


| Basic Information | |
|---|---|
| Family ID | F083228 |
| Family Type | Metagenome |
| Number of Sequences | 113 |
| Average Sequence Length | 39 residues |
| Representative Sequence | INTHGDYAVANALCLLSLLVAAVGAAFYLRHAVARAERR |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.94 % |
| % of genes near scaffold ends (potentially truncated) | 92.92 % |
| % of genes from short scaffolds (< 2000 bps) | 88.50 % |
| Associated GOLD sequencing projects | 100 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (61.947 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere (7.080 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.938 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (38.053 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.73% β-sheet: 0.00% Coil/Unstructured: 46.27% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF00528 | BPD_transp_1 | 56.64 |
| PF00378 | ECH_1 | 1.77 |
| PF00582 | Usp | 0.88 |
| PF00011 | HSP20 | 0.88 |
| PF07690 | MFS_1 | 0.88 |
| PF00270 | DEAD | 0.88 |
| PF00117 | GATase | 0.88 |
| PF00291 | PALP | 0.88 |
| PF02371 | Transposase_20 | 0.88 |
| PF02894 | GFO_IDH_MocA_C | 0.88 |
| PF00459 | Inositol_P | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.88 |
| COG0673 | Predicted dehydrogenase | General function prediction only [R] | 0.88 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 61.95 % |
| Unclassified | root | N/A | 38.05 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005327|Ga0070658_10211373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1639 | Open in IMG/M |
| 3300005329|Ga0070683_100118112 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2504 | Open in IMG/M |
| 3300005332|Ga0066388_103400021 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 813 | Open in IMG/M |
| 3300005334|Ga0068869_100910181 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 762 | Open in IMG/M |
| 3300005339|Ga0070660_100597204 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 923 | Open in IMG/M |
| 3300005344|Ga0070661_100791149 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 778 | Open in IMG/M |
| 3300005367|Ga0070667_101997895 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 546 | Open in IMG/M |
| 3300005459|Ga0068867_101306694 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 670 | Open in IMG/M |
| 3300005530|Ga0070679_100660783 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 988 | Open in IMG/M |
| 3300005539|Ga0068853_101135584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 754 | Open in IMG/M |
| 3300005539|Ga0068853_102247997 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 529 | Open in IMG/M |
| 3300005540|Ga0066697_10066718 | All Organisms → cellular organisms → Bacteria | 2060 | Open in IMG/M |
| 3300005553|Ga0066695_10864898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 518 | Open in IMG/M |
| 3300005563|Ga0068855_100057922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4540 | Open in IMG/M |
| 3300005577|Ga0068857_101430500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 673 | Open in IMG/M |
| 3300005578|Ga0068854_100850355 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 799 | Open in IMG/M |
| 3300005615|Ga0070702_101614638 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 537 | Open in IMG/M |
| 3300005833|Ga0074472_11101465 | Not Available | 680 | Open in IMG/M |
