → Bacteria | 1354 | Open in IMG/M |
| 3300011269|Ga0137392_11426135 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300012096|Ga0137389_11208717 | Not Available | 647 | Open in IMG/M |
| 3300014156|Ga0181518_10100198 | Not Available | 1619 | Open in IMG/M |
| 3300014201|Ga0181537_11041961 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300014654|Ga0181525_10240046 | Not Available | 989 | Open in IMG/M |
| 3300014657|Ga0181522_10160463 | All Organisms → cellular organisms → Bacteria | 1317 | Open in IMG/M |
| 3300017939|Ga0187775_10027186 | All Organisms → cellular organisms → Bacteria | 1616 | Open in IMG/M |
| 3300017943|Ga0187819_10621741 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300017946|Ga0187879_10840455 | Not Available | 513 | Open in IMG/M |
| 3300017970|Ga0187783_10346938 | Not Available | 1081 | Open in IMG/M |
| 3300017972|Ga0187781_10775609 | Not Available | 695 | Open in IMG/M |
| 3300017972|Ga0187781_11122424 | Not Available | 577 | Open in IMG/M |
| 3300017973|Ga0187780_10017899 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5125 | Open in IMG/M |
| 3300017973|Ga0187780_10221344 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1322 | Open in IMG/M |
| 3300017975|Ga0187782_10708196 | Not Available | 776 | Open in IMG/M |
| 3300017975|Ga0187782_10886104 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
| 3300018003|Ga0187876_1157562 | Not Available | 789 | Open in IMG/M |
| 3300018034|Ga0187863_10231250 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1028 | Open in IMG/M |
| 3300018035|Ga0187875_10088693 | All Organisms → cellular organisms → Bacteria | 1768 | Open in IMG/M |
| 3300018040|Ga0187862_10379207 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 873 | Open in IMG/M |
| 3300018042|Ga0187871_10218335 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
| 3300018043|Ga0187887_10212700 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
| 3300018047|Ga0187859_10093437 | All Organisms → cellular organisms → Bacteria | 1582 | Open in IMG/M |
| 3300018047|Ga0187859_10218450 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1019 | Open in IMG/M |
| 3300018057|Ga0187858_10713705 | Not Available | 598 | Open in IMG/M |
| 3300018062|Ga0187784_10169529 | All Organisms → cellular organisms → Bacteria | 1784 | Open in IMG/M |
| 3300018062|Ga0187784_10268250 | All Organisms → cellular organisms → Bacteria | 1388 | Open in IMG/M |
| 3300018062|Ga0187784_10794225 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300018062|Ga0187784_11465313 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300018064|Ga0187773_10052219 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1885 | Open in IMG/M |
| 3300018085|Ga0187772_10134087 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1626 | Open in IMG/M |
| 3300018086|Ga0187769_10200848 | All Organisms → cellular organisms → Bacteria | 1475 | Open in IMG/M |
| 3300018086|Ga0187769_11357505 | Not Available | 538 | Open in IMG/M |
| 3300018090|Ga0187770_10080413 | All Organisms → cellular organisms → Bacteria | 2403 | Open in IMG/M |
| 3300019999|Ga0193718_1068507 | Not Available | 760 | Open in IMG/M |
| 3300020580|Ga0210403_10354856 | Not Available | 1200 | Open in IMG/M |
