


| Basic Information | |
|---|---|
| Family ID | F083283 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 40 residues |
| Representative Sequence | YYSGSPEYAGTVNVVRLTAAGEVAVTRAALDIAREPSAVD |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.88 % |
| % of genes near scaffold ends (potentially truncated) | 98.23 % |
| % of genes from short scaffolds (< 2000 bps) | 92.92 % |
| Associated GOLD sequencing projects | 104 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (86.726 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.274 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.009 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.788 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 29.41% Coil/Unstructured: 70.59% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF01344 | Kelch_1 | 22.12 |
| PF03061 | 4HBT | 11.50 |
| PF13415 | Kelch_3 | 7.96 |
| PF09084 | NMT1 | 4.42 |
| PF03401 | TctC | 3.54 |
| PF13964 | Kelch_6 | 3.54 |
| PF13308 | YARHG | 0.88 |
| PF04909 | Amidohydro_2 | 0.88 |
| PF00583 | Acetyltransf_1 | 0.88 |
| PF03466 | LysR_substrate | 0.88 |
| PF01075 | Glyco_transf_9 | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 4.42 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 4.42 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 3.54 |
| COG0859 | ADP-heptose:LPS heptosyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 86.73 % |
| Unclassified | root | N/A | 13.27 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459020|G1P06HT01B08KJ | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 704 | Open in IMG/M |
| 3300000655|AF_2010_repII_A100DRAFT_1024444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1131 | Open in IMG/M |
| 3300000655|AF_2010_repII_A100DRAFT_1061226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 667 | Open in IMG/M |
| 3300000955|JGI1027J12803_109685692 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 613 | Open in IMG/M |
| 3300001164|JGI11823J13286_1009478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 688 | Open in IMG/M |
| 3300002911|JGI25390J43892_10038695 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1144 | Open in IMG/M |
| 3300004006|Ga0055453_10028487 | All Organisms → cellular organisms → Bacteria | 1426 | Open in IMG/M |
| 3300004152|Ga0062386_100098632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 2243 | Open in IMG/M |
| 3300004156|Ga0062589_101469942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 668 | Open in IMG/M |
| 3300004643|Ga0062591_101109036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 763 | Open in IMG/M |
| 3300005164|Ga0066815_10047207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 700 | Open in IMG/M |
| 3300005175|Ga0066673_10517974 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 701 | Open in IMG/M |
| 3300005187|Ga0066675_11370674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 519 | Open in IMG/M |
| 3300005332|Ga0066388_100756855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1570 | Open in IMG/M |
| 3300005332|Ga0066388_105686407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 631 | Open in IMG/M |
| 3300005434|Ga0070709_11109266 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 633 | Open in IMG/M |
| 3300005436|Ga0070713_101155958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 749 | Open in IMG/M |
| 3300005455|Ga0070663_100589957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 933 | Open in IMG/M |
| 3300005518|Ga0070699_100075111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2941 | Open in IMG/M |
| 3300005554|Ga0066661_10075897 | All Organisms → cellular organisms → Bacteria | 1971 | Open in IMG/M |
| 3300005610|Ga0070763_10928545 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 519 | Open in IMG/M |