| 3300005833|Ga0074472_11243051 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300005841|Ga0068863_100239644 | Not Available | 1751 | Open in IMG/M |
| 3300005893|Ga0075278_1040279 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 685 | Open in IMG/M |
| 3300006041|Ga0075023_100447622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium | 570 | Open in IMG/M |
| 3300006047|Ga0075024_100707541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 554 | Open in IMG/M |
| 3300006169|Ga0082029_1006434 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1476 | Open in IMG/M |
| 3300006224|Ga0079037_100180286 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1878 | Open in IMG/M |
| 3300006804|Ga0079221_10627315 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 731 | Open in IMG/M |
| 3300006930|Ga0079303_10094009 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1123 | Open in IMG/M |
| 3300006954|Ga0079219_12261156 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 525 | Open in IMG/M |
| 3300007076|Ga0075435_101995001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 509 | Open in IMG/M |
| 3300009100|Ga0075418_10699749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1092 | Open in IMG/M |
| 3300009166|Ga0105100_10229487 | Not Available | 1108 | Open in IMG/M |
| 3300009167|Ga0113563_12137471 | Not Available | 671 | Open in IMG/M |
| 3300009179|Ga0115028_10595697 | Not Available | 825 | Open in IMG/M |
| 3300009870|Ga0131092_11112009 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 629 | Open in IMG/M |
| 3300010357|Ga0116249_10253079 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1632 | Open in IMG/M |
| 3300010401|Ga0134121_10820999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Phyllobacterium | 895 | Open in IMG/M |
| 3300010937|Ga0137776_1206043 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 640 | Open in IMG/M |
| 3300012202|Ga0137363_11175368 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 653 | Open in IMG/M |
| 3300012350|Ga0137372_10051168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 3649 | Open in IMG/M |
| 3300012351|Ga0137386_10167013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1577 | Open in IMG/M |
| 3300012351|Ga0137386_10877173 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 644 | Open in IMG/M |
| 3300012359|Ga0137385_11092674 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 657 | Open in IMG/M |
| 3300012914|Ga0157297_10021147 | Not Available | 1458 | Open in IMG/M |
| 3300012958|Ga0164299_11034430 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 608 | Open in IMG/M |
| 3300013297|Ga0157378_10848820 | Not Available | 941 | Open in IMG/M |
| 3300013307|Ga0157372_10526778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1377 | Open in IMG/M |
| 3300013308|Ga0157375_11602226 | Not Available | 770 | Open in IMG/M |
| 3300013308|Ga0157375_12822797 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 581 | Open in IMG/M |
| 3300014325|Ga0163163_11514814 | Not Available | 732 | Open in IMG/M |
| 3300015075|Ga0167636_1033403 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 634 | Open in IMG/M |
| 3300015372|Ga0132256_101929674 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 697 | Open in IMG/M |
