


| Basic Information | |
|---|---|
| Family ID | F083179 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 40 residues |
| Representative Sequence | EAAAKLKEAAASPKKSALLLLNRRGVTQYVGVNLSANQG |
| Number of Associated Samples | 98 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.89 % |
| % of genes near scaffold ends (potentially truncated) | 98.23 % |
| % of genes from short scaffolds (< 2000 bps) | 89.38 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.26 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (81.416 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (31.858 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.973 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.212 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 19.40% β-sheet: 17.91% Coil/Unstructured: 62.69% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.26 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF02913 | FAD-oxidase_C | 24.78 |
| PF01264 | Chorismate_synt | 4.42 |
| PF02775 | TPP_enzyme_C | 2.65 |
| PF13551 | HTH_29 | 0.88 |
| PF00496 | SBP_bac_5 | 0.88 |
| PF00471 | Ribosomal_L33 | 0.88 |
| PF03989 | DNA_gyraseA_C | 0.88 |
| PF01053 | Cys_Met_Meta_PP | 0.88 |
| PF01370 | Epimerase | 0.88 |
| PF00890 | FAD_binding_2 | 0.88 |
| PF13358 | DDE_3 | 0.88 |
| PF12833 | HTH_18 | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 24.78 |
| COG0082 | Chorismate synthase | Amino acid transport and metabolism [E] | 4.42 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.88 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.88 |
| COG0188 | DNA gyrase/topoisomerase IV, subunit A | Replication, recombination and repair [L] | 0.88 |
| COG0267 | Ribosomal protein L33 | Translation, ribosomal structure and biogenesis [J] | 0.88 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.88 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.88 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.88 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.88 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.88 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.88 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.88 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.88 |
| COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 81.42 % |
| Unclassified | root | N/A | 18.58 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001867|JGI12627J18819_10164231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 902 | Open in IMG/M |
| 3300004082|Ga0062384_101051582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 585 | Open in IMG/M |
| 3300004082|Ga0062384_101249799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 541 | Open in IMG/M |
| 3300004114|Ga0062593_101469138 | Not Available | 732 | Open in IMG/M |
| 3300005332|Ga0066388_108430362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 513 | Open in IMG/M |
| 3300005451|Ga0066681_10717328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 608 | Open in IMG/M |
| 3300005537|Ga0070730_10694778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 645 | Open in IMG/M |
| 3300005764|Ga0066903_101524727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1263 | Open in IMG/M |
| 3300006028|Ga0070717_11880893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 540 | Open in IMG/M |
| 3300006046|Ga0066652_101577623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 605 | Open in IMG/M |
| 3300006172|Ga0075018_10780371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 522 | Open in IMG/M |
| 3300006173|Ga0070716_101529476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 546 | Open in IMG/M |
| 3300006796|Ga0066665_10485145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1015 | Open in IMG/M |