| 3300005713|Ga0066905_100062477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. | 2350 | Open in IMG/M |
| 3300005764|Ga0066903_101335256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1342 | Open in IMG/M |
| 3300005764|Ga0066903_105878581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 644 | Open in IMG/M |
| 3300005764|Ga0066903_105950352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 639 | Open in IMG/M |
| 3300005921|Ga0070766_10697080 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 687 | Open in IMG/M |
| 3300006038|Ga0075365_11330631 | Not Available | 505 | Open in IMG/M |
| 3300006050|Ga0075028_100448553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 745 | Open in IMG/M |
| 3300006163|Ga0070715_11056538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 509 | Open in IMG/M |
| 3300006173|Ga0070716_100613682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 820 | Open in IMG/M |
| 3300006176|Ga0070765_100981056 | Not Available | 799 | Open in IMG/M |
| 3300006800|Ga0066660_10313750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1258 | Open in IMG/M |
| 3300006880|Ga0075429_100084721 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2763 | Open in IMG/M |
| 3300007788|Ga0099795_10049906 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1520 | Open in IMG/M |
| 3300009012|Ga0066710_101374906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1095 | Open in IMG/M |
| 3300009089|Ga0099828_11515024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 591 | Open in IMG/M |
| 3300009098|Ga0105245_12719248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 548 | Open in IMG/M |
| 3300009100|Ga0075418_12319820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 585 | Open in IMG/M |
| 3300009792|Ga0126374_10669508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 776 | Open in IMG/M |
| 3300009792|Ga0126374_11046018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 644 | Open in IMG/M |
| 3300010043|Ga0126380_10350597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1074 | Open in IMG/M |
| 3300010046|Ga0126384_10128654 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1918 | Open in IMG/M |
| 3300010046|Ga0126384_11916670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 565 | Open in IMG/M |
| 3300010362|Ga0126377_12767981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 565 | Open in IMG/M |
| 3300010362|Ga0126377_13259381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 525 | Open in IMG/M |
| 3300010362|Ga0126377_13514326 | Not Available | 507 | Open in IMG/M |
| 3300010366|Ga0126379_13802804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 506 | Open in IMG/M |
| 3300010376|Ga0126381_102688714 | Not Available | 711 | Open in IMG/M |
| 3300010401|Ga0134121_10039420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 3853 | Open in IMG/M |
| 3300011332|Ga0126317_10918962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 521 | Open in IMG/M |
| 3300012180|Ga0153974_1047697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 939 | Open in IMG/M |
| 3300012204|Ga0137374_10120039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2421 | Open in IMG/M |
| 3300012285|Ga0137370_10465079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 772 | Open in IMG/M |
| 3300012358|Ga0137368_10415155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 881 | Open in IMG/M |
| 3300012361|Ga0137360_10574263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 964 | Open in IMG/M |
| 3300012469|Ga0150984_107959394 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300012492|Ga0157335_1027999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 576 | Open in IMG/M |
| 3300012893|Ga0157284_10202253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 599 | Open in IMG/M |