| 3300015372|Ga0132256_103744411 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 511 | Open in IMG/M |
| 3300017936|Ga0187821_10126597 | Not Available | 954 | Open in IMG/M |
| 3300018000|Ga0184604_10090527 | Not Available | 931 | Open in IMG/M |
| 3300018060|Ga0187765_10062043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1952 | Open in IMG/M |
| 3300018076|Ga0184609_10229973 | Not Available | 866 | Open in IMG/M |
| 3300018084|Ga0184629_10507114 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 627 | Open in IMG/M |
| 3300018433|Ga0066667_10875005 | Not Available | 771 | Open in IMG/M |
| 3300018920|Ga0190273_10911108 | Not Available | 713 | Open in IMG/M |
| 3300022694|Ga0222623_10344105 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 570 | Open in IMG/M |
| 3300025906|Ga0207699_10063480 | Not Available | 2231 | Open in IMG/M |
| 3300025909|Ga0207705_10762397 | Not Available | 752 | Open in IMG/M |
| 3300025910|Ga0207684_11627066 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 522 | Open in IMG/M |
| 3300025912|Ga0207707_10949431 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 708 | Open in IMG/M |
| 3300025919|Ga0207657_10513005 | Not Available | 939 | Open in IMG/M |
| 3300025920|Ga0207649_10865335 | Not Available | 707 | Open in IMG/M |
| 3300025921|Ga0207652_10596448 | Not Available | 991 | Open in IMG/M |
| 3300025926|Ga0207659_10676885 | Not Available | 883 | Open in IMG/M |
| 3300025932|Ga0207690_11369493 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 591 | Open in IMG/M |
| 3300025945|Ga0207679_11648401 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 587 | Open in IMG/M |
| 3300025972|Ga0207668_11516863 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 605 | Open in IMG/M |
| 3300025986|Ga0207658_11311765 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 662 | Open in IMG/M |
| 3300026095|Ga0207676_11581647 | Not Available | 653 | Open in IMG/M |
| 3300026547|Ga0209156_10169609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1052 | Open in IMG/M |
| 3300027843|Ga0209798_10221986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Phyllobacterium | 926 | Open in IMG/M |
| 3300027897|Ga0209254_10392757 | Not Available | 1031 | Open in IMG/M |
| 3300027899|Ga0209668_10755485 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 654 | Open in IMG/M |
| 3300027900|Ga0209253_10480101 | Not Available | 931 | Open in IMG/M |
| 3300028792|Ga0307504_10103771 | Not Available | 909 | Open in IMG/M |
| 3300029980|Ga0302298_10092075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 946 | Open in IMG/M |
| 3300030002|Ga0311350_11569974 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 583 | Open in IMG/M |
| 3300031547|Ga0310887_10451116 | Not Available | 767 | Open in IMG/M |
| 3300031726|Ga0302321_101280145 | Not Available | 841 | Open in IMG/M |
| 3300031820|Ga0307473_10294258 | Not Available | 1018 | Open in IMG/M |
| 3300031939|Ga0308174_10232737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1422 | Open in IMG/M |
| 3300031939|Ga0308174_11118568 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 670 | Open in IMG/M |
| 3300031952|Ga0315294_10671271 | Not Available | 915 | Open in IMG/M |
| 3300031995|Ga0307409_102722818 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 523 | Open in IMG/M |
| 3300032005|Ga0307411_10705109 | Not Available | 879 | Open in IMG/M |