| 3300006804|Ga0079221_11549365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 534 | Open in IMG/M |
| 3300007265|Ga0099794_10799568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 504 | Open in IMG/M |
| 3300009088|Ga0099830_10410102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1096 | Open in IMG/M |
| 3300009088|Ga0099830_11078909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 666 | Open in IMG/M |
| 3300009090|Ga0099827_11733917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 544 | Open in IMG/M |
| 3300010048|Ga0126373_11112626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 856 | Open in IMG/M |
| 3300010048|Ga0126373_12328421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 596 | Open in IMG/M |
| 3300010048|Ga0126373_12873406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 537 | Open in IMG/M |
| 3300010154|Ga0127503_10957874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 580 | Open in IMG/M |
| 3300010358|Ga0126370_12546157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 511 | Open in IMG/M |
| 3300010361|Ga0126378_11342937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 809 | Open in IMG/M |
| 3300011120|Ga0150983_15089863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1118 | Open in IMG/M |
| 3300011269|Ga0137392_10392180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1152 | Open in IMG/M |
| 3300012203|Ga0137399_11782306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 504 | Open in IMG/M |
| 3300012212|Ga0150985_104849460 | Not Available | 585 | Open in IMG/M |
| 3300012285|Ga0137370_10573496 | Not Available | 695 | Open in IMG/M |
| 3300012285|Ga0137370_10635280 | Not Available | 662 | Open in IMG/M |
| 3300012359|Ga0137385_10717363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 834 | Open in IMG/M |
| 3300014654|Ga0181525_10024688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3669 | Open in IMG/M |
| 3300016294|Ga0182041_10142308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1837 | Open in IMG/M |
| 3300016319|Ga0182033_11394710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodobiaceae → unclassified Rhodobiaceae → Rhodobiaceae bacterium | 631 | Open in IMG/M |
| 3300016371|Ga0182034_10975076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 731 | Open in IMG/M |
| 3300016404|Ga0182037_11522429 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 594 | Open in IMG/M |
| 3300016422|Ga0182039_10298132 | Not Available | 1334 | Open in IMG/M |
| 3300016445|Ga0182038_10948758 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 760 | Open in IMG/M |
| 3300018085|Ga0187772_11125767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 576 | Open in IMG/M |
| 3300020579|Ga0210407_10296414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1262 | Open in IMG/M |
| 3300020580|Ga0210403_10790181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 755 | Open in IMG/M |
| 3300020580|Ga0210403_11365523 | Not Available | 538 | Open in IMG/M |
| 3300021170|Ga0210400_10087233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum | 2458 | Open in IMG/M |
| 3300021171|Ga0210405_10248608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1407 | Open in IMG/M |
| 3300021384|Ga0213876_10465404 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 673 | Open in IMG/M |
| 3300021405|Ga0210387_11229968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 649 | Open in IMG/M |
| 3300021406|Ga0210386_11374705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 592 | Open in IMG/M |
| 3300021441|Ga0213871_10129031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 758 | Open in IMG/M |
| 3300021479|Ga0210410_11438218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 582 | Open in IMG/M |
