


| Basic Information | |
|---|---|
| Family ID | F083180 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MIWAALRWVPLMFLIAPAMEAPLVAHLNQPVKPIKTWR |
| Number of Associated Samples | 106 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 57.14 % |
| % of genes near scaffold ends (potentially truncated) | 99.12 % |
| % of genes from short scaffolds (< 2000 bps) | 90.27 % |
| Associated GOLD sequencing projects | 104 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.35 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.035 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (23.009 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.894 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.788 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 39.39% β-sheet: 0.00% Coil/Unstructured: 60.61% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF01180 | DHO_dh | 92.04 |
| PF00156 | Pribosyltran | 2.65 |
| PF01663 | Phosphodiest | 1.77 |
| PF02729 | OTCace_N | 0.88 |
| PF00135 | COesterase | 0.88 |
| PF08543 | Phos_pyr_kin | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 92.04 |
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 92.04 |
| COG0167 | Dihydroorotate dehydrogenase | Nucleotide transport and metabolism [F] | 92.04 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 92.04 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 92.04 |
| COG0351 | Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase | Coenzyme transport and metabolism [H] | 0.88 |
| COG0524 | Sugar or nucleoside kinase, ribokinase family | Carbohydrate transport and metabolism [G] | 0.88 |
| COG2240 | Pyridoxal/pyridoxine/pyridoxamine kinase | Coenzyme transport and metabolism [H] | 0.88 |
| COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 0.88 |
| COG2870 | ADP-heptose synthase, bifunctional sugar kinase/adenylyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.04 % |
| Unclassified | root | N/A | 7.96 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000655|AF_2010_repII_A100DRAFT_1039553 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300001545|JGI12630J15595_10108702 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300001593|JGI12635J15846_10761194 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300001867|JGI12627J18819_10053769 | All Organisms → cellular organisms → Bacteria | 1680 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101176109 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300002907|JGI25613J43889_10142071 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300002915|JGI25387J43893_1074907 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300002917|JGI25616J43925_10299435 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300004091|Ga0062387_101025061 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300005437|Ga0070710_10117585 | All Organisms → cellular organisms → Bacteria | 1605 | Open in IMG/M |
| 3300005445|Ga0070708_100555579 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
| 3300005529|Ga0070741_11180548 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300005538|Ga0070731_10079187 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2179 | Open in IMG/M |
| 3300005566|Ga0066693_10072226 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
| 3300006059|Ga0075017_100894323 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300006059|Ga0075017_101200368 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300006086|Ga0075019_10743398 | Not Available | 622 | Open in IMG/M |