| 3300021181|Ga0210388_10011530 | All Organisms → cellular organisms → Bacteria | 7049 | Open in IMG/M |
| 3300021401|Ga0210393_10454282 | Not Available | 1046 | Open in IMG/M |
| 3300021403|Ga0210397_11242636 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300021420|Ga0210394_10198882 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1748 | Open in IMG/M |
| 3300021559|Ga0210409_11607792 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300021560|Ga0126371_11942117 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 707 | Open in IMG/M |
| 3300026281|Ga0209863_10059125 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
| 3300026291|Ga0209890_10066784 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1296 | Open in IMG/M |
| 3300027432|Ga0209421_1062142 | Not Available | 749 | Open in IMG/M |
| 3300027590|Ga0209116_1040872 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300027591|Ga0209733_1089423 | Not Available | 784 | Open in IMG/M |
| 3300027609|Ga0209221_1028793 | Not Available | 1479 | Open in IMG/M |
| 3300027609|Ga0209221_1127388 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
| 3300027629|Ga0209422_1088233 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300027635|Ga0209625_1034119 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1133 | Open in IMG/M |
| 3300027824|Ga0209040_10154621 | All Organisms → cellular organisms → Bacteria | 1234 | Open in IMG/M |
| 3300027855|Ga0209693_10282771 | Not Available | 811 | Open in IMG/M |
| 3300027879|Ga0209169_10108855 | All Organisms → cellular organisms → Bacteria | 1435 | Open in IMG/M |
| 3300027895|Ga0209624_10046210 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2783 | Open in IMG/M |
| 3300027911|Ga0209698_10451104 | Not Available | 1000 | Open in IMG/M |
| 3300027911|Ga0209698_11368119 | Not Available | 516 | Open in IMG/M |
| 3300028047|Ga0209526_10743253 | Not Available | 613 | Open in IMG/M |
| 3300028808|Ga0302228_10060829 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1806 | Open in IMG/M |
| 3300028879|Ga0302229_10068802 | Not Available | 1719 | Open in IMG/M |
| 3300029817|Ga0247275_1137709 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300029944|Ga0311352_11189017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. L60 | 579 | Open in IMG/M |
| 3300029951|Ga0311371_11047970 | Not Available | 963 | Open in IMG/M |
| 3300030054|Ga0302182_10411563 | Not Available | 566 | Open in IMG/M |
| 3300030056|Ga0302181_10022200 | All Organisms → cellular organisms → Bacteria | 3607 | Open in IMG/M |
| 3300031233|Ga0302307_10385272 | Not Available | 713 | Open in IMG/M |
| 3300031715|Ga0307476_11096733 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium F42-01 | 585 | Open in IMG/M |
| 3300031719|Ga0306917_10086420 | All Organisms → cellular organisms → Bacteria | 2216 | Open in IMG/M |
| 3300031754|Ga0307475_11154192 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300031833|Ga0310917_10942930 | Not Available | 580 | Open in IMG/M |
| 3300031837|Ga0302315_10285416 | Not Available | 953 | Open in IMG/M |
| 3300031945|Ga0310913_10176584 | Not Available | 1486 | Open in IMG/M |
| 3300031947|Ga0310909_11461656 | Not Available | 545 | Open in IMG/M |
| 3300032160|Ga0311301_12919423 | Not Available | 517 | Open in IMG/M |
| 3300032205|Ga0307472_102477244 | Not Available | 527 | Open in IMG/M |