| 3300021559|Ga0210409_10183442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1910 | Open in IMG/M |
| 3300021560|Ga0126371_13732267 | Not Available | 513 | Open in IMG/M |
| 3300022508|Ga0222728_1010118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1213 | Open in IMG/M |
| 3300022512|Ga0242676_1039665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 559 | Open in IMG/M |
| 3300022530|Ga0242658_1041372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 939 | Open in IMG/M |
| 3300025898|Ga0207692_10158033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1304 | Open in IMG/M |
| 3300025921|Ga0207652_11763277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 524 | Open in IMG/M |
| 3300025928|Ga0207700_11626004 | Not Available | 571 | Open in IMG/M |
| 3300026023|Ga0207677_10506142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1045 | Open in IMG/M |
| 3300026498|Ga0257156_1117970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 552 | Open in IMG/M |
| 3300027104|Ga0208095_1003731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1022 | Open in IMG/M |
| 3300027376|Ga0209004_1005574 | All Organisms → cellular organisms → Bacteria | 1722 | Open in IMG/M |
| 3300027701|Ga0209447_10088065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 853 | Open in IMG/M |
| 3300027701|Ga0209447_10088949 | Not Available | 848 | Open in IMG/M |
| 3300027767|Ga0209655_10158168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 749 | Open in IMG/M |
| 3300027882|Ga0209590_10784118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 606 | Open in IMG/M |
| 3300028747|Ga0302219_10118739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1005 | Open in IMG/M |
| 3300028906|Ga0308309_10218845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1578 | Open in IMG/M |
| 3300029636|Ga0222749_10476620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 672 | Open in IMG/M |
| 3300030532|Ga0210290_1530308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 642 | Open in IMG/M |
| 3300030659|Ga0316363_10415223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 521 | Open in IMG/M |
| 3300030743|Ga0265461_11812458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 684 | Open in IMG/M |
| 3300031058|Ga0308189_10219755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 700 | Open in IMG/M |
| 3300031090|Ga0265760_10166003 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300031231|Ga0170824_102974103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 785 | Open in IMG/M |
| 3300031231|Ga0170824_105663182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 640 | Open in IMG/M |
| 3300031236|Ga0302324_101398988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 916 | Open in IMG/M |
| 3300031469|Ga0170819_12847359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 686 | Open in IMG/M |
| 3300031545|Ga0318541_10855922 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300031595|Ga0265313_10416991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 525 | Open in IMG/M |
| 3300031679|Ga0318561_10027455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2718 | Open in IMG/M |
| 3300031679|Ga0318561_10034007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2479 | Open in IMG/M |
| 3300031679|Ga0318561_10809875 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300031724|Ga0318500_10223156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 908 | Open in IMG/M |
| 3300031747|Ga0318502_10978893 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300031763|Ga0318537_10203721 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 736 | Open in IMG/M |
| 3300031771|Ga0318546_11353222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 500 | Open in IMG/M |
