


| Basic Information | |
|---|---|
| Family ID | F083245 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MEMLIKVGFCFFVGVGIGAILIQVSALFWMFWDMFKPKD |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 84.07 % |
| % of genes near scaffold ends (potentially truncated) | 26.55 % |
| % of genes from short scaffolds (< 2000 bps) | 69.91 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (54.867 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (33.628 % of family members) |
| Environment Ontology (ENVO) | Unclassified (75.221 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (89.381 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.75% β-sheet: 0.00% Coil/Unstructured: 49.25% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF02954 | HTH_8 | 7.96 |
| PF10614 | CsgF | 5.31 |
| PF06067 | DUF932 | 3.54 |
| PF05996 | Fe_bilin_red | 3.54 |
| PF03783 | CsgG | 2.65 |
| PF02739 | 5_3_exonuc_N | 1.77 |
| PF00565 | SNase | 1.77 |
| PF13759 | 2OG-FeII_Oxy_5 | 1.77 |
| PF00156 | Pribosyltran | 1.77 |
| PF02617 | ClpS | 0.88 |
| PF00709 | Adenylsucc_synt | 0.88 |
| PF13328 | HD_4 | 0.88 |
| PF06714 | Gp5_OB | 0.88 |
| PF02518 | HATPase_c | 0.88 |
| PF05226 | CHASE2 | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG1462 | Curli biogenesis system outer membrane secretion channel CsgG | Cell wall/membrane/envelope biogenesis [M] | 2.65 |
| COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 1.77 |
| COG0104 | Adenylosuccinate synthase | Nucleotide transport and metabolism [F] | 0.88 |
| COG2127 | ATP-dependent Clp protease adapter protein ClpS | Posttranslational modification, protein turnover, chaperones [O] | 0.88 |
| COG4252 | Extracytoplasmic sensor domain CHASE2 (specificity unknown) | Signal transduction mechanisms [T] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 54.87 % |
| All Organisms | root | All Organisms | 45.13 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2236876004|none_p0423779 | Not Available | 553 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10029117 | All Organisms → cellular organisms → Bacteria | 3065 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10192214 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300000224|SI34jun09_10mDRAFT_1008992 | Not Available | 2092 | Open in IMG/M |
| 3300000864|OpTDRAFT_1018244 | Not Available | 620 | Open in IMG/M |
| 3300000928|OpTDRAFT_10104022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 881 | Open in IMG/M |
| 3300000929|NpDRAFT_10084090 | All Organisms → Viruses → Predicted Viral | 2018 | Open in IMG/M |
| 3300001344|JGI20152J14361_10049968 | All Organisms → Viruses → Predicted Viral | 1111 | Open in IMG/M |
| 3300001352|JGI20157J14317_10007551 | Not Available | 7602 | Open in IMG/M |
| 3300001460|JGI24003J15210_10000656 | Not Available | 14732 | Open in IMG/M |
| 3300001472|JGI24004J15324_10018524 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2387 | Open in IMG/M |
| 3300003216|JGI26079J46598_1019592 | Not Available | 1766 | Open in IMG/M |
| 3300003580|JGI26260J51721_1000979 | Not Available | 12516 | Open in IMG/M |
| 3300003580|JGI26260J51721_1006387 | All Organisms → Viruses → Predicted Viral | 3606 | Open in IMG/M |
| 3300005941|Ga0070743_10065173 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
| 3300006164|Ga0075441_10311894 | Not Available | 574 | Open in IMG/M |
| 3300006164|Ga0075441_10365668 | Not Available | 523 | Open in IMG/M |
| 3300006737|Ga0098037_1063330 | Not Available | 1317 | Open in IMG/M |
| 3300006752|Ga0098048_1008049 | All Organisms → Viruses → Predicted Viral | 3871 | Open in IMG/M |
| 3300006752|Ga0098048_1012542 | All Organisms → Viruses → Predicted Viral | 2957 | Open in IMG/M |
| 3300006789|Ga0098054_1336608 | Not Available | 537 | Open in IMG/M |