| 3300012925|Ga0137419_11692877 | Not Available | 539 | Open in IMG/M |
| 3300012930|Ga0137407_11001414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 791 | Open in IMG/M |
| 3300012944|Ga0137410_10075670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2451 | Open in IMG/M |
| 3300012948|Ga0126375_10950484 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 695 | Open in IMG/M |
| 3300012975|Ga0134110_10546451 | Not Available | 532 | Open in IMG/M |
| 3300013297|Ga0157378_10539858 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1170 | Open in IMG/M |
| 3300014150|Ga0134081_10248512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 621 | Open in IMG/M |
| 3300014199|Ga0181535_10631383 | Not Available | 613 | Open in IMG/M |
| 3300015372|Ga0132256_102129240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 666 | Open in IMG/M |
| 3300016270|Ga0182036_10501911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 961 | Open in IMG/M |
| 3300016371|Ga0182034_10124364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1895 | Open in IMG/M |
| 3300016387|Ga0182040_11878073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 513 | Open in IMG/M |
| 3300016445|Ga0182038_11405813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 625 | Open in IMG/M |
| 3300017972|Ga0187781_11344195 | Not Available | 528 | Open in IMG/M |
| 3300017973|Ga0187780_10713989 | Not Available | 723 | Open in IMG/M |
| 3300018047|Ga0187859_10837342 | Not Available | 529 | Open in IMG/M |
| 3300018431|Ga0066655_11186694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 540 | Open in IMG/M |
| 3300018468|Ga0066662_10231699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1491 | Open in IMG/M |
| 3300018469|Ga0190270_11886291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 654 | Open in IMG/M |
| 3300019887|Ga0193729_1231739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 603 | Open in IMG/M |
| 3300020080|Ga0206350_11134960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 529 | Open in IMG/M |
| 3300021082|Ga0210380_10157386 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1020 | Open in IMG/M |
| 3300021402|Ga0210385_10719306 | Not Available | 765 | Open in IMG/M |
| 3300021444|Ga0213878_10547117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 511 | Open in IMG/M |
| 3300021560|Ga0126371_12659531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 606 | Open in IMG/M |
| 3300021560|Ga0126371_13487613 | Not Available | 531 | Open in IMG/M |
| 3300022694|Ga0222623_10278339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 644 | Open in IMG/M |
| 3300025315|Ga0207697_10557006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 504 | Open in IMG/M |
| 3300025900|Ga0207710_10076844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1542 | Open in IMG/M |
| 3300027909|Ga0209382_12074224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 543 | Open in IMG/M |
| 3300028714|Ga0307309_10079145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 758 | Open in IMG/M |
| 3300028773|Ga0302234_10317356 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300028778|Ga0307288_10220489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 736 | Open in IMG/M |
| 3300031199|Ga0307495_10242031 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300031366|Ga0307506_10361810 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300031545|Ga0318541_10329998 | Not Available | 852 | Open in IMG/M |
| 3300031549|Ga0318571_10471512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 501 | Open in IMG/M |
| 3300031564|Ga0318573_10710372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 540 | Open in IMG/M |
| 3300031668|Ga0318542_10074777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1593 | Open in IMG/M |
| 3300031679|Ga0318561_10701384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 556 | Open in IMG/M |