| 3300031781|Ga0318547_10330350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 929 | Open in IMG/M |
| 3300031792|Ga0318529_10146439 | Not Available | 1085 | Open in IMG/M |
| 3300031793|Ga0318548_10489985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 601 | Open in IMG/M |
| 3300031819|Ga0318568_10205933 | Not Available | 1214 | Open in IMG/M |
| 3300031879|Ga0306919_10021795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3892 | Open in IMG/M |
| 3300031879|Ga0306919_10246078 | Not Available | 1344 | Open in IMG/M |
| 3300031879|Ga0306919_10336624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1151 | Open in IMG/M |
| 3300031879|Ga0306919_10535616 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 903 | Open in IMG/M |
| 3300031890|Ga0306925_10799840 | Not Available | 978 | Open in IMG/M |
| 3300031910|Ga0306923_10411782 | Not Available | 1537 | Open in IMG/M |
| 3300031912|Ga0306921_10028415 | Not Available | 6211 | Open in IMG/M |
| 3300031946|Ga0310910_10240609 | Not Available | 1413 | Open in IMG/M |
| 3300031954|Ga0306926_10051083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 4947 | Open in IMG/M |
| 3300032001|Ga0306922_10188972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2209 | Open in IMG/M |
| 3300032041|Ga0318549_10012396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3030 | Open in IMG/M |
| 3300032064|Ga0318510_10114960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1037 | Open in IMG/M |
| 3300032064|Ga0318510_10232983 | Not Available | 752 | Open in IMG/M |
| 3300032066|Ga0318514_10591252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 591 | Open in IMG/M |
| 3300032068|Ga0318553_10022048 | Not Available | 2976 | Open in IMG/M |
| 3300032068|Ga0318553_10214404 | Not Available | 1004 | Open in IMG/M |
| 3300032160|Ga0311301_11699685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 760 | Open in IMG/M |
| 3300032205|Ga0307472_100357364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1202 | Open in IMG/M |
| 3300032515|Ga0348332_11625839 | Not Available | 636 | Open in IMG/M |
| 3300032955|Ga0335076_11488377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 564 | Open in IMG/M |
| 3300033290|Ga0318519_10027335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2646 | Open in IMG/M |
| 3300033486|Ga0316624_11005169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 752 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 31.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.27% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.31% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.42% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.54% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.65% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.65% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.77% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.77% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.77% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.89% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.89% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.89% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.89% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.89% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.89% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.89% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.89% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.89% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.89% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.89% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Host-Associated | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022508 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022512 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