| 3300006793|Ga0098055_1164116 | Not Available | 852 | Open in IMG/M |
| 3300006793|Ga0098055_1356363 | Not Available | 543 | Open in IMG/M |
| 3300006922|Ga0098045_1052109 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1012 | Open in IMG/M |
| 3300006922|Ga0098045_1080512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 779 | Open in IMG/M |
| 3300006922|Ga0098045_1098132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 692 | Open in IMG/M |
| 3300007665|Ga0102908_1082214 | Not Available | 640 | Open in IMG/M |
| 3300008950|Ga0102891_1085980 | Not Available | 956 | Open in IMG/M |
| 3300008961|Ga0102887_1062844 | All Organisms → Viruses → Predicted Viral | 1206 | Open in IMG/M |
| 3300009024|Ga0102811_1230562 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300009409|Ga0114993_10148183 | Not Available | 1830 | Open in IMG/M |
| 3300009420|Ga0114994_10007206 | Not Available | 8017 | Open in IMG/M |
| 3300009420|Ga0114994_10109729 | Not Available | 1876 | Open in IMG/M |
| 3300009420|Ga0114994_11137546 | Not Available | 504 | Open in IMG/M |
| 3300009425|Ga0114997_10292302 | Not Available | 904 | Open in IMG/M |
| 3300009436|Ga0115008_10011561 | All Organisms → cellular organisms → Bacteria | 7229 | Open in IMG/M |
| 3300009441|Ga0115007_10025326 | All Organisms → cellular organisms → Bacteria | 3644 | Open in IMG/M |
| 3300009441|Ga0115007_10838405 | Not Available | 624 | Open in IMG/M |
| 3300009606|Ga0115102_10982874 | Not Available | 988 | Open in IMG/M |
| 3300009705|Ga0115000_10587238 | Not Available | 695 | Open in IMG/M |
| 3300009785|Ga0115001_10587958 | Not Available | 681 | Open in IMG/M |
| 3300010149|Ga0098049_1014706 | All Organisms → Viruses → Predicted Viral | 2618 | Open in IMG/M |
| 3300010883|Ga0133547_10804077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 1846 | Open in IMG/M |
| 3300013010|Ga0129327_10543890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 634 | Open in IMG/M |
| 3300017709|Ga0181387_1024328 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1181 | Open in IMG/M |
| 3300017714|Ga0181412_1124015 | Not Available | 594 | Open in IMG/M |
| 3300017719|Ga0181390_1084132 | Not Available | 874 | Open in IMG/M |
| 3300017719|Ga0181390_1130850 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium | 647 | Open in IMG/M |
| 3300017719|Ga0181390_1188944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 500 | Open in IMG/M |
| 3300017738|Ga0181428_1031631 | All Organisms → Viruses → Predicted Viral | 1229 | Open in IMG/M |
| 3300017739|Ga0181433_1003311 | All Organisms → cellular organisms → Bacteria | 4911 | Open in IMG/M |
| 3300017742|Ga0181399_1067497 | Not Available | 912 | Open in IMG/M |
| 3300017745|Ga0181427_1050430 | All Organisms → Viruses → Predicted Viral | 1029 | Open in IMG/M |
| 3300017750|Ga0181405_1054986 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1044 | Open in IMG/M |
| 3300017759|Ga0181414_1068538 | Not Available | 942 | Open in IMG/M |
| 3300017760|Ga0181408_1088422 | Not Available | 810 | Open in IMG/M |
| 3300017762|Ga0181422_1154081 | Not Available | 704 | Open in IMG/M |
| 3300017770|Ga0187217_1076539 | Not Available | 1150 | Open in IMG/M |
| 3300020165|Ga0206125_10381986 | Not Available | 515 | Open in IMG/M |
| 3300020166|Ga0206128_1352848 | Not Available | 508 | Open in IMG/M |
| 3300020382|Ga0211686_10056181 | Not Available | 1592 | Open in IMG/M |
| 3300020431|Ga0211554_10363638 | Not Available | 673 | Open in IMG/M |
| 3300020463|Ga0211676_10096959 | All Organisms → Viruses → Predicted Viral | 1950 | Open in IMG/M |
| 3300021185|Ga0206682_10000085 | Not Available | 87240 | Open in IMG/M |
| 3300021185|Ga0206682_10010075 | All Organisms → cellular organisms → Bacteria | 6755 | Open in IMG/M |