| 3300032013|Ga0310906_10037313 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2279 | Open in IMG/M |
| 3300032053|Ga0315284_11192878 | Not Available | 837 | Open in IMG/M |
| 3300032074|Ga0308173_10199680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1659 | Open in IMG/M |
| 3300032180|Ga0307471_103473460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 558 | Open in IMG/M |
| 3300032205|Ga0307472_100875553 | Not Available | 829 | Open in IMG/M |
| 3300032205|Ga0307472_101333820 | Not Available | 692 | Open in IMG/M |
| 3300032205|Ga0307472_101606721 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 639 | Open in IMG/M |
| 3300033408|Ga0316605_10573687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1050 | Open in IMG/M |
| 3300033414|Ga0316619_11963115 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 532 | Open in IMG/M |
| 3300033416|Ga0316622_101124174 | Not Available | 918 | Open in IMG/M |
| 3300033419|Ga0316601_100325014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1418 | Open in IMG/M |
| 3300033480|Ga0316620_10894681 | Not Available | 858 | Open in IMG/M |
| 3300033482|Ga0316627_101937030 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 610 | Open in IMG/M |
| 3300033804|Ga0314863_045725 | Not Available | 893 | Open in IMG/M |
| 3300034074|Ga0373894_026969 | Not Available | 824 | Open in IMG/M |
| 3300034149|Ga0364929_0255889 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 590 | Open in IMG/M |
| 3300034690|Ga0364923_0138952 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 629 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 7.08% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.31% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.42% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.42% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.54% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 2.65% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.65% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.65% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.65% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.77% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.77% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 1.77% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.77% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.77% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.77% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.77% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.77% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.77% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.77% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.77% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.89% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.89% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.89% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.89% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.89% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.89% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.89% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.89% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.89% |