| 3300031718|Ga0307474_11064859 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 640 | Open in IMG/M |
| 3300031736|Ga0318501_10400747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 741 | Open in IMG/M |
| 3300031779|Ga0318566_10642794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 515 | Open in IMG/M |
| 3300031835|Ga0318517_10089600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1341 | Open in IMG/M |
| 3300031845|Ga0318511_10177547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 940 | Open in IMG/M |
| 3300031897|Ga0318520_10995116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 529 | Open in IMG/M |
| 3300031942|Ga0310916_10305526 | All Organisms → cellular organisms → Bacteria | 1348 | Open in IMG/M |
| 3300031947|Ga0310909_11127180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 637 | Open in IMG/M |
| 3300032009|Ga0318563_10004815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6004 | Open in IMG/M |
| 3300032066|Ga0318514_10513495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 638 | Open in IMG/M |
| 3300032828|Ga0335080_11359867 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 707 | Open in IMG/M |
| 3300032892|Ga0335081_10720289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. PAMC26660 | 1206 | Open in IMG/M |
| 3300032895|Ga0335074_11445075 | Not Available | 552 | Open in IMG/M |
| 3300032955|Ga0335076_10277376 | Not Available | 1568 | Open in IMG/M |
| 3300034150|Ga0364933_122756 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.27% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.50% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.19% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.31% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.54% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.54% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.54% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.65% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.65% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.77% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.77% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.77% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.89% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.89% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.89% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.89% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.89% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.89% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.89% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.89% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.89% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.89% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.89% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.89% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.89% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.89% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.89% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.89% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.89% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.89% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459020 | Litter degradation NP2 | Engineered | Open in IMG/M |
| 3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001164 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300004006 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011332 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012180 | Attine ant fungus gardens microbial communities from Georgia, USA - TSGA058 MetaG | Host-Associated | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Host-Associated | Open in IMG/M |