| 3300021335|Ga0213867_1124741 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300021957|Ga0222717_10022264 | Not Available | 4244 | Open in IMG/M |
| 3300022074|Ga0224906_1027313 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1984 | Open in IMG/M |
| (restricted) 3300023109|Ga0233432_10003056 | Not Available | 15331 | Open in IMG/M |
| (restricted) 3300023109|Ga0233432_10020611 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4815 | Open in IMG/M |
| 3300024247|Ga0228675_1008605 | All Organisms → cellular organisms → Bacteria | 2729 | Open in IMG/M |
| (restricted) 3300024255|Ga0233438_10012635 | Not Available | 5754 | Open in IMG/M |
| (restricted) 3300024264|Ga0233444_10016093 | Not Available | 5558 | Open in IMG/M |
| 3300024266|Ga0228661_1108202 | Not Available | 522 | Open in IMG/M |
| 3300024326|Ga0228652_1067073 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300024328|Ga0228635_1048877 | Not Available | 1140 | Open in IMG/M |
| 3300024343|Ga0244777_10157443 | All Organisms → Viruses → Predicted Viral | 1466 | Open in IMG/M |
| 3300024346|Ga0244775_10051011 | Not Available | 3601 | Open in IMG/M |
| 3300024346|Ga0244775_10560427 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300024348|Ga0244776_10349490 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300025083|Ga0208791_1069122 | Not Available | 586 | Open in IMG/M |
| 3300025084|Ga0208298_1001041 | Not Available | 10632 | Open in IMG/M |
| 3300025098|Ga0208434_1010150 | Not Available | 2626 | Open in IMG/M |
| 3300025108|Ga0208793_1001240 | Not Available | 15172 | Open in IMG/M |
| 3300025108|Ga0208793_1110652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 760 | Open in IMG/M |
| 3300025120|Ga0209535_1022954 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3112 | Open in IMG/M |
| 3300025137|Ga0209336_10006031 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5270 | Open in IMG/M |
| 3300025626|Ga0209716_1162178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 568 | Open in IMG/M |
| 3300025832|Ga0209307_1231219 | Not Available | 525 | Open in IMG/M |
| 3300025849|Ga0209603_1134754 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1031 | Open in IMG/M |
| 3300025886|Ga0209632_10480523 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 572 | Open in IMG/M |
| 3300025886|Ga0209632_10506617 | Not Available | 550 | Open in IMG/M |
| 3300025890|Ga0209631_10280699 | Not Available | 815 | Open in IMG/M |
| 3300027506|Ga0208973_1011176 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 2994 | Open in IMG/M |
| 3300027752|Ga0209192_10142807 | Not Available | 951 | Open in IMG/M |
| 3300027780|Ga0209502_10428436 | Not Available | 535 | Open in IMG/M |
| 3300027788|Ga0209711_10067570 | Not Available | 1900 | Open in IMG/M |
| 3300027810|Ga0209302_10074216 | Not Available | 1757 | Open in IMG/M |
| 3300027813|Ga0209090_10014007 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 4774 | Open in IMG/M |
| 3300027833|Ga0209092_10084553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 1904 | Open in IMG/M |
| 3300027833|Ga0209092_10132712 | All Organisms → Viruses → Predicted Viral | 1450 | Open in IMG/M |
| 3300028008|Ga0228674_1209726 | Not Available | 622 | Open in IMG/M |
| 3300028124|Ga0228621_1048629 | Not Available | 611 | Open in IMG/M |
| 3300028132|Ga0228649_1020896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → unclassified Legionellales → Legionellales bacterium | 1882 | Open in IMG/M |
| 3300028136|Ga0228608_1013145 | All Organisms → Viruses → Predicted Viral | 2444 | Open in IMG/M |
| 3300031140|Ga0308024_1004202 | Not Available | 4718 | Open in IMG/M |
| 3300031519|Ga0307488_10001654 | Not Available | 18642 | Open in IMG/M |