| Glacier Forefield Soils | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soils | 0.89% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.89% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.89% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.89% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.89% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.89% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.89% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.89% |
| Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005893 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_202 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006930 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
| 3300009527 | Groundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Lower Cold Creek | Environmental | Open in IMG/M |
| 3300009870 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant | Engineered | Open in IMG/M |
| 3300010357 | AD_USSTca | Engineered | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300011442 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2 | Environmental | Open in IMG/M |
| 3300012186 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ416 (21.06) | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015075 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G5C, Northern proglacial tributary margin, adjacent to top of river) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300022549 | Cold Creek_combined assembly | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027843 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300029980 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_3 | Environmental | Open in IMG/M |
| 3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
| 3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
| 3300033416 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033804 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_20 | Environmental | Open in IMG/M |
| 3300034074 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A4A4.1 | Engineered | Open in IMG/M |
| 3300034149 | Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17 | Environmental | Open in IMG/M |
| 3300034690 | Sediment microbial communities from East River floodplain, Colorado, United States - 60_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0070658_102113731 | 3300005327 | Corn Rhizosphere | INTHGDYAVANALCLMSLVVAAIGAWFYLRQSTRALARQR* |
| Ga0070683_1001181121 | 3300005329 | Corn Rhizosphere | AYRINTFSDYAVANALCLLSLLLAAFGAAFYLRHAVRSAAS* |
| Ga0066388_1034000212 | 3300005332 | Tropical Forest Soil | THGDYAVANALCLLSLLLAAVGAVFYLRHAGGRTDAQAGR* |
| Ga0068869_1009101811 | 3300005334 | Miscanthus Rhizosphere | NTHSDYAVANALCLLSLLVAAGGAAFYLRHAVKGAETKS* |
| Ga0070660_1005972041 | 3300005339 | Corn Rhizosphere | INTHGDYAVANALCLVSLLLAAVGAAFYLKHSVGQAERRA* |
| Ga0070661_1007911491 | 3300005344 | Corn Rhizosphere | YRINTFSDYAVANALCLLSLLLAAFGAAFYLRHAVRSAAS* |
| Ga0070667_1019978951 | 3300005367 | Switchgrass Rhizosphere | INTHGDYAVANALCLLSLLVAAVGAAFYLRHAVARAERR* |
| Ga0068867_1013066941 | 3300005459 | Miscanthus Rhizosphere | YRINTHGDYAVANALCLVSLLLAAVGAAFYLKHSVGQAERRA* |
| Ga0070679_1006607832 | 3300005530 | Corn Rhizosphere | YRINTFADYAVANALCLLSLLVAAFGAAFYLRHAVRRAESGA* |
| Ga0068853_1011355841 | 3300005539 | Corn Rhizosphere | YRINTFADYAVANALCLLSLLLAAAGAALYLRHAVKRAA* |