| 3300027104 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF024 (SPAdes) | Environmental | Open in IMG/M |
| 3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030532 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE108SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Host-Associated | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| 3300034644 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_123 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12627J18819_101642311 | 3300001867 | Forest Soil | QQPVKTPQEAAEKLKEAAASPKKSALLLLNRRGVTQYVGVNLSTNQG* |
| Ga0062384_1010515821 | 3300004082 | Bog Forest Soil | TPQEAAEKLKEVAASPKKSALLLLNRHGVTQYVGVNLGGNSG* |
| Ga0062384_1012497992 | 3300004082 | Bog Forest Soil | SPEEAAQQLKEIANSPKKTALLLLNRHGVTQYLGVKLSKDEG* |
| Ga0062593_1014691382 | 3300004114 | Soil | AQDAAQLLRDASKGAKKTALLLLNRRGVTRYVGVDLGANNKG* |
| Ga0066388_1084303621 | 3300005332 | Tropical Forest Soil | KTPEEAAAKLKEIAASPKKSALLLLNRRGVTQYVGVNLGANQG* |
| Ga0066681_107173281 | 3300005451 | Soil | EAAQKLKEIANSPRKTALLLLNRHGTTQYVGLDLSKNEG* |
| Ga0070730_106947781 | 3300005537 | Surface Soil | EAADRLKEIASSPNKTALLLLNRHGVTQYLGVEIGRNQG* |
| Ga0066903_1015247272 | 3300005764 | Tropical Forest Soil | AAKLKEIAASPKKSALLLLNRRGITQYVGVNLGANQG* |
| Ga0070717_118808931 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | QQPVKTPQEAAAKLKDVASSPKKSALLLLNRRGVTQYVGVGLGNQG* |
| Ga0066652_1015776231 | 3300006046 | Soil | PVGTPQETAQKLKEIANSSRKSALLLLNRHGTTQYVGLDLSKNEG* |
| Ga0075018_107803712 | 3300006172 | Watersheds | TPQEAAAKLKEAAASPKKSALLLLNRHGVTQYVGLNLSANQG* |
| Ga0070716_1015294761 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | QEAAAKLKEVGASPKKSALLLLNRHGVTQYVGVTPGGNQG* |
| Ga0066665_104851451 | 3300006796 | Soil | QPINTPQEAAAKLKEVAASPKKSALLLLNRHGVTQYVGVSLAGNQG* |
| Ga0079221_115493651 | 3300006804 | Agricultural Soil | DQQSVKTPQEAAAKLKEAAASSKKSALLLLNRRGATQYVGLNLAANQG* |
| Ga0099794_107995682 | 3300007265 | Vadose Zone Soil | QEAAAKLKEVGASPKKSALLLLNRHGVTQYVGVAPGGNQG* |
| Ga0099830_104101022 | 3300009088 | Vadose Zone Soil | GSPAEAAQQLKEIANSPKKTALLLLNRHGVTQYIGVKLSKDEG* |
| Ga0099830_110789091 | 3300009088 | Vadose Zone Soil | SKLKEIAASPKKSALLLLNRHGVTQYVGVSLGEDRG* |
| Ga0099827_117339172 | 3300009090 | Vadose Zone Soil | QLKEIANSPKKTALLLLNRHGVTQYVGVKRSKDEG* |
| Ga0126373_111126261 | 3300010048 | Tropical Forest Soil | AAQQLKEIAASKKSALLLLNRHGVTQYVGVSLGENRG* |
| Ga0126373_123284212 | 3300010048 | Tropical Forest Soil | TPEEAAEKLKEVANSPKKSTLLLLNRHGVTQYVGVNLGGNNG* |
| Ga0126373_128734061 | 3300010048 | Tropical Forest Soil | PIGSPKEAADRLRNIAKSPNKSALLLLNRRGVTQYLGVQLDKNQG* |
| Ga0127503_109578741 | 3300010154 | Soil | KSPQEAAAKLKEVGASPKKSALLLLNRHGVTQYVGVTPSGNQG* |
| Ga0126370_125461571 | 3300010358 | Tropical Forest Soil | AAKLKEIAASPKKSALLLLNRRGVTQYVGVNLGANQG* |
| Ga0126378_113429372 | 3300010361 | Tropical Forest Soil | IDQQPVNTPQEAAAKLKEIAASPKKSALLLLNRRGITQYVGVNLGANQG* |
| Ga0150983_150898631 | 3300011120 | Forest Soil | NTPQEAAAILKEIAASPKKSALLLLNRRGVTQYVGVSLGDYRG* |
| Ga0137392_103921803 | 3300011269 | Vadose Zone Soil | PAEAAQQLREIAKSQKKTALLLLNRHGVTQYVGVNLGKDQG* |
| Ga0137399_117823062 | 3300012203 | Vadose Zone Soil | QPVRNPVEAAQQLTEIANSPKKTALLLLNRHGVTQYLGVKLSKDEG* |
| Ga0150985_1048494601 | 3300012212 | Avena Fatua Rhizosphere | PQEAAQKLKEIANSSRKSALLLLNRHGTTQYVGLDLSKNEG* |
| Ga0137370_105734962 | 3300012285 | Vadose Zone Soil | VGTPQEAAQKLKEIANSPRKTALLLLNRHGTTQYVGLDLSKNEG* |
| Ga0137370_106352801 | 3300012285 | Vadose Zone Soil | AAQKLKEAASSPRKSALLLLNRHGVTQYVGLDLGKNEG* |
| Ga0137385_107173631 | 3300012359 | Vadose Zone Soil | AQQLKEIANSPKKTALLLLNRHGVTQYVGVKLSKDEG* |