| 3300031569|Ga0307489_11010381 | Not Available | 594 | Open in IMG/M |
| 3300031589|Ga0307996_1016261 | All Organisms → Viruses → Predicted Viral | 1945 | Open in IMG/M |
| 3300031622|Ga0302126_10050137 | Not Available | 1753 | Open in IMG/M |
| 3300031766|Ga0315322_10191927 | All Organisms → cellular organisms → Bacteria | 1437 | Open in IMG/M |
| 3300031774|Ga0315331_10199403 | Not Available | 1488 | Open in IMG/M |
| 3300032047|Ga0315330_10303929 | Not Available | 1005 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 33.63% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 13.27% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 7.96% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 5.31% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 5.31% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 4.42% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 4.42% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 4.42% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 3.54% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.65% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 2.65% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 2.65% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 1.77% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.77% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.77% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.77% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.89% |
| Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine | 0.89% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2236876004 | Estuarine microbial communities from Columbia River, sample from South Channel ETM site, GS313-0p1-ETM-15m | Environmental | Open in IMG/M |
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000224 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 34 06/16/09 10m | Environmental | Open in IMG/M |
| 3300000864 | Marine plume microbial communities from the Columbia River - Metatranscriptome 25 PSU | Environmental | Open in IMG/M |
| 3300000928 | Marine plume microbial communities from the Columbia River - 25 PSU | Environmental | Open in IMG/M |
| 3300000929 | Marine plume microbial communities from the Columbia River - 15 PSU | Environmental | Open in IMG/M |
| 3300001344 | Pelagic Microbial community sample from North Sea - COGITO 998_met_02 | Environmental | Open in IMG/M |
| 3300001352 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300003216 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA | Environmental | Open in IMG/M |
| 3300003580 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300007665 | Estuarine microbial communities from the Columbia River estuary - metaG 1557A-3 | Environmental | Open in IMG/M |
| 3300008950 | Estuarine microbial communities from the Columbia River estuary - metaG 1552A-02 | Environmental | Open in IMG/M |
| 3300008961 | Estuarine microbial communities from the Columbia River estuary - metaG 1550B-02 | Environmental | Open in IMG/M |
| 3300009024 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 | Environmental | Open in IMG/M |
| 3300009409 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
| 3300009441 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome | Environmental | Open in IMG/M |
| 3300009606 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009705 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017739 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 | Environmental | Open in IMG/M |
| 3300017742 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21 | Environmental | Open in IMG/M |
| 3300017745 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15 | Environmental | Open in IMG/M |