| 3300012893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1 | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028714 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196 | Environmental | Open in IMG/M |
| 3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
| 3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300034150 | Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2NP_01140820 | 2170459020 | Switchgrass, Maize And Mischanthus Litter | YAGTVNVVRLTHDGQVLVERMELDIPREVEPVYVP |
| AF_2010_repII_A100DRAFT_10244442 | 3300000655 | Forest Soil | AAYYSGSPEYAGTVNVVRLTAAGKVAVTRVPLGIAREPSAID* |
| AF_2010_repII_A100DRAFT_10612262 | 3300000655 | Forest Soil | AYYSGSPEYAGTVNVVRLTAAGKVAVTRVPLGIAREPSAID* |
| JGI1027J12803_1096856922 | 3300000955 | Soil | EYAGTVNVVRLSAGGKVTVARAELDIAREPSAVD* |
| JGI11823J13286_10094781 | 3300001164 | Forest Soil | AYYSGSPEYAGTVNVVRLAATGDVAVTRVELDIAREPSAVE* |
| JGI25390J43892_100386954 | 3300002911 | Grasslands Soil | YSGSPEYAGTINMVRLSAGGDIAVTRAALEIAREPSAVD* |
| Ga0055453_100284874 | 3300004006 | Natural And Restored Wetlands | SPEYTGTVNVVRLTPAGEVVVTREPLDITRDPFAPPPADE* |
| Ga0062386_1000986324 | 3300004152 | Bog Forest Soil | VAAYYSGSPEYAGTVNVVRLNAAGNVEVRRAELDIAREPSALV* |
| Ga0062589_1014699421 | 3300004156 | Soil | AAYYSGSPEYAGTVNLVRLTRDGRVVVAQQELDIARDVDPPFVPD* |
| Ga0062591_1011090361 | 3300004643 | Soil | YYSGSPEYAGTVNVVRLSAASGVAVTRAELDVAREPSAVE* |
| Ga0066815_100472072 | 3300005164 | Soil | AYYSGSPEYAGTVNVVRLTTAGDVAVTRAELDIAREPSAVE* |
| Ga0066673_105179742 | 3300005175 | Soil | RVAAYYSGSPEYTGTVNVVRLTRSGDVVVTQVQLDIAREVAPLYIAE* |
| Ga0066675_113706741 | 3300005187 | Soil | TKVGAVTAYYSGSPEYAGTVNVVRLTSTGTVSVERAAVDIAREPAALD* |
| Ga0066388_1007568554 | 3300005332 | Tropical Forest Soil | VAAFYSGSPEYAGTVNVVRLGASGQVAVTRAELDIAREPSAVD* |
| Ga0066388_1056864072 | 3300005332 | Tropical Forest Soil | AYYSGSPEYAGTVNVIRLSGNGDVNVTRAALDVAREPSADASA* |
| Ga0070709_111092661 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | NGVVPAYYSGSPEYAGTINVVRLGEAGVTVIRAPLDIARELVD* |
| Ga0070713_1011559582 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | AYYSGSPEYAGTVNVVRLTPAGEVAVRRAALDIAREPSAVD* |
| Ga0070663_1005899571 | 3300005455 | Corn Rhizosphere | GSPEYSGTVNVVRLTRDGHVLVERMELDIPRELEPVYVP* |
| Ga0070699_1000751116 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | AYYSGSPEYAGTVNVVRLTAAGEVAVTRAALDIAREPSAVD* |
| Ga0066661_100758971 | 3300005554 | Soil | AGTVNVVQLCADGKVAVTRAPLEIAREPSAVDYT* |
| Ga0070763_109285452 | 3300005610 | Soil | YSGSPEYAGTINVVRLSEIGGVTVTRAPLDIAREVTD* |
| Ga0066905_1000624773 | 3300005713 | Tropical Forest Soil | YYSGSPEYAGTVNVVRLTGEGQVLVSLLELDIPREVEPIFVP* |
| Ga0066903_1013352563 | 3300005764 | Tropical Forest Soil | PEYAGTVNVVRLTATGEVAVTRAALDIAREPSAVD* |
| Ga0066903_1058785811 | 3300005764 | Tropical Forest Soil | VEAHYSGSPEYAGTVNVVRLGSTGAVRVERTAVAVAREPAALD* |
| Ga0066903_1059503522 | 3300005764 | Tropical Forest Soil | YSGSPEYAGTVNVVRLTAAGAVAVTRAALDIAREPSAVD* |
| Ga0070766_106970803 | 3300005921 | Soil | GGTTAHYSGSPEYAGTINLVRLTRQGEVVVSHLALDIAREPCAFED* |
| Ga0075365_113306311 | 3300006038 | Populus Endosphere | SPEYAGTVNVVRLTGGGDVAVARAELNIAREPSAVD* |
| Ga0075028_1004485531 | 3300006050 | Watersheds | YYSGSPEYAGTVNVVRLTPAGEVAVTRAALDIAREPSAVD* |
| Ga0070715_110565381 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | AAYYSGSPEYAGTVNVVRLAGSGGVAVARAHLAIAREPSAVD* |
| Ga0070716_1006136821 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | GSPEYAGTVNVVRLGAAGAVAVTRAELDIAREPSAVE* |
| Ga0070765_1009810563 | 3300006176 | Soil | GSPEYAGTINVVRLSEAGGVTVTRAPLDIAREISD* |
| Ga0066660_103137501 | 3300006800 | Soil | KVGAVTAYYSGSPEYAGTVNVVRLNSTGTVSVERAAVDIAREPAALD* |
| Ga0075429_1000847211 | 3300006880 | Populus Rhizosphere | VAAYYSGSPEYAGTVNVVRLTHAGQVVVARTELDIAREPSA* |
| Ga0099795_100499063 | 3300007788 | Vadose Zone Soil | YSGSPEYAGTVNVVRLVASGEVVVTLHELDIAREVEPVFVP* |