| Ga0181525_100246884 | 3300014654 | Bog | SSPQQAADKLRDIANSSNKSALLLLNRHGVTQYLGVELGKNQG* |
| Ga0182041_101423081 | 3300016294 | Soil | AADQLKEIAASKKSALLLLNRHGVTQYVGVSLGENRG |
| Ga0182033_113947102 | 3300016319 | Soil | AAKLNEVSKSSKKSALLLLNRHGVTQYVGVNLGGNNG |
| Ga0182034_109750762 | 3300016371 | Soil | VKTPQEAGVKLKEAAAAPKKSVLLLLNRRGVTQYVGINLGANQG |
| Ga0182037_115224291 | 3300016404 | Soil | EAAEKLKEVANSPKKSALLLLNRHGVTQYVGVNLGGSNG |
| Ga0182039_102981322 | 3300016422 | Soil | NSPQEAAEKLKEVAASPKKSALLLLNRHGVMQYVGVSLGGNSG |
| Ga0182038_109487581 | 3300016445 | Soil | EAAEKLKEVANSPKKSALLLLNRHGVTQYVGVNLGGNNG |
| Ga0187772_111257672 | 3300018085 | Tropical Peatland | DQKPVSTPQEAAQQLKEMAASKKSALLLLNRRGVTQYVGVSLGENRG |
| Ga0210407_102964142 | 3300020579 | Soil | KLKEAASSPKKSALLLLNRRGVTQYVGVNLSANQG |
| Ga0210403_107901812 | 3300020580 | Soil | SPQEAAAKLKEIAASPKKSALLLLNRHGVTQYVGVSLGEDRG |
| Ga0210403_113655231 | 3300020580 | Soil | AAKLKEIAASPKRSALILLNRRGITEYVGVTLGGNQG |
| Ga0210400_100872331 | 3300021170 | Soil | AAGKLKEIAASSKKSALLLLNRHGVTQYVGVSLGENRG |
| Ga0210405_102486081 | 3300021171 | Soil | VAKLKEAASSPKKSALLLLNRRGVTQYVGVNLSANQG |
| Ga0213876_104654041 | 3300021384 | Plant Roots | QMLRDAAKTPKKSALLLLNRRGVTRYVGLDLGRNQG |
| Ga0210387_112299681 | 3300021405 | Soil | AKLKEAASSPKKSALLLLNRHGVTQYVGVNLSANQG |
| Ga0210386_113747052 | 3300021406 | Soil | AAAKLKEAAASPKKSALLLLNRRGVTQYVGVNLSTNQG |
| Ga0213871_101290311 | 3300021441 | Rhizosphere | PEEAAAKLKGAAASPKKSALLLLNRRGVTQYVGLNLSTDQG |
| Ga0210410_114382181 | 3300021479 | Soil | VKTPQEAAAKLKEAAASPKKSALLLLNRHGTTQYVGVNLSANQG |
| Ga0210409_101834421 | 3300021559 | Soil | QEAAGKLTEIAGSTKKSALLLLNRHGVTQYVGVSLGENRG |
| Ga0126371_137322671 | 3300021560 | Tropical Forest Soil | SPQEAAQKLDEVVKSRQKTALLLLNRYGVEHYVGVDLEKNEG |
| Ga0222728_10101181 | 3300022508 | Soil | QEAAAKLKEAAASPKKSALLLLNRRGVTQYVGVNLSTNQG |
| Ga0242676_10396651 | 3300022512 | Soil | EAAAKLKEAAASPKKSALLLLNRHGTTQYVGVNLSANQG |
| Ga0242658_10413722 | 3300022530 | Soil | EAAAKLKEAANSPKKSALLLLNRRGVTQYVGVNLSANQG |
| Ga0207692_101580331 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | AIDKHPVKTPQEAAEKLKDAATSAKKSALLLLNRRGVTQYVGVSLSANQG |
| Ga0207652_117632772 | 3300025921 | Corn Rhizosphere | EEAAQQLKEAANSPRKSALLLLNRRGMTQYVGINLGKNEG |
| Ga0207700_116260041 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MTGVRFSEQKLKEIANSPRKTALLLLNRHGTSQYVGLDLGKNEG |
| Ga0207677_105061422 | 3300026023 | Miscanthus Rhizosphere | NKLRQAAKSQQKTALLLLNRRGVTQYVGVKLGKDEG |
| Ga0257156_11179702 | 3300026498 | Soil | EAAGKLKEIAASSKKSALLLLNRHGVTQYVGVSLGENRG |
| Ga0208095_10037311 | 3300027104 | Forest Soil | TPQEAAGKLKEIAASSKKSALLLLNRHGVTQYVGVSLGENRG |
| Ga0209004_10055741 | 3300027376 | Forest Soil | NSPKEAAEKLKEVVASPKKSALLLLNRHGVTQYVGISVSGNSG |
| Ga0209447_100880652 | 3300027701 | Bog Forest Soil | RLNEAAHSPKKTVLLLLNRHGVTEYVGMSLGANQG |
| Ga0209447_100889491 | 3300027701 | Bog Forest Soil | EKLKQVAASPKKSALLLLNRHGVTQYVGVSLGGNSG |
| Ga0209655_101581681 | 3300027767 | Bog Forest Soil | AKLKEAAASPKKSALLLLNRRGVTQYVGVNLSANQG |
| Ga0209590_107841182 | 3300027882 | Vadose Zone Soil | QQLKEIAKSPKKTALLLLNRHGVTQYVGINLGKEQG |
| Ga0302219_101187392 | 3300028747 | Palsa | QEAADKLKDIANSPNKSALLLLNRHGVTQYLGIELGKNQG |
| Ga0308309_102188451 | 3300028906 | Soil | EAAAKLKEVAASPKKSALLLLNRRGVTQYVGVNLSTNQG |
| Ga0222749_104766202 | 3300029636 | Soil | QEAAEKLKDAATSAKKSALLLLNRRGVTQYVGVSLSANQG |
| Ga0210290_15303081 | 3300030532 | Soil | AAARINEAAHSPKKTVLLLLNRHGVTEYVGMSLGANQG |
| Ga0316363_104152231 | 3300030659 | Peatlands Soil | RTPQDAADRLKEIANSPNKTALLLLNRHGVTQYLGVEIGKNQG |
| Ga0265461_118124581 | 3300030743 | Soil | TPQEAAARLNEAGHSPKKTVLLLLNRHGVTEYVGMSLGANQG |