| 3300017750 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29 | Environmental | Open in IMG/M |
| 3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
| 3300017760 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16 | Environmental | Open in IMG/M |
| 3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
| 3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020166 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1 | Environmental | Open in IMG/M |
| 3300020382 | Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX556058-ERR599059) | Environmental | Open in IMG/M |
| 3300020431 | Marine microbial communities from Tara Oceans - TARA_B100001142 (ERX556101-ERR598983) | Environmental | Open in IMG/M |
| 3300020463 | Marine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050) | Environmental | Open in IMG/M |
| 3300021185 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 | Environmental | Open in IMG/M |
| 3300021335 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300023109 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MG | Environmental | Open in IMG/M |
| 3300024247 | Seawater microbial communities from Monterey Bay, California, United States - 36D_r | Environmental | Open in IMG/M |
| 3300024255 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MG | Environmental | Open in IMG/M |
| 3300024264 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MG | Environmental | Open in IMG/M |
| 3300024266 | Seawater microbial communities from Monterey Bay, California, United States - 75D | Environmental | Open in IMG/M |
| 3300024326 | Seawater microbial communities from Monterey Bay, California, United States - 64D | Environmental | Open in IMG/M |
| 3300024328 | Seawater microbial communities from Monterey Bay, California, United States - 44D | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300025083 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025098 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025626 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes) | Environmental | Open in IMG/M |
| 3300025832 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 (SPAdes) | Environmental | Open in IMG/M |
| 3300025849 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes) | Environmental | Open in IMG/M |
| 3300025886 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025890 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes) | Environmental | Open in IMG/M |
| 3300027506 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_66_BLW_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027752 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300027780 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes) | Environmental | Open in IMG/M |
| 3300027788 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes) | Environmental | Open in IMG/M |
| 3300027810 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027813 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300027833 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028008 | Seawater microbial communities from Monterey Bay, California, United States - 1D_r | Environmental | Open in IMG/M |
| 3300028124 | Seawater microbial communities from Monterey Bay, California, United States - 25D | Environmental | Open in IMG/M |
| 3300028132 | Seawater microbial communities from Monterey Bay, California, United States - 61D | Environmental | Open in IMG/M |
| 3300028136 | Seawater microbial communities from Monterey Bay, California, United States - 9D | Environmental | Open in IMG/M |
| 3300031140 | Marine microbial communities from water near the shore, Antarctic Ocean - #420 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031569 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2 | Environmental | Open in IMG/M |