| Ga0066710_1013749061 | 3300009012 | Grasslands Soil | AYYSGSPEYAGTVNVVRLTPAGEVAVRRAALDIAREPSAVD |
| Ga0099828_115150242 | 3300009089 | Vadose Zone Soil | YSGSPEYAGTVNVVRLTPTGDVTVTRLDLDIAREPSA* |
| Ga0105245_127192482 | 3300009098 | Miscanthus Rhizosphere | NCAGKVRHVATYCSGSPEYAGIFNVVRLGAAGSVAVTRAELDIAREPSAVE* |
| Ga0075418_123198202 | 3300009100 | Populus Rhizosphere | SGSPEYAGTVNVVRLTAGGDVAVARAELDIAREPSAVE* |
| Ga0126374_106695082 | 3300009792 | Tropical Forest Soil | YYSGSPEYAGTINVVRLTSGGQVVVDRIDLDIPREVEPQYVP* |
| Ga0126374_110460181 | 3300009792 | Tropical Forest Soil | GSPEYAGTVNVVRLTATGEVAVTRAALDIAREPSAVD* |
| Ga0126380_103505972 | 3300010043 | Tropical Forest Soil | VGAVAAYYSGSPEYAGAVNVVRLTPAGEVAVTRAALDIAREPSAVD* |
| Ga0126384_101286543 | 3300010046 | Tropical Forest Soil | YYSGSPEYAGTVNVVRLTRDGRVLVERMELDIPREVEPVYVP* |
| Ga0126384_119166701 | 3300010046 | Tropical Forest Soil | YSGSPEYAGTVNVVRLTRDGQVLVTRMELNIPREVEPVYVP* |
| Ga0126377_127679812 | 3300010362 | Tropical Forest Soil | AKVGAVAAYYSGSPDYAGTVNVVRLTAGGDVAVARGEHDIAREPSAVD* |
| Ga0126377_132593812 | 3300010362 | Tropical Forest Soil | EYAGTVNVVRLTAAGAVAVTRTALDIAREPSAVD* |
| Ga0126377_135143261 | 3300010362 | Tropical Forest Soil | AGTVNVVRLTSAGEVEVSQHALDIPREVAPIYVPD* |
| Ga0126379_138028041 | 3300010366 | Tropical Forest Soil | YYSGSPEYAGTVNVVRLTGDGQVLVSLMELDIPREVEPVFVP* |
| Ga0126381_1026887142 | 3300010376 | Tropical Forest Soil | YYSGSPEFAGTVNVVRMSEATGVTVTRVALNIARELSE* |
| Ga0134121_100394201 | 3300010401 | Terrestrial Soil | AYYSGSPEYAGTANLVRLTPAGQVKVSRLKLDIAREVEPQFVPD* |
| Ga0126317_109189621 | 3300011332 | Soil | YYSGSPEYAGTVNVVRLGAAGAVVVTRAELDIAREPSAVE* |
| Ga0153974_10476971 | 3300012180 | Attine Ant Fungus Gardens | YSGSPEYAGTVNVVRLIAGGEVAVTRAALDIAREPSAVD* |
| Ga0137374_101200396 | 3300012204 | Vadose Zone Soil | EYAGTVNVVRLTAAGEVAVTRAALDIAREPSAVD* |
| Ga0137370_104650792 | 3300012285 | Vadose Zone Soil | EYAGTINVVRLSAGGDIAVTRAALEVAREPSAVD* |
| Ga0137368_104151552 | 3300012358 | Vadose Zone Soil | VAAYYSGSPEYAGTINVVRLSAGGDIAVTRAALEVAGEPSAVD* |
| Ga0137360_105742632 | 3300012361 | Vadose Zone Soil | SPEYAGTVNVVRLTVAGGVAVTRAALDIAREPSAVD* |
| Ga0150984_1079593942 | 3300012469 | Avena Fatua Rhizosphere | NGTVAAYYSGSAEYAGTVNVVRLTGSGQVLVERMELDIPREVEPVYVP* |
| Ga0157335_10279991 | 3300012492 | Arabidopsis Rhizosphere | YYSGSPEYAGTVNVVRLSPGGQVLVEWMELDIPREVEPVYVP* |
| Ga0157284_102022532 | 3300012893 | Soil | AAYYSGSPEYAGTVNVVRLSAAGGVAVTRAELDIAREPSAVE* |
| Ga0137419_116928772 | 3300012925 | Vadose Zone Soil | EYAGTANVIHLTTTGEVAVARAALDIAREPSAVD* |
| Ga0137407_110014143 | 3300012930 | Vadose Zone Soil | YSGSPEYAGTVNLVRLTASGQVEVERAALDIAREPSALGE* |
| Ga0137410_100756701 | 3300012944 | Vadose Zone Soil | AYYSGSPEYAGTVNVVRLTSAGQVLVERMELEIPREVEPVYVP* |
| Ga0126375_109504842 | 3300012948 | Tropical Forest Soil | SGSPEYAGTVNLVRLTGAGEVVVTRMALDIAREVEPEYVP* |
| Ga0134110_105464511 | 3300012975 | Grasslands Soil | SPEYAGTVNVVRLTGEGQVLVSLLELDIPREVEPVFVP* |
| Ga0157378_105398583 | 3300013297 | Miscanthus Rhizosphere | YSGSPEYAGTVNVVRLSAAGGVAVTRAELDIAREPSAVE* |
| Ga0134081_102485122 | 3300014150 | Grasslands Soil | AYYSGSPEYAGTVNVVRLTSTGTVSVERAAVDIAREPAALD* |
| Ga0181535_106313831 | 3300014199 | Bog | SGSPEYAGTVNVVRLGDTGGVTVTHAPLDIAREISD* |
| Ga0132256_1021292402 | 3300015372 | Arabidopsis Rhizosphere | GSPEYAGTVNVVRLTAGGGVAVARAELDIAREPSAVD* |
| Ga0182036_105019111 | 3300016270 | Soil | SGSPEYAGTVNVVRLTAAGAVAVTRAALDIAREPSAVD |
| Ga0182034_101243641 | 3300016371 | Soil | SPEYAGTVNVVRLTATGEVAVTRATLDIAREPSAVD |
| Ga0182040_118780731 | 3300016387 | Soil | YYSGSPEYAGTVNVVRLTAGGQVEVTRAALDIAREPSSLDA |
| Ga0182038_114058132 | 3300016445 | Soil | YSGSPEYAGTVNVVRLTAAGKVAVTRVPLGIAREPSAID |
| Ga0187781_113441952 | 3300017972 | Tropical Peatland | GSPEYSGAVNVVRLSETEGVVVTRAPLDIARETGD |