| Ga0068853_1022479971 | 3300005539 | Corn Rhizosphere | RINTHSDYAVANALCLLSLLVAAGGAAFYLRHAVKGAETKS* |
| Ga0066697_100667184 | 3300005540 | Soil | YPVANALCLLSLALAAIGAVFYLRHAAGQVEEHRR* |
| Ga0066695_108648981 | 3300005553 | Soil | DVAYRISTHADYPVANALCLLSLALAAIGAVFYLRHAAAQVERT* |
| Ga0068855_1000579221 | 3300005563 | Corn Rhizosphere | DYGVANALCLMSLVIAAVGAWFYLRHSLRNAEAVT* |
| Ga0068857_1014305002 | 3300005577 | Corn Rhizosphere | VDVAYRINTFADYAVANALCLLSLLLAAAGAALYLRHAVKRAA* |
| Ga0068854_1008503552 | 3300005578 | Corn Rhizosphere | DYAVANALCLLSLLLAAFGAAFYLRHAVHRAENT* |
| Ga0070702_1016146381 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | VAYRINTHADYAVANALCLLSLLVAAGGAAFYLRHAVKGAEAAS* |
| Ga0074472_111014652 | 3300005833 | Sediment (Intertidal) | THGDYAVANALCLVSLLFASLGAWVYLRHAVAKAEQGS* |
| Ga0074472_112430511 | 3300005833 | Sediment (Intertidal) | HGDYAVANALCLVSLLFASLGAWIYLRHAVAKAEQGA* |
| Ga0068863_1002396444 | 3300005841 | Switchgrass Rhizosphere | STLSDYAVANALCLLSLIVAAGGAWFYLRHASESVK* |
| Ga0075278_10402791 | 3300005893 | Rice Paddy Soil | TFADYAVANALCLLSLLLAAVGAAFYLRHAVHRAEGPQ* |
| Ga0075023_1004476221 | 3300006041 | Watersheds | HGDYAVANALCLVSLAFASLGAWVYLRHAVQQVART* |
| Ga0075024_1007075412 | 3300006047 | Watersheds | HGDYAVANALCLISLLFASLGAWVYLRHAVKRVGGA* |
| Ga0082029_10064343 | 3300006169 | Termite Nest | YRISTLSDYAVANALCLMSLVVAAGGAWFYLRHAVARAEGT* |
| Ga0079037_1001802861 | 3300006224 | Freshwater Wetlands | VAYRISTHGDYAVANALCLVSLVFASLGAWVYLHHAVKRVGVA* |
| Ga0079221_106273152 | 3300006804 | Agricultural Soil | TFADYPVANALCLMSLVLAGGGAWFYLRHAAQKVEAAA* |
| Ga0079303_100940091 | 3300006930 | Deep Subsurface | AYRISTLSDYAVANALCLMSLAVAAVGAWFYLQHAKRQTLSA* |
| Ga0079219_122611561 | 3300006954 | Agricultural Soil | STHADYPVANALCLLSLALAAIGAVFYLRHAVAKAEGA* |
| Ga0075435_1019950012 | 3300007076 | Populus Rhizosphere | RINTHADYAVANALCLMSLVIAAFGAWFYLRHAARRVT* |
| Ga0075418_106997493 | 3300009100 | Populus Rhizosphere | TFADYAVANALCLLTLLLAAFGAAFYLRHAVRRAESTS* |
| Ga0105100_102294871 | 3300009166 | Freshwater Sediment | NTHGDYGVANALCLASLLLAAGGAWFYLRHAVVRAEAAA* |
| Ga0113563_121374712 | 3300009167 | Freshwater Wetlands | AEYAVANALCLLSLLVAAGGAAFYLRHAVKSAGEAA* |
| Ga0115028_105956971 | 3300009179 | Wetland | RISTHGDYAVANALCLVSLVFASLGAWVYLHHAVKRVGVA* |
| Ga0114942_13165742 | 3300009527 | Groundwater | INDHGDYAVANALCLMSLLIAAAAAWIYLRHATARHTAAS* |
| Ga0131092_111120091 | 3300009870 | Activated Sludge | YRISTMGDYAVANALCLMSLVVAAGAAWFYLQHSAKAMRQ* |
| Ga0116249_102530791 | 3300010357 | Anaerobic Digestor Sludge | HGDYAVANALCLVSLLFGAAGAWVYLRHAVRRAEQVS* |
| Ga0134121_108209992 | 3300010401 | Terrestrial Soil | YRINTHSDYAVANALCLLSLLVAAGGAAFYLRHAVKGAETKS* |
| Ga0137776_12060432 | 3300010937 | Sediment | AYRIATFGDYPVANALCLLTLGRAAIGAVFYLRHAGAGAAKT* |
| Ga0137437_11448311 | 3300011442 | Soil | SDYAVANALCLLSLLVAATAAWLYLRHAVGQVARQ* |
| Ga0136620_101871662 | 3300012186 | Polar Desert Sand | GDYAVANALCLMSLLVAAAGAWFYLRQVSGQVRQR* |
| Ga0137363_111753682 | 3300012202 | Vadose Zone Soil | DYPVANALCLLSLGLAAIGAVFYLRHATARAVGS* |
| Ga0137372_100511684 | 3300012350 | Vadose Zone Soil | VAYRINTHADYAVANALCLMSLLVAAIGAAFYLRHATRQSSA* |
| Ga0137386_101670131 | 3300012351 | Vadose Zone Soil | INTHADYAVANALCLLSLLVAAIGAAFYLRHASAKVSQT* |
| Ga0137386_108771732 | 3300012351 | Vadose Zone Soil | VAYRISTHGDYPVANALCLLSLALAAIGAVFYLRHAAAQVEGK* |