| 3300031589 | Marine microbial communities from David Island wharf, Antarctic Ocean - #35 | Environmental | Open in IMG/M |
| 3300031622 | Marine microbial communities from Western Arctic Ocean, Canada - CB4_20m | Environmental | Open in IMG/M |
| 3300031766 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515 | Environmental | Open in IMG/M |
| 3300031774 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915 | Environmental | Open in IMG/M |
| 3300032047 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| none_04237792 | 2236876004 | Marine Estuarine | MEMLIKVGFCFFVGVGIGAILIQVSALFWMFWDMFKEKKLKRFTTLLLF |
| DelMOSum2010_100291174 | 3300000101 | Marine | MEMLIKVGFSFFVGVGIAAILIQVSALFWMFWDMFKPKD* |
| DelMOSpr2010_101922142 | 3300000116 | Marine | MEMLIKVGFCFFVGVGIGAILIQVSALFWMFWDMFFGNGKD* |
| SI34jun09_10mDRAFT_10089924 | 3300000224 | Marine | MELLIKISFSFFLGVGIGVMLMQVSALVWMFWDMFKSKQK* |
| OpTDRAFT_10182442 | 3300000864 | Freshwater And Marine | MELFIHVAFCFFVGVGIGAILIQLSALFWMFWDMFKPKD* |
| OpTDRAFT_101040222 | 3300000928 | Freshwater And Marine | MELLINVVFSLLLGVGIAAMLMQVSALFWMFWDMFRSKRND* |
| NpDRAFT_100840905 | 3300000929 | Freshwater And Marine | FCFFVGVGIGAILIQLSALFWMFWDMFFNKRKDLLDK* |
| JGI20152J14361_100499682 | 3300001344 | Pelagic Marine | MQGIELLIYVGFCFFVGVGIGAILIQLSALLWMFWDMFKPKPTKQTRE* |
| JGI20157J14317_100075512 | 3300001352 | Pelagic Marine | MELFIYVAFCFFVGVGIGAILIQLSALFWMFWDMFFGKKDKKRLDSMTSWH* |
| JGI24003J15210_100006561 | 3300001460 | Marine | MIDQLIFVGFCFFVGVGIGAMLIQVSALFWMFWDMFRSKKD |
| JGI24004J15324_100185242 | 3300001472 | Marine | MQGIELLIYVGFCFFVGVGIGAILIQISALFWMFWDMFFGKKDKEKT* |
| JGI26079J46598_10195923 | 3300003216 | Marine | MEMLINVVFSLLLGVGIAAMLMQVSALFWMFWDMFRSKRND* |
| JGI26260J51721_10009799 | 3300003580 | Marine | MEMLIKVGFCFFVGVGIGAILIQVSALFWMFWDMFKKKN* |
| JGI26260J51721_10063872 | 3300003580 | Marine | MEMLIKVGFSFFVGVGIAAILIQVSALFWMFWDMFRSKHND* |
| Ga0070743_100651733 | 3300005941 | Estuarine | MIDLLIFAGFCFFVGVGIGAILIQVSALFWMFWDMFFGKKN* |
| Ga0075441_103118943 | 3300006164 | Marine | MELLINVVFGLLLVIGIGAMLSMMSALIWMFWDMFFGKGNT* |
| Ga0075441_103656681 | 3300006164 | Marine | MELLIKVGFSFFLGVGIGVILMQVSALCWMFWDMFRSKRND* |
| Ga0098037_10633303 | 3300006737 | Marine | MIDQLIFVGFCFFVGVGIGAMLIQISALFWMFWDMFRSKKDGS* |
| Ga0098048_10080499 | 3300006752 | Marine | MQGIELLIYVGFCFFVGVGIGAILIQVSALFWMFWDMFFGKKDKKNT* |
| Ga0098048_10125423 | 3300006752 | Marine | MELFIYVAFCFFVGVGIGAMLIQVSALFWMFWDMFKKK* |
| Ga0098054_13366081 | 3300006789 | Marine | MIDQLIFVGFCFFVGVGIGAMLIQISALFWMFWDMFFGKKDKKNT* |
| Ga0098055_11641161 | 3300006793 | Marine | MQGIELLIYVGFCFFVGVGIGAILIQISALFWMFWDMFFGKKDKKNT* |
| Ga0098055_13563632 | 3300006793 | Marine | MELFIYVAFCFFVGVGIGAMLIQMSALFWMFWDMFKPKD* |
| Ga0098045_10521091 | 3300006922 | Marine | MQGIELLIYVGFCFFVGVGIGAILIQISALFWMFWDMFF |
| Ga0098045_10805121 | 3300006922 | Marine | QGIELLIYVGFCFFVGVGIGAILIQISALFWMFWDMFFGKKDKKNT* |
| Ga0098045_10981323 | 3300006922 | Marine | LIYVGFCFFVGVGIGAILIQISALFWMFWDMFFVKKD* |
| Ga0102908_10822141 | 3300007665 | Estuarine | MQGIELLIYVGFCFFVGVGIGAILIQISALLWMFWDMFKPKPTKQTRE* |
| Ga0102891_10859803 | 3300008950 | Estuarine | MELLINVVFAFFFGVGIAAILIQVSALFWMFWDMFKPKD* |
| Ga0102887_10628442 | 3300008961 | Estuarine | MQGIELLIYVGFCFFVGVGIGAILIQISALFWMFWDMFKPKPTKQTRE* |
| Ga0102811_12305621 | 3300009024 | Estuarine | MQGIELLIYVGFCFFVGVGIGAILIQVSALFWMFWDMF |
| Ga0114993_101481834 | 3300009409 | Marine | MELLINVVFSLLLGVGIGAILMQVSALIWMFWDMFKRG* |
| Ga0114994_100072068 | 3300009420 | Marine | MEMLIKVGFCFFVGVGIGAILIQVSALFWMFWDMFKPKD* |
| Ga0114994_101097292 | 3300009420 | Marine | MEQGIEMLIKVGFCFFVGVGIGAILIQVSALIWMFWDMFRNKRS* |
| Ga0114994_111375462 | 3300009420 | Marine | MEMLIKVGFCFFVGVGIGAILIQVSALFWMFWDMFKPKQK* |