| 3300006172|Ga0075018_10745231 | Not Available | 533 | Open in IMG/M |
| 3300007788|Ga0099795_10094732 | All Organisms → cellular organisms → Bacteria | 1162 | Open in IMG/M |
| 3300009012|Ga0066710_101687827 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300009089|Ga0099828_10348180 | All Organisms → cellular organisms → Bacteria | 1335 | Open in IMG/M |
| 3300009545|Ga0105237_11741430 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300009618|Ga0116127_1090716 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300009764|Ga0116134_1340308 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300010043|Ga0126380_11975008 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300010358|Ga0126370_11173827 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300010379|Ga0136449_100314069 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2845 | Open in IMG/M |
| 3300011271|Ga0137393_10500367 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
| 3300012096|Ga0137389_11019080 | Not Available | 709 | Open in IMG/M |
| 3300012199|Ga0137383_10241162 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1325 | Open in IMG/M |
| 3300012200|Ga0137382_11025285 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300012202|Ga0137363_11411797 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300012206|Ga0137380_10265493 | All Organisms → cellular organisms → Bacteria | 1544 | Open in IMG/M |
| 3300012211|Ga0137377_11075836 | Not Available | 734 | Open in IMG/M |
| 3300012363|Ga0137390_11369344 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300012683|Ga0137398_10178977 | All Organisms → cellular organisms → Bacteria | 1390 | Open in IMG/M |
| 3300012918|Ga0137396_11308430 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300012927|Ga0137416_10668725 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300014153|Ga0181527_1058883 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2001 | Open in IMG/M |
| 3300015053|Ga0137405_1271777 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300016341|Ga0182035_10538837 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
| 3300016371|Ga0182034_11444441 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300016404|Ga0182037_11201333 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300016422|Ga0182039_10163217 | All Organisms → cellular organisms → Bacteria | 1740 | Open in IMG/M |
| 3300017823|Ga0187818_10207894 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300017930|Ga0187825_10423393 | Not Available | 514 | Open in IMG/M |
| 3300017932|Ga0187814_10181482 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300017959|Ga0187779_10745446 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300017970|Ga0187783_11092458 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300017973|Ga0187780_10076362 | All Organisms → cellular organisms → Bacteria | 2302 | Open in IMG/M |
| 3300018012|Ga0187810_10211103 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300018035|Ga0187875_10153123 | Not Available | 1289 | Open in IMG/M |
| 3300018062|Ga0187784_10458365 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
| 3300018090|Ga0187770_10518518 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
| 3300018431|Ga0066655_10188415 | All Organisms → cellular organisms → Bacteria | 1264 | Open in IMG/M |