| Ga0137385_110926741 | 3300012359 | Vadose Zone Soil | YRINTFADYAVANALCLLSLILAAGGAWFYLQHAVGKVEKT* |
| Ga0157297_100211471 | 3300012914 | Soil | DYAVANALCLLTLLFAAFGAAFYLRHAVRRAEATS* |
| Ga0164299_110344302 | 3300012958 | Soil | AYWINTHSDYAVANALCLLSLIVAAGGAAFYLRHAVKSAEGKA* |
| Ga0157378_108488201 | 3300013297 | Miscanthus Rhizosphere | DYAVANALCLMSLVVAAIGAWFYLRQSTRALARQR* |
| Ga0157372_105267783 | 3300013307 | Corn Rhizosphere | AYRINTHADYAVANALCLLSLLLAAVGAAFYLRHAVKRVESGG* |
| Ga0157375_116022262 | 3300013308 | Miscanthus Rhizosphere | STLSDYGVANALCLISLVVAAGAAWFYLQHAADKVRR* |
| Ga0157375_128227971 | 3300013308 | Miscanthus Rhizosphere | INTFADYAVANALCLLSLLLAAVGAAFYLRHAVKRVETGS* |
| Ga0163163_115148142 | 3300014325 | Switchgrass Rhizosphere | DYAVANALCLLSLLVAAGGAWFYLRHAVKGAEDKT* |
| Ga0167636_10334032 | 3300015075 | Glacier Forefield Soils | NTFGDYAVANALCLLSLVLAAGGAWFYLHHAVEKVTRA* |
| Ga0132256_1019296741 | 3300015372 | Arabidopsis Rhizosphere | AYRISTLSDYAVANALCLMCLIVAAAAAWFYLKHAAAERSRA* |
| Ga0132256_1037444111 | 3300015372 | Arabidopsis Rhizosphere | DVAYRISTHGDYPVANALCLLTLGLSAIGAAFYLRHASRSSRAATS* |
| Ga0187821_101265972 | 3300017936 | Freshwater Sediment | YRIATHGDYPVANALCLLSLALAAIGAVFYLRHAVAKAEGA |
| Ga0184604_100905272 | 3300018000 | Groundwater Sediment | HADYAVANALCLLSLLVAALGAAFYLRHAVRRSDA |
| Ga0187765_100620431 | 3300018060 | Tropical Peatland | STHADYPVANALCLLTLVLAAIGAVFYLRHAGVRAEGEASR |
| Ga0184609_102299732 | 3300018076 | Groundwater Sediment | ISTHADYPVANALCLLSLALAAIGAVFYLRHAAAQVRGT |
| Ga0184629_105071142 | 3300018084 | Groundwater Sediment | DIAYRISTLGDYSVANALCLMSLIVAAGAAWFYLQHTAKKI |
| Ga0066667_108750052 | 3300018433 | Grasslands Soil | VAYRIKTFSDSAVAYAICLMSLALAAGGTWFYLRHAAARVDAR |
| Ga0190273_109111081 | 3300018920 | Soil | HGDYAVANALCLMSLVLASAGAWFYLREAARKAERA |
| Ga0212091_103833041 | 3300022549 | Groundwater | SDYAVANALCLMSLLIAAAAAWIYLRHATARHTAAS |
| Ga0222623_103441051 | 3300022694 | Groundwater Sediment | YRISTHADYPVANALCLLSLALAAIGAVFYLRHAAAQVRGT |
| Ga0207699_100634804 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | AYRISTFADYAVANALCLLSLLLAAFGAAFYLRHAVQRVEVKG |
| Ga0207705_107623972 | 3300025909 | Corn Rhizosphere | YRINTFADYAVANALCLLSLLLAAVGAAFYLRHAVKRVETGS |
| Ga0207684_116270662 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | FADYPVANALCLLSLVLAAGGAWFYLRHASKKIEVVA |
| Ga0207707_109494311 | 3300025912 | Corn Rhizosphere | ISTFADYAVANALCLLSLLLAAFGAAFYLRHAVRKVEGA |
| Ga0207657_105130052 | 3300025919 | Corn Rhizosphere | GDYGVANALCLMSLVIAAVGAWFYLRHSLRNAEAVT |
| Ga0207649_108653351 | 3300025920 | Corn Rhizosphere | GDYAVANALCLVSLLLAAVGAAFYLKHSVGQAERRA |
| Ga0207652_105964482 | 3300025921 | Corn Rhizosphere | YRINTFADYAVANALCLLSLLVAAFGAAFYLRHAVRRAESGA |
| Ga0207659_106768852 | 3300025926 | Miscanthus Rhizosphere | INTHSDYAVANALCLLSLLVAAGGAWFYLRHAVKGAEDKT |
| Ga0207690_113694932 | 3300025932 | Corn Rhizosphere | INTFADYAVANALCLLTLLFAAFGAAFYLRHAVRRAEATS |
| Ga0207679_116484011 | 3300025945 | Corn Rhizosphere | TFADYAVANTLCLLTLLFAAFGAAFYLRHAVRRAEATS |
| Ga0207668_115168631 | 3300025972 | Switchgrass Rhizosphere | YRISTLSDYAVANALCLISLVVAAGAAWFYLQHAAREQARA |
| Ga0207658_113117652 | 3300025986 | Switchgrass Rhizosphere | AYRINTHSDYAVANALCLLSLIVAAGGAAFYLRHAVKSAAATT |
| Ga0207676_115816471 | 3300026095 | Switchgrass Rhizosphere | MSLLRTGAIYGVANALCLLSLLVAAGGAAFYLRHAVKGAEAAS |