| Ga0114997_102923022 | 3300009425 | Marine | MEQGIEMLIKVGFCFFVGVGIGAILIQVSALFWMFWDMFRNKRS* |
| Ga0115008_1001156115 | 3300009436 | Marine | MELFIYVAFCFFVGVGIGAILIQLSALFWMFWDMFKPTKQTRD* |
| Ga0115007_100253264 | 3300009441 | Marine | MELLINVVFAFFFGAGIAAILIQVSALFWMFWDMFRSKRND* |
| Ga0115007_108384052 | 3300009441 | Marine | MELLIKVGFCFFLGVGIGAILMQVSALFWMFWDMFRSKRND* |
| Ga0115102_109828742 | 3300009606 | Marine | MQGIELLIYVGFCFFVGVGIGAILIQISALFWMFWDMFKKN* |
| Ga0115000_105872383 | 3300009705 | Marine | MEQGIEMLIKVGFCFFVGVGIGAILIQVSALFWMFWDMFRSKRND* |
| Ga0115001_105879583 | 3300009785 | Marine | MEQGIEMLIKVGFCFFVGVGIGAILIQVSALFWMFWDMFKRG* |
| Ga0098049_10147065 | 3300010149 | Marine | MKMIDQLIFVGFCFFVGVGIGAMLIQISALFWMFWDMFRSKKDGS* |
| Ga0133547_108040775 | 3300010883 | Marine | MELLINVVFSLLLGVGIAAMLIQVIALFWMYWDMFRSKRND* |
| Ga0129327_105438902 | 3300013010 | Freshwater To Marine Saline Gradient | MELLINVVFSLLLGAAIAAMLVQATALVWMFWDMFKPKKR* |
| Ga0181387_10243281 | 3300017709 | Seawater | MQGIELLIYVGFCFFVGVGIGAILIQVSALFWMFWDMFFGKKDKKNT |
| Ga0181412_11240153 | 3300017714 | Seawater | MIDQLIFVGFCFFVGVGIGAMLIQVSALFWMFWDMFRSKKDD |
| Ga0181390_10841321 | 3300017719 | Seawater | MEMLIYVGFCFFVGVGIGAILLQLSALFWMFWDMFTK |
| Ga0181390_11308503 | 3300017719 | Seawater | MQGIELLIYVGFCFFVGIGIGAILIQVSALFWMFWDMFFGKKDKKNT |
| Ga0181390_11889441 | 3300017719 | Seawater | MQGIELLIYVGFCFFVGVGIGAILMQVSALCWMFWDMFFGKKD |
| Ga0181428_10316312 | 3300017738 | Seawater | MKMIDQLIFVGFCFFVGVGIGAMLIQVSALFWMFWDMFRSKKDD |
| Ga0181433_10033115 | 3300017739 | Seawater | MIDQLIFVGFCFFVGVGIGAMLIQVSALLWMFWDMFRSKKDD |
| Ga0181399_10674973 | 3300017742 | Seawater | MQGIELLIYVGFCFFVGVGIGAILIQISALLWMFWDMFKPKPTKQTRE |
| Ga0181427_10504305 | 3300017745 | Seawater | MQGIELLIYVGFCFFVGVGIGAILIQVSALFWMFWDMFRSKKDD |
| Ga0181405_10549864 | 3300017750 | Seawater | MIDQLIFVGFCFFVGVGIGAMLIQVSALFWMFWDMFFGKKDKKNT |
| Ga0181414_10685383 | 3300017759 | Seawater | MIDQLIFVGFCFFVGVGIGAMLIQVSALFWMFWDMFRSKKDGS |
| Ga0181408_10884223 | 3300017760 | Seawater | LIYVGFCFFVGVGIGAILIQVSALFWMFWDMFFGKKDKKNT |
| Ga0181422_11540811 | 3300017762 | Seawater | RRQVMELLINVAFCFFVGVGIGAILIQLSALFWMFWDMFFGKKDKKNT |
| Ga0187217_10765396 | 3300017770 | Seawater | MQGIELLIYVGFCFFVGVGIGAILIQVSALFWMFWDMFF |
| Ga0206125_103819862 | 3300020165 | Seawater | MQGIELLIYVGFCFFVGVGIGAMLIQISALFWMFWDMFKPKD |
| Ga0206128_13528482 | 3300020166 | Seawater | MQGIELLIYVGFCFFVGVGIGAILIQLSALLWMFWDMFKPKPTKQTRE |
| Ga0211686_100561812 | 3300020382 | Marine | MELLINVVFGLLLVIGIGAMLSMMSALIWMFWDMFFGKGNT |
| Ga0211554_103636382 | 3300020431 | Marine | MKMIDQLIFVGFCFFVGVGIGAMLIQVSALFWMFWDMFRSKKDGS |
| Ga0211676_100969591 | 3300020463 | Marine | MQGIELLIYVGFCFFVGVGIGAILIQINALFWMFWGMFFGKKDKEKT |
| Ga0206682_100000858 | 3300021185 | Seawater | MIDLLIFVGFCFFVGVGIGAILIQVSALFWMFWDMFFGKKS |
| Ga0206682_100100756 | 3300021185 | Seawater | MEMLIKVGFSFFVGVGIAAILIQVSALFWMFWDMFKPKD |
| Ga0213867_11247412 | 3300021335 | Seawater | MQGIELLIYVGFCFFVGVGIGAILIQLSALLWMFWDMFFNKRKDWLDK |
| Ga0222717_100222642 | 3300021957 | Estuarine Water | MEMLIKVGFCFFVGVGIGAILIQVSALFWMFWDMFKKN |
| Ga0224906_10273132 | 3300022074 | Seawater | MIDQLIFVGFCFFVGVGIGAMLIQVSALVWMFWDMFRSKKDD |
| (restricted) Ga0233432_100030566 | 3300023109 | Seawater | MEMLINVVFSLLLGVGIAAMLMQVSALFWMFWDMFRSKRND |
| (restricted) Ga0233432_100206111 | 3300023109 | Seawater | MIDLLIFAGFCFFVGVGIGAILIQVSALFWMFWDMFFGKK |
| Ga0228675_10086053 | 3300024247 | Seawater | MEMLIYVGFCFFVGVGIGAILLQLSALFWMFWDMFTKKR |
| (restricted) Ga0233438_100126353 | 3300024255 | Seawater | MEMLIKVGFCFFVGVGIGAILIQVSALFWMFWDMFKKKN |
| (restricted) Ga0233444_1001609312 | 3300024264 | Seawater | MEMLIKVGFSFFVGVGIAAILIQVSALFWMFWDMFRSKHND |