| 3300019789|Ga0137408_1053177 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300020140|Ga0179590_1082353 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300020580|Ga0210403_10689233 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300020581|Ga0210399_10359657 | All Organisms → cellular organisms → Bacteria | 1215 | Open in IMG/M |
| 3300020581|Ga0210399_10889530 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300021407|Ga0210383_10426703 | Not Available | 1144 | Open in IMG/M |
| 3300021420|Ga0210394_10593366 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 974 | Open in IMG/M |
| 3300021420|Ga0210394_10670889 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300021474|Ga0210390_10048731 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3477 | Open in IMG/M |
| 3300021477|Ga0210398_10540787 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300021478|Ga0210402_11845435 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300021479|Ga0210410_11120351 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300021479|Ga0210410_11813142 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300021559|Ga0210409_10034452 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4843 | Open in IMG/M |
| 3300022531|Ga0242660_1160929 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300022708|Ga0242670_1039840 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300023259|Ga0224551_1012267 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1436 | Open in IMG/M |
| 3300024288|Ga0179589_10469023 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300025905|Ga0207685_10081553 | All Organisms → cellular organisms → Bacteria | 1340 | Open in IMG/M |
| 3300025910|Ga0207684_11095295 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300025928|Ga0207700_10007681 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6621 | Open in IMG/M |
| 3300026281|Ga0209863_10053553 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
| 3300026524|Ga0209690_1127058 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300027039|Ga0207855_1029629 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300027109|Ga0208603_1024622 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300027603|Ga0209331_1153868 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300027643|Ga0209076_1102465 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300027671|Ga0209588_1232397 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300027729|Ga0209248_10173901 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300027737|Ga0209038_10058523 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
| 3300027795|Ga0209139_10083343 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1124 | Open in IMG/M |
| 3300027846|Ga0209180_10196080 | All Organisms → cellular organisms → Bacteria | 1165 | Open in IMG/M |
| 3300027846|Ga0209180_10363855 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300027846|Ga0209180_10507083 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300027862|Ga0209701_10129864 | All Organisms → cellular organisms → Bacteria | 1554 | Open in IMG/M |
| 3300027882|Ga0209590_10339134 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
| 3300027894|Ga0209068_10500213 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300027905|Ga0209415_10971517 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300028536|Ga0137415_10371515 | Not Available | 1234 | Open in IMG/M |
| 3300028536|Ga0137415_10549299 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300029636|Ga0222749_10253482 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300031573|Ga0310915_10121291 | All Organisms → cellular organisms → Bacteria | 1785 | Open in IMG/M |