| 3300033158|Ga0335077_10146060 | All Organisms → cellular organisms → Bacteria | 2720 | Open in IMG/M |
| 3300033289|Ga0310914_10761935 | Not Available | 865 | Open in IMG/M |
| 3300034282|Ga0370492_0283234 | Not Available | 673 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 15.04% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 14.16% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 8.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.85% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 7.08% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 7.08% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 6.19% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 5.31% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.42% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.54% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.54% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.65% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.65% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.77% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.77% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.89% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.89% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001087 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 | Environmental | Open in IMG/M |
| 3300001166 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 | Environmental | Open in IMG/M |
| 3300001167 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003351 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018003 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019999 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
| 3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027609 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300029817 | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Bog25 | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031837 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12677J13195_10088281 | 3300001087 | Forest Soil | MHGLKIVAFVVALVVACAAARVCRAQDRVTILYDAFGE |
| JGI12694J13545_10252262 | 3300001166 | Forest Soil | VRIHVLKIVAFLLMCGAAVPCRAQDRVTILYDAFGESKELTKDWGFSA |
| JGI12673J13574_10050361 | 3300001167 | Forest Soil | LRSYVLRILALVVVYGAAVPCRAQDKVTILYDAFGESKTLTKD |
| JGI12635J15846_101067352 | 3300001593 | Forest Soil | LRSHVWRILILAFVLVCVTGVPSRAQDKVTILYDAFGESKTLTKDWGFS |
| JGIcombinedJ26739_1002557771 | 3300002245 | Forest Soil | LRIHVLRILAFVLLWAAATPCRAQDKVTILYDAFGESAGL |
| JGIcombinedJ26739_1007922691 | 3300002245 | Forest Soil | LRSYVLRILALVVVYGAAVPCRAQDKVTILYDAFGESKTLTKDWGFSAL |
| JGIcombinedJ26739_1016304152 | 3300002245 | Forest Soil | VRIHVLKIVAFLLMCGAAVPCRAQDRVTILYDAFGESKELTKDWGFSAF |
| JGI26346J50198_10223051 | 3300003351 | Bog Forest Soil | LRIHVLRILVFLLVCVATVPCGAQDKVTTLYDAFGESKGLTKDWGYSA |
| Ga0062385_104098062 | 3300004080 | Bog Forest Soil | LRIHAFRILTFLLVYVAAVPCRAQDKVTILYDAFGESKEL |
| Ga0062384_1004890352 | 3300004082 | Bog Forest Soil | LRVHVLRILAFLLVYVAAVHCRAQDKVTILYDAFGESKEL |
| Ga0062387_1000676601 | 3300004091 | Bog Forest Soil | LRIHALRILTFLLVYVAAVPCRAQDKVTILYDAFGESKELTKDWGFSA |
| Ga0062387_1001764442 | 3300004091 | Bog Forest Soil | VRIHAMRVLTLLLLYVAALPCRAQDKVTILYDAFGESKEL |