| Ga0187780_107139891 | 3300017973 | Tropical Peatland | PAYYSGSPEYSGGVNVVRLSPTDGVTVARAPLDIAREPT |
| Ga0187859_108373422 | 3300018047 | Peatland | YSGSPEYAGTVNVVRLSEASGVTVTRAPLDITRETTE |
| Ga0066655_111866942 | 3300018431 | Grasslands Soil | RATKVGAVTAYYSGSPEYAGTVNVVRLTSTGTVSVERAAVDIAREPAALD |
| Ga0066662_102316993 | 3300018468 | Grasslands Soil | AAYYSGSPEYAGTVNVVRLTAGGEVAVTRAALDIAREPSAVD |
| Ga0190270_118862913 | 3300018469 | Soil | SPEYAGTVNVVRLTAAGDVSVTRAALDIAREPSAID |
| Ga0193729_12317392 | 3300019887 | Soil | YYSGSPEYAGTVNVVRLTVAGDVAVTRAELDIAREPSAVE |
| Ga0206350_111349601 | 3300020080 | Corn, Switchgrass And Miscanthus Rhizosphere | AYYSGAPEYAGTVNVVRLGAAGAVAVTRAELDIAREPSAVE |
| Ga0210380_101573861 | 3300021082 | Groundwater Sediment | YYSGSPEYAGTVNVVRLGAAGAVAVTRAELDIAREPSAVE |
| Ga0210385_107193061 | 3300021402 | Soil | GSPEYAGTVNVVRLSVASGVTVTRAPLEIAREVPE |
| Ga0213878_105471171 | 3300021444 | Bulk Soil | GSPEYAGTVNVVRLTPAGEVAVTRVALDIAREPSAVD |
| Ga0126371_126595312 | 3300021560 | Tropical Forest Soil | YAGTVNVVRLTGDGQVLVSLMELDIPREVEPVFVP |
| Ga0126371_134876131 | 3300021560 | Tropical Forest Soil | NGAVPAYYSGSPEFAGTINVVRMSEASGVTVTRAPLDIARELSE |
| Ga0222623_102783392 | 3300022694 | Groundwater Sediment | GNGLAAYYSGSPEYAGTVNVVRLTRTGDVVVARSELDIAREPSA |
| Ga0207697_105570061 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | SGSPEYAGTVNVVRLGAAGAVAVTRAELDIARAPSAVE |
| Ga0207710_100768444 | 3300025900 | Switchgrass Rhizosphere | GSPEYAGTVNVVRLGAAGAVAVTRAELDIAREPSAVE |
| Ga0209382_120742242 | 3300027909 | Populus Rhizosphere | KVGDGVAAYYSGSPEFAGTVNVVRLTHAGQVVVARTELDIAREPSA |
| Ga0307309_100791451 | 3300028714 | Soil | YYSGSPEYAGTVNVVRLTAAGDVAVTRAELDIAREPSAVE |
| Ga0302234_103173561 | 3300028773 | Palsa | VVPAYYSGSPELAETVNVVRLGIGGVTVRREPLDGRGASGIA |
| Ga0307288_102204893 | 3300028778 | Soil | SPEYAGTVNVVRLGAAGAVAVTRAELDIAREPSAVE |
| Ga0307495_102420311 | 3300031199 | Soil | GSPEYAGTANVIRLTSKGEVAVTRAALDIAREPSAVD |
| Ga0307506_103618101 | 3300031366 | Soil | YSGSPEYAGTVNLIRLAAGGQVTVTREALDITRDPFAV |
| Ga0318541_103299981 | 3300031545 | Soil | YSGSPESAGTVNVVRLGDGGVTVTRAPLDIVREIID |
| Ga0318571_104715122 | 3300031549 | Soil | AYYSGSPEYAGTVNVVRLTPAGEVAVTRVALDIAREPSAVD |
| Ga0318573_107103721 | 3300031564 | Soil | YYSGSPEYAGTVNVVRLTAAGEVAVTRAALDIAREPSAVD |
| Ga0318542_100747773 | 3300031668 | Soil | GSPEYAGTVNVVRLTAAGEVAVTRAALDIAREPSAVD |
| Ga0318561_107013841 | 3300031679 | Soil | YSGSPEYVGTVNVVRLTAAGEVAVTRAALDIAREPSAVD |
| Ga0307474_110648591 | 3300031718 | Hardwood Forest Soil | VVPAYYSGSPEYAGTINVVRLGKSGVTVTQAPLDIAREVVD |
| Ga0318501_104007472 | 3300031736 | Soil | YYSGSPEYVGTVNVVRLTAAGEVAVTRAALDIAREPSAVD |
| Ga0318566_106427941 | 3300031779 | Soil | VPAYSGSPEYAGTVNVVRLTVAGGVAVTRAALDIAREPSAVD |
| Ga0318517_100896002 | 3300031835 | Soil | YSGSPEYAGTVNVVRLGSTGALRVERTAVSVAREPAALE |
| Ga0318511_101775472 | 3300031845 | Soil | YYSGSPEYAGTVNVVRLTAAGEVAVTRAALDIAREPPAVD |
| Ga0318520_109951162 | 3300031897 | Soil | PEYAGTVNVVRLTAAGAVAVTRAALDIAREPSAVD |
| Ga0310916_103055264 | 3300031942 | Soil | KASYCGSPSYAGSVNLVRLTAMGGVEVQRTKLDVAREPWATE |
| Ga0310909_111271802 | 3300031947 | Soil | PEYAGTVNVVRLTAGGQVEVTRAALDIAREPSSLGV |
| Ga0318563_100048159 | 3300032009 | Soil | AVAAYYSGSPEYAGTVNVVRLTATGEVAVTRAALDIAREPSAVD |
| Ga0318514_105134952 | 3300032066 | Soil | EYAGTVNVVRLTAGGQVEVTRAALDIAREPSSLGV |
| Ga0335080_113598671 | 3300032828 | Soil | AVPAYYSGSPEFAGTVNLVRLGEAGVTVTRAPLDIAREIVE |
| Ga0335081_107202893 | 3300032892 | Soil | YYSGSPEYAGTVNVVRLGRGGVTVTRAPLDIAREPID |
| Ga0335074_114450751 | 3300032895 | Soil | YSGSPEYTGTINVVRMSESAGVTITRAPLDIAREVTG |
| Ga0335076_102773761 | 3300032955 | Soil | GAVPAYYSGSPEYSGAINVVRLSAMSGVTVTRAPLDIAREQSD |
| Ga0364933_122756_2_130 | 3300034150 | Sediment | AAYYSGSPEYAGTVNVVRLIAAGDVEVIRAELDIAREPSAVG |
| ⦗Top⦘ |