| Ga0308189_102197551 | 3300031058 | Soil | PQEAAAKLKEAAASPKKSALLLLDRRGVTQYVGVNLSANQG |
| Ga0265760_101660032 | 3300031090 | Soil | QPMTSPEETAARLRDIAKSPNKNALLLLNRHGVTQYLGIQLDKNQG |
| Ga0170824_1029741031 | 3300031231 | Forest Soil | NQQPVNTPQEAAGKLKEIAASPKKSALLLLNRRGVTQYVGVSLGDYRG |
| Ga0170824_1056631822 | 3300031231 | Forest Soil | EAAAKLKEAAASPKKSALLLLNRHGVTQYVGLNLSANQG |
| Ga0302324_1013989881 | 3300031236 | Palsa | RLKEIGDSPQKNALLLLDRHGVTQYVGVKLGKDEG |
| Ga0170819_128473591 | 3300031469 | Forest Soil | QEAAAKLTEAATSPKKSALLLLNRHGVTQYVGVNLGANQG |
| Ga0318541_108559221 | 3300031545 | Soil | AEKLKEVANSPKKSALLLLNRHGVTQYVGVNLGGNNG |
| Ga0265313_104169912 | 3300031595 | Rhizosphere | TPQEAADRLDEIAKSPQKTALLLLDRHGVTQYVGVTLGKNAG |
| Ga0318561_100274551 | 3300031679 | Soil | EKLKEVANSSKKNALLLLNRHGVTQYVGVNLANNNG |
| Ga0318561_100340073 | 3300031679 | Soil | SPQEAAEKLKEVAASPKKSALLLLNRHGVMQYVGVSLGGNSG |
| Ga0318561_108098752 | 3300031679 | Soil | NTPEQAAEKLKEVANSPRKSALLLLNRHGVTQYVGVNLSGNNG |
| Ga0318500_102231561 | 3300031724 | Soil | VKTPQEAGAKLKEAAAAPKKSVLLLLNRRGVTQYVGINLGANQG |
| Ga0318502_109788932 | 3300031747 | Soil | VNNPKEAADKLKEVANSPKKSALLLLNRHGVTQYVGVNLGSNNG |
| Ga0318537_102037212 | 3300031763 | Soil | PQEAVEKLKEIAASPKKSALLLLNRHGVTQYVGVSLGSDNG |
| Ga0318546_113532222 | 3300031771 | Soil | AVKTPQEAAAKLKEIAASPKKSALILLNRHGVTQYVGLTLGSNQG |
| Ga0318547_103303502 | 3300031781 | Soil | VKLKEAAAAPKKSVLLLLNRRGVTQYVGINLGANQG |
| Ga0318529_101464392 | 3300031792 | Soil | QEAAEKLKEVAASPKKSALLLLNRHGVMQYVGVSLGGNSG |
| Ga0318548_104899852 | 3300031793 | Soil | EAAEKLKEVASSSKKSALILLNRHGVAQYVGVSLGGNQG |
| Ga0318568_102059331 | 3300031819 | Soil | AAKLNEVANSPKKSALLLLNRHGVTQYVGVNLGSNNG |
| Ga0306919_100217951 | 3300031879 | Soil | AADKLKEVANSPKKSALLLLNRHGVTQYVGVNLGSNNG |
| Ga0306919_102460781 | 3300031879 | Soil | VNTPEEAAVKLKEVANSPKKSALLLLNRHGVTQYVGVNLGGNNG |
| Ga0306919_103366241 | 3300031879 | Soil | EAAAKLKEAAASPKKSALLLLNRRGVTQYVGVNLSANQG |
| Ga0306919_105356161 | 3300031879 | Soil | QEAVEKLKEIAASPKKSALLLLNRHGVTQYVGVSLGSDNG |
| Ga0306925_107998401 | 3300031890 | Soil | AAAKLNEVSKSSKKSALLLLNRHGVTQYVGVNLGNNNG |
| Ga0306923_104117821 | 3300031910 | Soil | EAAVKLKEVANSPKKSALLLLNRHGVTQYVGVNLGGNNG |
| Ga0306921_100284151 | 3300031912 | Soil | TPQEAAAKLNEAIHSPRKTALLLLNRHGVTEYIGVTLGANQG |
| Ga0310910_102406092 | 3300031946 | Soil | PEEAAAKLNEVSKSSKKSALLLLNRHGVTQYVGVNLGNNNG |
| Ga0306926_100510831 | 3300031954 | Soil | AGAKLKEAAAAPKKSVLLLLNRRGVTQYVGINLGANQG |
| Ga0306922_101889723 | 3300032001 | Soil | KLKEVANSPKKSALLLLNRHGVTQYVGVNLGGNNG |
| Ga0318549_100123961 | 3300032041 | Soil | EKLKEVANSSKKNALLLLNRHGVTQYVGVNLGNNNG |
| Ga0318510_101149602 | 3300032064 | Soil | IDQQPVNTPQEAAAKLKEIAASPKKSALLLLNRRGVTQYVGVNLGANQG |
| Ga0318510_102329831 | 3300032064 | Soil | PKEAADKLKEVANSPKKSALLLLNRHGVTQYVGVNLGSNNG |
| Ga0318514_105912522 | 3300032066 | Soil | EAAEKLKEIAASPKKSALLLLNRRGVTQYVGLNLRANQG |
| Ga0318553_100220481 | 3300032068 | Soil | NTPREAAEKLKEIAASPKKSALLLLNRRGVTQYVGLNLRANQG |
| Ga0318553_102144041 | 3300032068 | Soil | KEAADKLKEVANSPKKSALLLLNRHGVTQYVGVNLGSNNG |
| Ga0311301_116996851 | 3300032160 | Peatlands Soil | VRTPQEAAAKLTGVPASPKKNILLLLNRHGVTQYVGMELGKNQG |
| Ga0307472_1003573641 | 3300032205 | Hardwood Forest Soil | KTPQEAAGKLKEIAASSKKSALLLLNRRGITQYVGVSLGDNRG |
| Ga0348332_116258391 | 3300032515 | Plant Litter | AARLRDIAKSPNKNALLLLNRHGVTQYLGVELGKNQG |
| Ga0335076_114883771 | 3300032955 | Soil | ADKLREIANAPNKSALLLLNRHGVTQYLGVELNKG |
| Ga0318519_100273351 | 3300033290 | Soil | KEAAEKLKEVANSSKKNALLLLNRHGVTQYVGVNLANNNG |
| Ga0316624_110051692 | 3300033486 | Soil | VGSPEEAARTLKEIAKSPQKNALLLLNRHGVTQYVGVSLGKDEG |
| Ga0370548_050848_38_196 | 3300034644 | Soil | VVAIDQQPVKTPQEAAAKLKEAAASPKKSALLLLDRRGVAQYVGINLSANQG |
| ⦗Top⦘ |