| 3300031682|Ga0318560_10480979 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300031708|Ga0310686_102242536 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300031719|Ga0306917_10028070 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3575 | Open in IMG/M |
| 3300031769|Ga0318526_10344421 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300031770|Ga0318521_10584964 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300031771|Ga0318546_11268211 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300031779|Ga0318566_10590512 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300031896|Ga0318551_10913571 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300031912|Ga0306921_12181904 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300031981|Ga0318531_10448892 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300032043|Ga0318556_10294841 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300032059|Ga0318533_10618177 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300032828|Ga0335080_10089894 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3406 | Open in IMG/M |
| 3300032955|Ga0335076_10021354 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6506 | Open in IMG/M |
| 3300033480|Ga0316620_12420529 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 23.01% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 22.12% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 5.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.31% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.31% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.42% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.42% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.42% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.54% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.54% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.65% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.77% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.77% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.77% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.77% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.89% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.89% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.89% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
| 3300002915 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009618 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100 | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014153 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaG | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022708 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023259 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300027039 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 14 (SPAdes) | Environmental | Open in IMG/M |
| 3300027109 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008 (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A100DRAFT_10395532 | 3300000655 | Forest Soil | MIWAAIRWVLLMFLIAPVMEAPLVAHLSDPIKPIKSW |
| JGI12630J15595_101087022 | 3300001545 | Forest Soil | MRQPLFVAWAAIRWVPLMFLIAPAMEAPLVALKSEPVKPIK |
| JGI12635J15846_107611942 | 3300001593 | Forest Soil | MRRPLFFIWAALRWVPLMFLIAPAMEAPLVAHRSDPPKPIKT |
| JGI12627J18819_100537693 | 3300001867 | Forest Soil | MIWAAVRWLPLMFLVAQGLEAPLVAHSGQPLKPIRVW |