| Ga0062389_1046626802 | 3300004092 | Bog Forest Soil | LRIHILLILAFVLVCAAAIPCRAQDKVTILYDAFGESAQLTKDWGFSALV |
| Ga0070713_1002219551 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | LRVHVLRILVFLLVCVAVVRCRAQDKVTILYDAFGESKELTKDWGYSALV |
| Ga0070761_107506051 | 3300005591 | Soil | MRIHPLRILTFLLLYVAAVPCRAQDKVTILYDAFGESKELTKDWGFSA |
| Ga0070762_111779931 | 3300005602 | Soil | LRVHILRILAFLLACAAAVPCRAQDKVTILYDAFGESKEL |
| Ga0070766_105301203 | 3300005921 | Soil | LRIRVLTILTFLLLYAAAVPCRAQDRVTILYDAFGESKEL |
| Ga0070766_112156372 | 3300005921 | Soil | LRIHILRILAFALLCAAAVPCRAQDKVTILYDAFGESKEL |
| Ga0075028_1008411301 | 3300006050 | Watersheds | LRVHALRILAFLLVYVAAVPCGAQDKVTILYDAFGES |
| Ga0075017_1000973511 | 3300006059 | Watersheds | MFLLVYVAAVPCRAQDKVTILYDAFGESKELTKDWGF |
| Ga0075017_1013129192 | 3300006059 | Watersheds | LRIHALRILTFLLVYVAAVPCLAQDKVTILYDAFGESKELTKDWGFSAFV |
| Ga0075019_101616041 | 3300006086 | Watersheds | LRIHILRILAFLLVCASAVLCGAQDKVTILYDAFGESKEL |
| Ga0070715_107862351 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | LRIYVLRILAFTLLCMVAVPCRAQDKVTILYDAIGESKQLTKDWGFSAL |
| Ga0070712_1005779712 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LRVHVLRILAFLMMCVAALPCRAQDKVTILYDAFG |
| Ga0070765_1003018831 | 3300006176 | Soil | VRIHVLRIIAILLVLLCLAAGPCRAQDKVTILYDAFGESKQLT |
| Ga0070765_1016732332 | 3300006176 | Soil | LRIHALRVLTFLLVCVAAVPCRAQDKVTILYDAFGESKELTKDWG |
| Ga0116225_13025162 | 3300009524 | Peatlands Soil | LRVHFLRILACAWLCAAAVPCRAQDRVTILYDAFGEAKDLT |
| Ga0116133_11236302 | 3300009623 | Peatland | LRIHALRILTFLLVCMAAVPCRAQDKVTILYDAFG |
| Ga0116134_10415192 | 3300009764 | Peatland | LRIHGLRILAFLLVYVAAVPCRAQDRVTILYDAFGESKELTKDWGFSA |
| Ga0126374_102671381 | 3300009792 | Tropical Forest Soil | MRIHALRILTFLLVGVAAVPCRAQDKVTILYDAFG |
| Ga0116223_108064071 | 3300009839 | Peatlands Soil | LRIHVLRILAFLLVCVAAVPCRAQDKVTILYDAFGES |
| Ga0126378_105334591 | 3300010361 | Tropical Forest Soil | LTFLLLGVAAGPCQAQDKVTILYDAFGESKELTKDWGFSAF |
| Ga0126381_1000918463 | 3300010376 | Tropical Forest Soil | LTFLLVGVAAVPCRAQHKVTILYDAFGESKELTKDWGFSAFVEH |
| Ga0126381_1006661053 | 3300010376 | Tropical Forest Soil | LTFLLVCVAALPCRAQDKVTILYDAFGESKELTKDWGFSAFVEH |
| Ga0136449_1009912133 | 3300010379 | Peatlands Soil | LAFLLVYVAAVPCRAQDKVTILYDAFGESKELTKDWG |
| Ga0137392_114261351 | 3300011269 | Vadose Zone Soil | MLLLVYVAAVPCRAQDKVTILYDAFGESKELTKDWGFSA |
| Ga0137389_112087171 | 3300012096 | Vadose Zone Soil | LRILAFLLVCVAAVPCGAQDKVTILYDAFGESKELTKDWGYSAFVE |
| Ga0181518_101001982 | 3300014156 | Bog | LTFLLVYVAAVPCRAQDKVTILYDAFGESKELTKDWGYSAL |
| Ga0181537_110419611 | 3300014201 | Bog | LRIYIFRILAFLLLYAAAIPCRAQDKVTILYDAFGESKELTKDWGFSAL |
| Ga0181525_102400462 | 3300014654 | Bog | LRILAFLLVYVAAVPCRAQDKVTILYDAFGESKELTKDWGFSAFVEHN |
| Ga0181522_101604633 | 3300014657 | Bog | LRIHALRILTFLLVYVAAVPCRAQDKVTILYDAFGES |
| Ga0187775_100271861 | 3300017939 | Tropical Peatland | MRKIDFLPILAFVLLCVAAFPCRAQDKVTILYDAFGESKE |
| Ga0187819_106217412 | 3300017943 | Freshwater Sediment | MKQFSGVFLQILALALVCFAAVPCRAQDRVTILYDAFGDSKQLNK |
| Ga0187879_108404552 | 3300017946 | Peatland | VRIHALRIIAILLVLLCLAAVPCRAQDKVTILYDAFGESKQLTRDWG |
| Ga0187783_103469381 | 3300017970 | Tropical Peatland | LRIHALRILTFLLVSVAAGPCRAQDKVTILYDAFGESKELTKDWGFSTF |