| Ga0228661_11082022 | 3300024266 | Seawater | MEMLIKVGFCFFVGVGIGAILIQVSALFWMFWDMF |
| Ga0228652_10670733 | 3300024326 | Seawater | CFFVGVGIGAILIQLSALFWMFWDMFFNKRKDLLDK |
| Ga0228635_10488774 | 3300024328 | Seawater | MEMLIKVGFCFFVGVGIGAILIQLSALFWMFWDMFKKN |
| Ga0244777_101574435 | 3300024343 | Estuarine | MQGIELLIYVGFCFFVGVGIGAILIQISALFWMFWDMFKPKPTKQTRE |
| Ga0244775_100510117 | 3300024346 | Estuarine | MIDLLIFAGFCFFVGVGIGAILIQVSALFWMFWDMFFGKKN |
| Ga0244775_105604273 | 3300024346 | Estuarine | MELLINVVFAFFFGVGIAAILIQVSALFWMFWDMFKPKD |
| Ga0244776_103494903 | 3300024348 | Estuarine | MLIKVGFSFFVGVGIAAILIQVSALFWMFWDMFKPKD |
| Ga0208791_10691223 | 3300025083 | Marine | QGIELLIYVGFCFFVGVGIGAILIQISALFWMFWDMFFGKKDKKNT |
| Ga0208298_100104123 | 3300025084 | Marine | QRKQVMELFIYVAFCFFVGVGIGAMLIQVSALFWMFWDMFKKK |
| Ga0208434_10101503 | 3300025098 | Marine | MQGIELLIYVGFCFFVGVGIGAILIQISALFWMFWDMFRSKKDGS |
| Ga0208793_10012401 | 3300025108 | Marine | VMELFIYVAFCFFVGVGIGAMLIQVSALFWMFWDMFKKK |
| Ga0208793_11106521 | 3300025108 | Marine | IQMMKRTMKMIDQLIFVGFCFFVGVGIGAMLIQISALFWMFWDMFFGKKDKKNT |
| Ga0209535_10229549 | 3300025120 | Marine | MQGIELLIHVGFCFFVGVGIGAILIQISALFWMFWDMFFGKKDKEKT |
| Ga0209336_100060315 | 3300025137 | Marine | MQGIELLIYVGFCFFVGVGIGAILIQISALFWMFWDMFFGKKDKEKT |
| Ga0209716_11621782 | 3300025626 | Pelagic Marine | MELFIYVAFCFFVGVGIGAILIQLSALFWMFWDMFFGKKDKKRLDSMTSWH |
| Ga0209307_12312191 | 3300025832 | Pelagic Marine | MQGIELLIYVGFCFFVGVGIGAILIQLSALLWMFWDMFKPKPT |
| Ga0209603_11347544 | 3300025849 | Pelagic Marine | MELFIYVAFCFFVGVGIGAILIQLSALFWMFWDMFFGKK |
| Ga0209632_104805231 | 3300025886 | Pelagic Marine | MELFIYVAFCFFVGVGIGAILIQLSALFWMFWDMFFGKKDKKRLDSMTS |
| Ga0209632_105066171 | 3300025886 | Pelagic Marine | RQVMELFIYVAFCFFVGVGIGAILIQLSALFWMFWDMFFGKKRQKET |
| Ga0209631_102806993 | 3300025890 | Pelagic Marine | MQGIELLIYVGFCFFVGVGIGAILIQLSALLWMFWDMFK |
| Ga0208973_10111765 | 3300027506 | Marine | MQGIELLIYVGFCFFVGVGIGAILIQISALFWMFWDMFTKQR |
| Ga0209192_101428073 | 3300027752 | Marine | MELLINVVFSLLLGVGIGAILMQVSALIWMFWDMFKRG |
| Ga0209502_104284362 | 3300027780 | Marine | MEMLIKVGFCFFVGVGIGAILIQVSALFWMFWDMFKPKQK |
| Ga0209711_100675701 | 3300027788 | Marine | MEQGIEMLIKVGFCFFVGVGIGAILIQVSALFWMFWDMFRNKRS |
| Ga0209302_100742163 | 3300027810 | Marine | MELLIKVGFCFFLGVGIGAILMQVSALIWMFWDMFKRG |
| Ga0209090_100140073 | 3300027813 | Marine | MEMLIKVGFCFFVGVGIGAILIQVSALFWMFWDMFKPKD |
| Ga0209092_100845534 | 3300027833 | Marine | MELLINVVFSLLLGVGIAAMLMQVSALFWMFWDMFRSKRND |
| Ga0209092_101327123 | 3300027833 | Marine | MELFIYVAFCFFVGVGIGAILIQLSALFWMFWDMFKPTKQTRD |
| Ga0228674_12097263 | 3300028008 | Seawater | MQGIELLIYVGFCFFVGVGIGAILIQISALFWMFWDMFFGKKDKKNT |
| Ga0228621_10486292 | 3300028124 | Seawater | MIDQLIFVGFCFFVGVGIGAMLIQVSALVWIFWDMFRSKKDD |
| Ga0228649_10208964 | 3300028132 | Seawater | MELFIHVAFCFFVGVGIGAILIQLSALFWMFWDMFFNKRKDLL |
| Ga0228608_10131455 | 3300028136 | Seawater | FCFFVGVGIGAILIQLSALFWMFWDMFFNKRKDLLDK |
| Ga0308024_100420210 | 3300031140 | Marine | MELLIKVGFSFFLGVGIGVILMQVSALCWMFWDMFRSKRND |
| Ga0307488_1000165424 | 3300031519 | Sackhole Brine | MELLINVLFAFFFGAGIAAILIQVTALFWMFWDMFFGRNK |
| Ga0307489_110103813 | 3300031569 | Sackhole Brine | MELLINVVFAFFFGAGIAAILIQVSALFWMFWDMFRSKRND |
| Ga0307996_10162611 | 3300031589 | Marine | RGLLMELLIKVGFSFFLGVGIGVILMQVSALCWMFWDMFRSKRND |
| Ga0302126_100501371 | 3300031622 | Marine | MEQGIEMLIKVGFCFFVGVGIGAILIQVSALFWMFWDM |
| Ga0315322_101919273 | 3300031766 | Seawater | MELFIHVAFCFFVGVGIGAILIQLSALFWMFWDMFFNKRKDLLDK |
| Ga0315331_101994033 | 3300031774 | Seawater | MKMIDQLIFVGFCFFVGVGIGAMLIQVSALLWMFWDMFRSKKDD |
| Ga0315330_103039294 | 3300032047 | Seawater | TLIQMMKRTMKMIDQLIFVGFCFFVGVGIGAMLIQVSALVWMFWDMFRSKKDD |
| ⦗Top⦘ |