| JGIcombinedJ26739_1011761092 | 3300002245 | Forest Soil | MRRPLFFIWAALRWVPLMFLIAPAMEAPLVAHRSDP |
| JGI25613J43889_101420711 | 3300002907 | Grasslands Soil | MSWAALRWVLLMFLVAPGMEAPLVAHLNQPVKPIKTWVGN |
| JGI25387J43893_10749072 | 3300002915 | Grasslands Soil | MMWAALRWVALMFLIAPAMEAPLVAHLNQPVRPIKTWVGNSSW |
| JGI25616J43925_102994351 | 3300002917 | Grasslands Soil | MSWAALRWVLLMFLIAPGMEAPLVAHLNQPVKPIKTWVGNSS |
| Ga0062387_1010250612 | 3300004091 | Bog Forest Soil | MRRPLFFLWAAIRWVPLMFLIAPAMEAPLVAHLSDPPKPIKTW |
| Ga0070710_101175853 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRPLFFVWAALRWVPLMFLIAPAMEAPLVAHRSDPPKPIKTWVG |
| Ga0070708_1005555792 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MRNRLFVIWAALRWVPLLFLIAPAMEAPLVAHLSQPHKAIKAWT |
| Ga0070741_111805482 | 3300005529 | Surface Soil | MIWAALRWVPLMFLIAPAMEAPLVAHLNEPVKPIKTWVG |
| Ga0070731_100791873 | 3300005538 | Surface Soil | MRRPLFVFWAAFRWVLLMFLIVPVMDAPLVAHLSAPVKPIKTW |
| Ga0066693_100722261 | 3300005566 | Soil | MIWAAFRWVLLMFLIAPVMEAPLVAHLNQPVKPIKT |
| Ga0075028_1010446771 | 3300006050 | Watersheds | MRRRLFIVWAALRWLPLMFLVAQGLEAPLVAHVSQPVKPIRVWTAKT |
| Ga0075017_1008943231 | 3300006059 | Watersheds | MIWAALRWVPLMFLVAQGLEAPLVAHVSQPLKPIRVWTAK |
| Ga0075017_1012003681 | 3300006059 | Watersheds | MRRPLFMTWAAIRWVPLMFLVAPVMEAPLVAHLSAPVKPIKTWV |
| Ga0075019_107433982 | 3300006086 | Watersheds | MRRRLFMIWAAIRWVPLMFLMAQGLEAPLVAHTSQPIKPIRVWS |
| Ga0075018_107452312 | 3300006172 | Watersheds | MIWAALRWLPLMFLVAQGLEAPLVAHVSQPLKPIRVWTAKT |
| Ga0099795_100947322 | 3300007788 | Vadose Zone Soil | MRNRLFVIWAALRWVPLMFVIAPAMEAPLVAHLSE |
| Ga0066710_1016878271 | 3300009012 | Grasslands Soil | MSWAALRWVLLMFLVAPGMEAPLVAHLNQPVKPIKTW |
| Ga0099828_103481803 | 3300009089 | Vadose Zone Soil | MRSKLFMIWAATRWLLLMFLIAPGLEAPLVAHSSEPVKPLKVWMGLA |
| Ga0105237_117414301 | 3300009545 | Corn Rhizosphere | MIWAAVRWVPLMFLIAPVMEAPLVAYKTEPVKPIKTWVG |
| Ga0116127_10907161 | 3300009618 | Peatland | MLQAKHTIRQTLFMSWAAFRWLALMFVIAPVVEAPLVAHLSEPVRP |
| Ga0116134_13403081 | 3300009764 | Peatland | MRRPLFVTWAAIRWVPLMFLIAPVMEAPLVAHLSEPVKPMKVW |
| Ga0126380_119750081 | 3300010043 | Tropical Forest Soil | MVWAAVRWVPLMFLIAPAMEAPLVAHRSEPAKPIKT |
| Ga0126370_111738271 | 3300010358 | Tropical Forest Soil | MIWAAVRWVPLMFLIAPVMEAPLVAYRTEPASPIKT |
| Ga0136449_1003140694 | 3300010379 | Peatlands Soil | MVWAALRWLPLMFLVAQGLEAPLVAHVSQPLKPIRVW |
| Ga0137393_105003671 | 3300011271 | Vadose Zone Soil | MKRPLFMIWAAIRWVPLMFLIAPVMEAPLVAYKTEQAKPIKTWV |
| Ga0137389_110190802 | 3300012096 | Vadose Zone Soil | MWHRLDIMRNRLLVPWAAIRWVLLMFLVAQGLQAPLVAHPSEPIK |
| Ga0137383_102411622 | 3300012199 | Vadose Zone Soil | MRRRLFMIWAALRWLPLMFVVAQGLEAPLVAHSNQPIKPIRVWSGR |
| Ga0137382_110252851 | 3300012200 | Vadose Zone Soil | MKRPLFMIWAAVRWVPLMFLIAPVMEAPLVAYKTEPAKPIKTW |
| Ga0137363_114117971 | 3300012202 | Vadose Zone Soil | MIWAAIRWVPLMFLIAPAMEAPLVAHLSEPVRPIKSWVGNASW |
| Ga0137380_102654931 | 3300012206 | Vadose Zone Soil | MKRPLFMIWAAVRWVPLMFLIAPVMEAPLVAYKTEPAKPIKTWVG |
| Ga0137377_110758362 | 3300012211 | Vadose Zone Soil | MRRRLFMIWAALRWLPLMFVVAQGLEAPLVAHPSQPIKP |
| Ga0137390_113693441 | 3300012363 | Vadose Zone Soil | MRNRLFVIWAALRWVLLMFLAPPAMEAPLVAHLSEPPKAIKAW |
| Ga0137398_101789771 | 3300012683 | Vadose Zone Soil | MVWAAIRWLPLMFLVAQGLEAPLVAHVSQPLKPIR |
| Ga0137396_113084302 | 3300012918 | Vadose Zone Soil | MIWAALRWLPLMFVVAQGLEAPLVAHPSQPIKPIRVWSGR |
| Ga0137416_106687252 | 3300012927 | Vadose Zone Soil | MSWAALRWVLLMFLVAPGMEAPLVAHLNQPVKPIK |