| Ga0187781_107756091 | 3300017972 | Tropical Peatland | LRIHALRILTFLLVCVAAVPCRAQDKVTILYDAFGESKELT |
| Ga0187781_111224242 | 3300017972 | Tropical Peatland | LRIHALRMLTFLLVCVAAVPCRAQDKVTILYDAFGESKELTKDWGFS |
| Ga0187780_100178991 | 3300017973 | Tropical Peatland | LRIHALRILTFLLVCVAAVPCRAQDKVTILYDAFGESKELTK |
| Ga0187780_102213441 | 3300017973 | Tropical Peatland | LRILTFLLVCVAAVPCRAQDKVTILYDAFGESKELTK |
| Ga0187782_107081962 | 3300017975 | Tropical Peatland | MRKVDVLLTLAFLLVCVAAVPCRAQDKVTILYDAFG |
| Ga0187782_108861042 | 3300017975 | Tropical Peatland | LTFLLVCVAAVPCRAQDKVTILYDAFGESKELTKDWGFSALV |
| Ga0187876_11575622 | 3300018003 | Peatland | LRIHVLRILVFLLACVAAVPCGAQDKVTILYDAFGESKELTKDWGY |
| Ga0187863_102312502 | 3300018034 | Peatland | LRIHALRILTFLLVFVAAVPCRAQDKVTILYDAFGES |
| Ga0187875_100886932 | 3300018035 | Peatland | LRIHALRILTFLLVFVAAVPCRAQDKVTILYDAFGESKELTKDWGFSAF |
| Ga0187862_103792071 | 3300018040 | Peatland | LRIYALRILTFLLVCVAAVPCRAQDKVTILYDAFG |
| Ga0187871_102183351 | 3300018042 | Peatland | LRIHALRILTFLLCMAAVPCRAQDKVTILYDAFGESKELTKDWG |
| Ga0187887_102127001 | 3300018043 | Peatland | LRIHVLRILAFLLACVAAVPCRAQDKVTILYDAFGESKELTKDWGF |
| Ga0187859_100934371 | 3300018047 | Peatland | LRIHALRILTFLLVYVAAVPCRAQDKLTILYDAFGESKVLTKD |
| Ga0187859_102184503 | 3300018047 | Peatland | MFLLACVAAVPCGAQDKVTTLYDAFGESKELTKDW |
| Ga0187858_107137051 | 3300018057 | Peatland | LRIHALRILTFLLVFVAAIPCRAQDKVTILYDAFGESTELTKDWGYSAL |
| Ga0187784_101695292 | 3300018062 | Tropical Peatland | LRSHVLRVLTVLLVYVAAVPCRAQDKVTILYDAFGE |
| Ga0187784_102682503 | 3300018062 | Tropical Peatland | MMKVDVLLTLAFLLVCVAAVPCRAQDKVTILYDAFGES |
| Ga0187784_107942251 | 3300018062 | Tropical Peatland | LRIHALRILTFLLVCVAAVPCWAQDKVTILYDAFGESKKLTKDWGFSAFVEHN |
| Ga0187784_114653132 | 3300018062 | Tropical Peatland | LRIRGLPFLAFVLLCAAAIPCPAQDKVTILYDAFGESAQLT |
| Ga0187773_100522191 | 3300018064 | Tropical Peatland | MRKIDVLRILSFVLVCVAAVPCRAQDKVTILYDAFGESKELTKDWGFSALV |
| Ga0187772_101340871 | 3300018085 | Tropical Peatland | MRLHVVLIFTLTLMSLAAIPSRAQDRVTILYDAFGESKELTKDWGF |
| Ga0187769_102008483 | 3300018086 | Tropical Peatland | LRIHALRILTFLLVCVAAVPSWAQDNVAQDKVTILYDAFGESK |
| Ga0187769_113575052 | 3300018086 | Tropical Peatland | MRIHVLRILALVLVCVAAGPCWAQDKVTILYDAFGESK |
| Ga0187770_100804134 | 3300018090 | Tropical Peatland | LRIHALRILTFLLVCVAAVPSWAQDNVAQDKVTILYDAFGESKELTKDWGFS |
| Ga0193718_10685072 | 3300019999 | Soil | LRIHVLRILAFLLVCVAAVPCGAQDKVTILYDAFGESKELTKDWGYSAL |
| Ga0210403_103548562 | 3300020580 | Soil | LRIHVLRILAFLLLYVAAVPCRAQDKVTILYDAFGESKELTK |
| Ga0210388_1001153010 | 3300021181 | Soil | PLRIHALRILTFLLVYVAALPCRAQDKVAILYDAFGESKGLTQPPKTVPPTM |
| Ga0210393_104542821 | 3300021401 | Soil | LRIHVLRILVFLLACVAAVPCGAQDKVTILYDAFGESKELT |
| Ga0210397_112426361 | 3300021403 | Soil | LRISVLRILALVLVCVAAIPCRGQDKVTILFDAFGESAGLT |
| Ga0210394_101988823 | 3300021420 | Soil | VGSFALKIAAFVLVCLAALPCRAQDRVTILYDAFGQSKELTKDWGFSA |
| Ga0210409_116077921 | 3300021559 | Soil | LRIHVLRVLAFLVVCVAAVPCRAQDKVTILYDAFGESKELTKDW |
| Ga0126371_119421171 | 3300021560 | Tropical Forest Soil | MRIRALRILTFLLVCVAAVPCRAQDKVTILYDAFGESNELTKDWGFSAF |
| Ga0209863_100591252 | 3300026281 | Prmafrost Soil | LRVHVLRILAFALVWVAAVPCRAQDKVTILYDAFGESKDLT |
| Ga0209890_100667841 | 3300026291 | Soil | LRVHVLRILAFLLVCVVVVPCRAQDKVTILYDAFGESKEL |