| Ga0209156_101696092 | 3300026547 | Soil | VAYRISTLSDYAVANALCLLTLIVAAGGAWFYLRHAAAEGGRA |
| Ga0209798_102219861 | 3300027843 | Wetland Sediment | VAYRINTHADYAVANALCLLSLLVAAGGAAFYLRHAVKSAGAAS |
| Ga0209254_103927571 | 3300027897 | Freshwater Lake Sediment | AYRISTLSDYAVANALCLMSLVVAAAGAWFYLQHAKARQL |
| Ga0209668_107554851 | 3300027899 | Freshwater Lake Sediment | GDYAVANALCLVSLVFASLGAWVYLHHAVKRVGVA |
| Ga0209253_104801011 | 3300027900 | Freshwater Lake Sediment | SDYAVANALCLLSLLVAGGGAAFYLRHAVRSAGGTQ |
| Ga0307504_101037711 | 3300028792 | Soil | YRISTHGDYPVANALCLLSLALAAIGAVFYLRHAAAQVEGK |
| Ga0307503_103775202 | 3300028802 | Soil | SDYAVANALCLMSLLVAAAAAWMYLRHAVAQVART |
| Ga0302298_100920752 | 3300029980 | Fen | HGDYPVANALCILSLALSGIGAAFYLRHASRTSTAAT |
| Ga0311350_115699741 | 3300030002 | Fen | ISTHGDYPVANALCLLTLGLSAIGAAFYLRHASRSSRAATS |
| Ga0310887_104511162 | 3300031547 | Soil | HGDYAVANALCLMSLVVAAFGAWFYLRQSSRALAK |
| Ga0302321_1012801452 | 3300031726 | Fen | YRINTHGDYPVANALCILSLALSAIGAAFYLRHASRTSTAAT |
| Ga0307473_102942582 | 3300031820 | Hardwood Forest Soil | STHGDYPVANALCLLTLVLAAIGAVFYLRHAGASAEKR |
| Ga0308174_102327372 | 3300031939 | Soil | DVAYRINTFADYAVANALCLLSLLLAAVGAAFYLSHAVKRVEAG |
| Ga0308174_111185682 | 3300031939 | Soil | ISTFADYAVANALCLLSLLLAAFGAAFYLRHAVRKVESA |
| Ga0315294_106712711 | 3300031952 | Sediment | YRINTHADYAVANALCLLSLLVAAGGAAFYLRHAVRSAGATS |
| Ga0307409_1027228182 | 3300031995 | Rhizosphere | HGDYAVANALCLVSLLFASLGAAIYLRHAVRRAELAP |
| Ga0307411_107051092 | 3300032005 | Rhizosphere | DVAYRINTFADYAVANALCLLTLLLAAFGAAFYLRHAVRRAESTS |
| Ga0310906_100373131 | 3300032013 | Soil | VAYRISTLSDYAVANALCLMSLVVAAGGAWFYLQHSAKTIK |
| Ga0315284_111928782 | 3300032053 | Sediment | DYAVANALCLLSLLVAAGGAAFYLRHAVRSAGATS |
| Ga0308173_101996803 | 3300032074 | Soil | ADYAVANALCLLSLLLAAFGAAFYLRHAVRRVEAP |
| Ga0307470_117928321 | 3300032174 | Hardwood Forest Soil | TLSDYAVANALCLMCLVVAAGAAWFYLQHAAAERSRT |
| Ga0307471_1034734602 | 3300032180 | Hardwood Forest Soil | TVDVAYRINTHGDYAVANALCLMSLLLAAVGAAFYLRQAGRKADS |
| Ga0307472_1008755532 | 3300032205 | Hardwood Forest Soil | YRISTHGDYPVANALCLLSLLLAAIGAVFYLRHAAAGAERS |
| Ga0307472_1013338201 | 3300032205 | Hardwood Forest Soil | DYAVANALCLISLVVAAGGAAFYLRHAVKSAEGTG |
| Ga0307472_1016067212 | 3300032205 | Hardwood Forest Soil | FGDYAVANALCLLSLILAAGGAWFYLHHAVEKVERA |
| Ga0316605_105736871 | 3300033408 | Soil | AYRISTLSDYAVANALCLMSLAVAAVGAWFYLQHAKRQTLSA |
| Ga0316619_119631151 | 3300033414 | Soil | RISTHGDYAVANALCLVSLVFASLGAWVYLHHAVKRVGVA |
| Ga0316622_1011241742 | 3300033416 | Soil | INTHSDYGVANALCLASLALAAAGAWFYLRHAVARVEVAS |
| Ga0316601_1003250141 | 3300033419 | Soil | TLSDYAVANALCLMSLAVAAVGAWFYLQHAKRQTLSA |
| Ga0326726_110583201 | 3300033433 | Peat Soil | GDYAVANALCLMSLVLASFGAWFYLREAAAKKADRT |
| Ga0316620_108946812 | 3300033480 | Soil | VAYRISTHGDYAVANALCLVSLVFASLGAWVYLHHAVKRVGVA |
| Ga0316627_1019370301 | 3300033482 | Soil | SDYAVANALCLLSLLVAAGGAWFYLRHAARGARGEAVQ |
| Ga0314863_045725_1_117 | 3300033804 | Peatland | STHGDYAVANALCLLSLALAAIGAVFYLRHASARAEGG |
| Ga0373894_026969_710_823 | 3300034074 | Sediment Slurry | HADYGVANALCLASLVLAAAGAWFYLRHAVERAEDSG |
| Ga0364929_0255889_479_589 | 3300034149 | Sediment | HSDYAVANALCLMSLLVAAAAAWLYLRHAVRQHARQ |
| Ga0364923_0138952_515_628 | 3300034690 | Sediment | HSDYGVANALCLASLALAAAGAWFYLHHAVAKAESST |
| ⦗Top⦘ |