| Ga0181527_10588831 | 3300014153 | Bog | MQRPLFIAWAAIRWVPLMFLIAPVMEAPLVAHLSEP |
| Ga0137405_12717772 | 3300015053 | Vadose Zone Soil | MIWAALRWVPLMFLIAPAMEAPLVAHLNQPVKPIKTWR |
| Ga0182035_105388372 | 3300016341 | Soil | MRRPLFVAWAAIRWVPLMFLIAPAMEAPLVALKSEPVKPIKVW |
| Ga0182034_114444411 | 3300016371 | Soil | MTWAAIRWVPLMFLICPAMEAPLVAHLSAPVKPIKTWVGN |
| Ga0182037_112013331 | 3300016404 | Soil | MTWAAIRWVPLMFLICPVMEAPLVAHLSKPVKPIKSWVGNAS |
| Ga0182039_101632173 | 3300016422 | Soil | MIWAAVRWLPLMFLVAPVMEAPLVAYKTEPIKPIKT |
| Ga0187818_102078942 | 3300017823 | Freshwater Sediment | MIWAALRWVPLMFLIAPAMEAPLVAHLNRPVKPIK |
| Ga0187825_104233931 | 3300017930 | Freshwater Sediment | MRRRLFVIWAALRWLPLMFLIAQGLEAPLVAHPSSAATPIRA |
| Ga0187814_101814821 | 3300017932 | Freshwater Sediment | MRRPLFFIWAAIRWVPLMFLICPAMEAPLVAHLSAPVKPMKTWV |
| Ga0187779_107454461 | 3300017959 | Tropical Peatland | MSWAAVRWVLLMFLFAQGMEAPLVAHLSQPVKPIKTWVGNS |
| Ga0187783_110924581 | 3300017970 | Tropical Peatland | MRKPLFMIWAAIRWVPLMFLIAPGIEAPLVAHLSTPVKP |
| Ga0187780_100763625 | 3300017973 | Tropical Peatland | MQRPLFIAWAAIRWVPLMFLIAPVMEAPLVAHLSEPV |
| Ga0187810_102111032 | 3300018012 | Freshwater Sediment | MQRPLFIAWAAIRWVPLMFLFAPVMEAPLVAHLSEPVKPI |
| Ga0187875_101531231 | 3300018035 | Peatland | MRSRRFMIWAALRWLPLMFLVAQGLQAPLVAHPGKPIRPLRT |
| Ga0187784_104583651 | 3300018062 | Tropical Peatland | MQRPLFIAWAAIRWVPLMFLIAPVMEAPLVAHLSEPVKPLKVW |
| Ga0187770_105185181 | 3300018090 | Tropical Peatland | MQRPLFIAWAAIRWVPLMFLIAPVMGAPLVAHLSEPVKPLKVWRG |
| Ga0066655_101884151 | 3300018431 | Grasslands Soil | MIWAALRWVLLMFLIAPVMEAPLVAHLNQPMKPVKSWV |
| Ga0137408_10531772 | 3300019789 | Vadose Zone Soil | MIWAAVRWVPLMFLIAPAMEAPLVAHRSEPAKPIK |
| Ga0179590_10823532 | 3300020140 | Vadose Zone Soil | MRKPLFMIWAALRWVPLMFLIAPVMEAPLVAHLSEPIKPIKSWV |
| Ga0210403_106892331 | 3300020580 | Soil | MSWAALRWVLLMFLIAPAMEAPLVAHLSKPVKPIKTWVGNS |
| Ga0210399_103596572 | 3300020581 | Soil | MRRPLFVAWAAIRWVPLMFLIAPAMEAPLVALKSEPVKPLKVWVGNA |
| Ga0210399_108895302 | 3300020581 | Soil | MIWAALRWVPLLFLIAPAMEAPLVANLSQPVKPIKAWVGNASW |
| Ga0210383_104267032 | 3300021407 | Soil | MVWAAFRWLPLMFLVTPGLEAPLVAHTSQPLKPLRTWTAKTS |
| Ga0210394_105933661 | 3300021420 | Soil | MRRRLFMVWAALRWLPLMFLVAQGLEAPLVAHVSQPLKPIRV |
| Ga0210394_106708892 | 3300021420 | Soil | MIWAAVRWVPLMFLIAPVMEAPLVAYKTEQSKPIKT |
| Ga0210390_100487314 | 3300021474 | Soil | MIWAAIRWVPLMFLIAPGIEAPLVAHLSAPVKPIK |
| Ga0210398_105407871 | 3300021477 | Soil | MIWAALRWVPLMFLIAPAMEAPLVAHRSDPPKPIKTWVG |
| Ga0210402_118454352 | 3300021478 | Soil | MSWAALRWVLLMFLIAPAMEAPLVAHLSQPVKPIKTWVGSSS |
| Ga0210410_111203512 | 3300021479 | Soil | MIWAALRWVPLMFLIAPAMEAPLVANLSQPVKPIKAWV |
| Ga0210410_118131421 | 3300021479 | Soil | MRHRLLMSWAALRWVLLMFLVAPAMEAPLVAHLNQPVKP |
| Ga0210409_100344521 | 3300021559 | Soil | MRRPLFVAWAAIRWVPLMFLIAPAMEAPLVALKSEPVKPIKVWVG |
| Ga0242660_11609292 | 3300022531 | Soil | MSWAALRWVLLMFLIAPGMEAPLVAHLNQPVKPIKTW |
| Ga0242670_10398402 | 3300022708 | Soil | MRRPLFVAWAAIRWVPLMFLIAPAMEAPLVALKSEPVKP |
| Ga0224551_10122673 | 3300023259 | Soil | MRRPFFVLWAAIRWVPLMFLIAPVMEAPLVAHLSDPPKPIKT |
| Ga0179589_104690232 | 3300024288 | Vadose Zone Soil | MRRRIFMIWAALRWVPLMFLLAQGLEAPLVAHPTQPIKPIKT |
| Ga0207685_100815531 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MRNRLFVIWAALRWVPLMFLIAPAMEAPLVAHLSQPPKAIKAWVG |
| Ga0207684_110952952 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MIWAAIRWVPLMFLIAPVMEAPLVAYKTEPVKPIKTWVG |