| Ga0209421_10621421 | 3300027432 | Forest Soil | VRIHVLRIISILLVLLCLAAVPCPAQDKVTILYDA |
| Ga0209116_10408721 | 3300027590 | Forest Soil | LRIHVLRILAFVLVWAAATPCRAQDKVTILYDAFGESAELTKDWGS |
| Ga0209733_10894231 | 3300027591 | Forest Soil | LRIHVLRVLAFLLVCAAAVPCGAQDKVTILYDAFGESKEL |
| Ga0209221_10287933 | 3300027609 | Forest Soil | LRVQGLRILAFLLVCVAAIPCRAQDKVTVLYDAFGESKELT |
| Ga0209221_11273882 | 3300027609 | Forest Soil | LRVHGLRILAFLLVCVAAVSCRAQDKVTILYDAFGESKE |
| Ga0209422_10882332 | 3300027629 | Forest Soil | LRTHVLRMLAFVLVYVAAVPCRAQDKVTILYDAFGESKTLTKDWGFSALI |
| Ga0209625_10341193 | 3300027635 | Forest Soil | LRIHVLRILSFVLVCLAAIPCRAQDKVTILYDAFGE |
| Ga0209040_101546211 | 3300027824 | Bog Forest Soil | LRVHVLRILAFLLVWVAAVPCRAQDKVTILYDAFGESKELTKDWGFSAL |
| Ga0209693_102827712 | 3300027855 | Soil | MRINIRRILIFLLIGAAAIPCPALDKVTILYDAFGESNQLTKDWGFSA |
| Ga0209169_101088551 | 3300027879 | Soil | LRIHVLRVLAFLLVCVAAVPCRAQDKVTILYDAFGESKEL |
| Ga0209624_100462101 | 3300027895 | Forest Soil | MRIHALRILTFLLVYVAAVPCLAQDKVTILYDAFGESKELTKDWGFSAL |
| Ga0209698_104511043 | 3300027911 | Watersheds | LRVHALRILAFLLVYVAAVPCGAQDKVTILYDAFGESKELTK |
| Ga0209698_113681191 | 3300027911 | Watersheds | LRIHALRILTFLLLYVAAVPCRAQDKVTILYDAFGESKELTK |
| Ga0209526_107432531 | 3300028047 | Forest Soil | LRSYILRILAFALMYVVAVPCRAQDKVTILYDAFGDSKTLTKDW |
| Ga0302228_100608291 | 3300028808 | Palsa | LRILAFWLVCVAAVPCRAQDRVTILYDAFGESKELTKDWGYSAL |
| Ga0302229_100688022 | 3300028879 | Palsa | VRIHVLRIVAILLVLLCLAAVPCRAQDKVTILYDAFGESKQLTK |
| Ga0247275_11377091 | 3300029817 | Soil | LRIHVLRILAFLLVCVAAVPCRAQDKVTILYDAFGESKE |
| Ga0311352_111890172 | 3300029944 | Palsa | MHVLKIVAFVLACAVAGPCRAQDKVTILYDAFGESKELTKDW |
| Ga0311371_110479702 | 3300029951 | Palsa | MHVLKIVAFVLACAVAGPCRAQDKVTILYDAFGDS |
| Ga0302182_104115632 | 3300030054 | Palsa | LRIHALKILAFLLVYVAAVPCGAQDKVTILYDAFGESKELTKDW |
| Ga0302181_100222001 | 3300030056 | Palsa | VRIHVLRIIGILLVLLCLAAVPCRAQDKVTILYDA |
| Ga0302307_103852722 | 3300031233 | Palsa | VRIHVLRIISILLVLLCLAAVPCPAQDKVTILYDAFGESKELTKDW |
| Ga0307476_110967331 | 3300031715 | Hardwood Forest Soil | LRFHVVLRILAFALLCVAAVPCRAQDKVTILYDAFGESKELTKDWG |
| Ga0306917_100864201 | 3300031719 | Soil | LRIHVLRVLAFVLACVAAAPCRAQDKVTILYDAFGESKELTKDWGF |
| Ga0307475_111541921 | 3300031754 | Hardwood Forest Soil | LRIYVLRILAFTLLCMVAVPCRAQDKVTILYDAIGESKQLTKDWGFSALVEHD |
| Ga0310917_109429302 | 3300031833 | Soil | LRIQVLLILAFVLVCAAAIPCQAQDKVTILYDAFGESKELTK |
| Ga0302315_102854162 | 3300031837 | Palsa | MHVLKIVAFVLACAVAGPCRAQDKVTILYDAFGESKELTKDWG |
| Ga0310913_101765841 | 3300031945 | Soil | LRNHVLRILALLCVAVVPCRAHDKVTVLYDAFGESKELTED |
| Ga0310909_114616561 | 3300031947 | Soil | LRIHVLWILKFVLLGMVTVPCRAQDKVTILYDAFGESKELTKDWGFSAL |
| Ga0311301_129194231 | 3300032160 | Peatlands Soil | LRIHVLRILAFLLVCVAAVPCRAQDKVTILYDAFGESKELTKDWGFS |
| Ga0307472_1024772441 | 3300032205 | Hardwood Forest Soil | MKQFSDVFLGILAFALMCVAAVPCGAQDKVTIIYDAFGESKELTKDWG |
| Ga0335077_101460604 | 3300033158 | Soil | VRTPLLRIVAVFFFCAAALPCLAQDRITILYDAFGDSKDLT |
| Ga0310914_107619351 | 3300033289 | Soil | LRIQVLRTLAFVLVCAAAIPCQAQDKVTILYDAFGESAQLTKDWGFSAL |
| Ga0370492_0283234_524_673 | 3300034282 | Untreated Peat Soil | MRAHGLQVLAFLLVCVAAVPCRAQDKVTVLYDAFGESKELTKDWGFSALV |
| ⦗Top⦘ |