| Ga0207700_100076811 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKPLFMIWAAVRWVPLMFLIAPVMEAPLVAYKTEPAKPLKTWV |
| Ga0209863_100535532 | 3300026281 | Prmafrost Soil | MIWAALRWVPLMFLIAPVMEAPLVAHLSDPPKPIKTWVGN |
| Ga0209690_11270582 | 3300026524 | Soil | MIWAAFRWVLLMFLIAPVMEAPLVAHLSQPAKPIKTWAGNAS |
| Ga0207855_10296291 | 3300027039 | Tropical Forest Soil | MTWAAIRWVPLMFLISPAMEAPLVAHLSDPVKPLKVWV |
| Ga0208603_10246222 | 3300027109 | Forest Soil | MSWAALRWVLLMFLVAPAMEAPLVAHLNQPVKPIKTWVGN |
| Ga0209331_11538682 | 3300027603 | Forest Soil | MMWAALRWFPLMFLIAPAMEAPLVAHLNQPRKPIKT |
| Ga0209076_11024652 | 3300027643 | Vadose Zone Soil | MRNRLFVIWAALRWVLLMFLVPPAMEAPLVAHLSQPP |
| Ga0209588_12323972 | 3300027671 | Vadose Zone Soil | MSWAALRWVLLMFLVAPGMEAPLVAHLNQPVKPIKTWVGNS |
| Ga0209248_101739011 | 3300027729 | Bog Forest Soil | MKRPLFFIWAAIRWVPLMFLVAPVMEAPLVAHLSEPV |
| Ga0209038_100585231 | 3300027737 | Bog Forest Soil | MRKPLFMIWAALRWVPLMFLIAPVMEAPLVAHLSEPVKPI |
| Ga0209139_100833433 | 3300027795 | Bog Forest Soil | MRRPLFIAWAAIRWVPLMFLIAPGMEAPLVAHLTEPAKQIKTW |
| Ga0209180_101960801 | 3300027846 | Vadose Zone Soil | MIWAALRWVPLMFLIAPAMEAPLVAHLSKPVKPVKTWVGN |
| Ga0209180_103638551 | 3300027846 | Vadose Zone Soil | MIWAALRWIPLMFLIAPVMEAPLVAHLSQPVKPIKTWVG |
| Ga0209180_105070832 | 3300027846 | Vadose Zone Soil | MRTRLFFTWAAFRWMLLMFVIAPVLEAPLVAHPSEPVKPIRVWLG |
| Ga0209701_101298643 | 3300027862 | Vadose Zone Soil | MSWAALRWVLLMFLVAPGMEAPLVAHLNQPVKPIKTWV |
| Ga0209590_103391341 | 3300027882 | Vadose Zone Soil | MIWAALRWVLLMFLIAPAMEAPLVAHLSQPVKPIKSWVGNAS |
| Ga0209068_105002131 | 3300027894 | Watersheds | MRRRLFMIWAALRWVPLMFLVAQGLEAPLVAHSGQPIKPIRVWTGRA |
| Ga0209415_109715171 | 3300027905 | Peatlands Soil | MRRRLFMVWAALRWVPLMFLVAQGLEAPLVAHVSQPL |
| Ga0137415_103715152 | 3300028536 | Vadose Zone Soil | MRRRLFIVWAALRWLPLMFLLAQGLEAPLVAHISQPLKPI |
| Ga0137415_105492992 | 3300028536 | Vadose Zone Soil | MSWAALRWVLLMFLVAPGMEAPLVAHLNQPVKPIKTWVG |
| Ga0222749_102534822 | 3300029636 | Soil | MFWAALRWVPLMFLIAPAMEAPLVAHLNQPAKPIK |
| Ga0310915_101212911 | 3300031573 | Soil | MTWAAIRWLPLMFLISPAMEAPLVAHLSDPVKPLKV |
| Ga0318560_104809792 | 3300031682 | Soil | MTWAAIRWVPLMFLICPVMEAPLVAHLSAPVKPIKTWVGN |
| Ga0310686_1022425362 | 3300031708 | Soil | MRRRLFMIWAALRWLPLMFLVAQGLEAPLVAHVSQPLKP |
| Ga0306917_100280701 | 3300031719 | Soil | MTWAAIRWLPLMFLVSPAMEAPLVAHLSDPVKPLKV |
| Ga0318526_103444212 | 3300031769 | Soil | MRRPLFMTWAAIRWVPLMFLISPAMEAPLVAHLSDPVKPLKVW |
| Ga0318521_105849641 | 3300031770 | Soil | MTWAAIRWLPLMFLVSPAMEAPLVAHLSDPVKPLKVWVGN |
| Ga0318546_112682111 | 3300031771 | Soil | MTWAAIRWLPLMFLISPAMEAPLVAHLKDPVKPLK |
| Ga0318566_105905121 | 3300031779 | Soil | MRRPFFMTWAAIRWLPLMFLVSPAMEAPLVAHLSDPVK |
| Ga0318551_109135711 | 3300031896 | Soil | MTWAAIRWVPLMFLICPVMEAPLVAHLSKPVKPIKSWV |
| Ga0306921_121819041 | 3300031912 | Soil | MRRPFFMTWAAVRWLPLMFLVSPAMEAPLVAHLSDPVKPLKVWV |
| Ga0318531_104488922 | 3300031981 | Soil | MIWAAFRWVLLMFLIAPAMEAPLVAHLSQPIKPIKSWTGNAS |
| Ga0318556_102948411 | 3300032043 | Soil | MIWAAFRWVLLMFLIAPVMEAPLVAHLSQPAKPIKAWTGN |
| Ga0318533_106181772 | 3300032059 | Soil | MTWAAIRWVPLMFLVAPVMEAPLVAHLSAPVKPIKVWVGNASW |
| Ga0335080_100898944 | 3300032828 | Soil | MRKPLFMTWAAIRWVPLMFLICPAMEAPLVAHLSAPVKPIKAW |
| Ga0335076_100213541 | 3300032955 | Soil | MIWAAIRWIPLMFLIAPGIEAPLVAHLSAPVQPIKVWVGNASW |
| Ga0316620_124205291 | 3300033480 | Soil | MKRPLFIFWAAFRWVLLMFLIVPVMDAPLVAHLSA |
| ⦗Top⦘ |